--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:16:14 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/sdhC/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -630.17          -632.94
2       -630.12          -632.87
--------------------------------------
TOTAL     -630.15          -632.91
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.895467    0.088758    0.341366    1.458674    0.865281   1371.67   1436.33    1.000
r(A<->C){all}   0.168815    0.019752    0.000048    0.439890    0.135987     92.72    211.62    1.002
r(A<->G){all}   0.167028    0.020190    0.000055    0.448200    0.131661    152.12    315.77    1.010
r(A<->T){all}   0.162905    0.018367    0.000034    0.425846    0.128373    267.07    337.72    1.001
r(C<->G){all}   0.173965    0.021164    0.000216    0.469932    0.136393    167.91    245.76    1.000
r(C<->T){all}   0.157300    0.018560    0.000003    0.431754    0.116613    134.70    200.52    1.006
r(G<->T){all}   0.169986    0.021863    0.000025    0.476445    0.128026    161.91    195.43    1.000
pi(A){all}      0.191936    0.000340    0.155658    0.227444    0.191417   1176.67   1332.13    1.000
pi(C){all}      0.296358    0.000458    0.254796    0.337559    0.295432   1206.21   1248.07    1.000
pi(G){all}      0.293977    0.000431    0.255530    0.336018    0.293590   1052.50   1153.57    1.000
pi(T){all}      0.217729    0.000372    0.180788    0.254163    0.217399   1113.18   1147.97    1.000
alpha{1,2}      0.411589    0.218317    0.000171    1.348548    0.238010   1238.73   1321.94    1.000
alpha{3}        0.460934    0.256817    0.000111    1.492665    0.297549    940.95   1119.12    1.000
pinvar{all}     0.996692    0.000014    0.989332    0.999996    0.997910   1138.48   1237.35    1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-602.884864
Model 2: PositiveSelection	-602.88487
Model 0: one-ratio	-602.88487
Model 7: beta	-602.88486
Model 8: beta&w>1	-602.88486


Model 0 vs 1	1.1999999969702912E-5

Model 2 vs 1	1.1999999969702912E-5

Model 8 vs 7	0.0
>C1
VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
HFR
>C2
VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
HFR
>C3
VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
HFR
>C4
VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
HFR
>C5
VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
HFR
>C6
VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
HFR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=153 

C1              VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
C2              VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
C3              VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
C4              VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
C5              VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
C6              VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
                **************************************************

C1              FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
C2              FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
C3              FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
C4              FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
C5              FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
C6              FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
                **************************************************

C1              IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
C2              IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
C3              IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
C4              IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
C5              IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
C6              IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
                **************************************************

C1              HFR
C2              HFR
C3              HFR
C4              HFR
C5              HFR
C6              HFR
                ***




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  153 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  153 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4590]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [4590]--->[4590]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.457 Mb, Max= 30.677 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
C2              VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
C3              VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
C4              VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
C5              VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
C6              VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
                **************************************************

C1              FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
C2              FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
C3              FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
C4              FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
C5              FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
C6              FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
                **************************************************

C1              IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
C2              IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
C3              IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
C4              IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
C5              IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
C6              IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
                **************************************************

C1              HFR
C2              HFR
C3              HFR
C4              HFR
C5              HFR
C6              HFR
                ***




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC
C2              GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC
C3              GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC
C4              GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC
C5              GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC
C6              GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC
                **************************************************

C1              AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC
C2              AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC
C3              AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC
C4              AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC
C5              AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC
C6              AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC
                **************************************************

C1              CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC
C2              CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC
C3              CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC
C4              CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC
C5              CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC
C6              CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC
                **************************************************

C1              TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC
C2              TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC
C3              TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC
C4              TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC
C5              TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC
C6              TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC
                **************************************************

C1              GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT
C2              GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT
C3              GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT
C4              GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT
C5              GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT
C6              GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT
                **************************************************

C1              TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG
C2              TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG
C3              TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG
C4              TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG
C5              TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG
C6              TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG
                **************************************************

C1              ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG
C2              ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG
C3              ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG
C4              ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG
C5              ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG
C6              ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG
                **************************************************

C1              GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG
C2              GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG
C3              GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG
C4              GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG
C5              GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG
C6              GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG
                **************************************************

C1              CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG
C2              CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG
C3              CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG
C4              CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG
C5              CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG
C6              CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG
                **************************************************

C1              CACTTCCGA
C2              CACTTCCGA
C3              CACTTCCGA
C4              CACTTCCGA
C5              CACTTCCGA
C6              CACTTCCGA
                *********



>C1
GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC
AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC
CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC
TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC
GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT
TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG
ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG
GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG
CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG
CACTTCCGA
>C2
GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC
AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC
CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC
TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC
GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT
TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG
ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG
GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG
CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG
CACTTCCGA
>C3
GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC
AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC
CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC
TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC
GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT
TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG
ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG
GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG
CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG
CACTTCCGA
>C4
GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC
AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC
CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC
TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC
GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT
TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG
ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG
GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG
CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG
CACTTCCGA
>C5
GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC
AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC
CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC
TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC
GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT
TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG
ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG
GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG
CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG
CACTTCCGA
>C6
GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC
AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC
CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC
TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC
GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT
TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG
ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG
GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG
CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG
CACTTCCGA
>C1
VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
HFR
>C2
VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
HFR
>C3
VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
HFR
>C4
VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
HFR
>C5
VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
HFR
>C6
VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
HFR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 459 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579788900
      Setting output file names to "/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1129409138
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0673915379
      Seed = 572579534
      Swapseed = 1579788900
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1027.264005 -- -24.965149
         Chain 2 -- -1027.264005 -- -24.965149
         Chain 3 -- -1027.264005 -- -24.965149
         Chain 4 -- -1027.264005 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1027.264005 -- -24.965149
         Chain 2 -- -1027.263946 -- -24.965149
         Chain 3 -- -1027.264005 -- -24.965149
         Chain 4 -- -1027.264005 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1027.264] (-1027.264) (-1027.264) (-1027.264) * [-1027.264] (-1027.264) (-1027.264) (-1027.264) 
        500 -- (-647.107) (-646.589) (-637.176) [-641.467] * (-641.685) [-635.830] (-638.917) (-642.641) -- 0:00:00
       1000 -- (-637.070) (-643.422) [-638.070] (-645.328) * (-636.335) (-635.287) [-637.524] (-643.290) -- 0:00:00
       1500 -- (-642.232) (-642.927) [-638.129] (-640.496) * (-650.131) (-639.135) [-642.155] (-638.980) -- 0:00:00
       2000 -- (-638.245) (-641.130) (-639.292) [-634.254] * (-641.787) (-640.755) [-642.976] (-643.421) -- 0:00:00
       2500 -- (-636.240) [-639.744] (-641.729) (-641.282) * (-639.962) (-657.570) (-641.754) [-637.636] -- 0:00:00
       3000 -- (-643.100) (-637.620) (-639.241) [-638.931] * (-640.167) (-648.255) [-639.381] (-642.113) -- 0:00:00
       3500 -- (-647.785) (-638.378) [-641.504] (-637.705) * (-641.784) (-640.049) (-639.768) [-642.527] -- 0:00:00
       4000 -- (-643.815) (-633.357) (-644.403) [-636.948] * (-639.243) [-633.115] (-641.283) (-637.961) -- 0:00:00
       4500 -- (-646.008) (-642.132) [-644.455] (-639.316) * (-647.182) [-640.710] (-641.675) (-640.639) -- 0:00:00
       5000 -- (-641.110) (-641.420) [-640.166] (-642.734) * (-638.980) (-642.958) [-634.061] (-639.275) -- 0:03:19

      Average standard deviation of split frequencies: 0.078567

       5500 -- (-646.517) (-637.432) (-638.016) [-642.568] * (-640.443) (-640.869) (-639.328) [-645.307] -- 0:03:00
       6000 -- (-639.262) [-634.736] (-643.484) (-656.084) * (-640.555) [-638.389] (-642.693) (-641.109) -- 0:02:45
       6500 -- [-637.410] (-640.624) (-652.523) (-646.398) * (-640.913) (-633.442) (-644.526) [-639.541] -- 0:02:32
       7000 -- (-643.113) (-653.433) [-638.969] (-643.371) * (-646.739) (-637.766) (-644.070) [-637.828] -- 0:02:21
       7500 -- (-634.514) (-647.982) (-638.312) [-644.956] * (-649.376) [-640.054] (-646.810) (-643.588) -- 0:02:12
       8000 -- (-640.903) (-636.020) [-643.705] (-657.832) * (-645.155) [-633.692] (-643.131) (-640.462) -- 0:02:04
       8500 -- (-639.759) [-635.134] (-643.339) (-630.219) * (-639.335) (-644.758) (-637.475) [-637.022] -- 0:01:56
       9000 -- [-638.932] (-645.543) (-641.369) (-631.425) * (-638.375) [-636.943] (-641.955) (-637.123) -- 0:01:50
       9500 -- (-641.773) (-638.393) (-644.364) [-629.724] * (-644.047) (-638.439) (-641.087) [-641.960] -- 0:01:44
      10000 -- (-644.323) (-642.411) (-643.211) [-631.280] * (-643.868) (-636.907) (-642.532) [-639.323] -- 0:01:39

      Average standard deviation of split frequencies: 0.069780

      10500 -- (-639.589) (-639.693) (-630.985) [-631.704] * [-636.565] (-650.617) (-648.321) (-645.580) -- 0:01:34
      11000 -- (-635.336) [-638.038] (-631.069) (-630.828) * (-642.478) (-640.385) [-635.899] (-643.751) -- 0:01:29
      11500 -- (-635.137) (-642.563) [-631.209] (-629.259) * (-633.504) (-649.298) (-644.112) [-633.083] -- 0:01:25
      12000 -- (-642.018) [-643.185] (-630.005) (-633.569) * [-641.188] (-641.798) (-643.570) (-635.915) -- 0:01:22
      12500 -- (-640.883) (-646.110) [-631.256] (-629.684) * (-642.736) (-643.042) [-634.376] (-643.523) -- 0:01:19
      13000 -- (-638.458) [-639.204] (-630.128) (-633.299) * [-640.199] (-650.826) (-645.147) (-642.679) -- 0:01:15
      13500 -- [-639.265] (-639.264) (-633.481) (-633.395) * [-639.594] (-642.300) (-638.699) (-644.161) -- 0:01:13
      14000 -- (-638.417) (-643.449) (-633.302) [-631.182] * (-643.674) (-641.617) [-643.519] (-645.934) -- 0:01:10
      14500 -- [-643.261] (-639.390) (-631.103) (-629.362) * (-645.119) [-640.099] (-640.711) (-650.792) -- 0:01:07
      15000 -- (-639.551) [-637.654] (-632.181) (-629.511) * (-640.543) (-637.078) [-639.253] (-644.028) -- 0:01:05

      Average standard deviation of split frequencies: 0.052378

      15500 -- [-632.490] (-637.678) (-632.835) (-631.413) * (-633.536) [-635.795] (-644.172) (-641.479) -- 0:01:03
      16000 -- (-643.039) (-634.996) [-629.532] (-629.009) * [-636.245] (-640.444) (-648.387) (-638.236) -- 0:01:01
      16500 -- (-643.367) [-638.864] (-631.290) (-629.092) * [-633.717] (-636.063) (-638.338) (-638.668) -- 0:00:59
      17000 -- (-639.339) (-639.278) (-630.290) [-631.399] * [-639.218] (-640.645) (-642.560) (-639.444) -- 0:00:57
      17500 -- (-639.095) [-638.016] (-631.344) (-631.502) * (-639.713) (-636.695) [-639.561] (-639.312) -- 0:00:56
      18000 -- [-638.024] (-640.030) (-628.905) (-630.835) * (-638.732) (-641.135) [-637.237] (-653.024) -- 0:00:54
      18500 -- (-645.003) [-645.274] (-631.536) (-631.168) * (-651.165) [-639.456] (-644.627) (-640.063) -- 0:00:53
      19000 -- [-635.594] (-642.723) (-633.210) (-632.359) * [-640.209] (-641.085) (-652.342) (-641.442) -- 0:00:51
      19500 -- (-643.947) (-642.451) (-632.155) [-633.939] * (-643.629) [-640.744] (-655.191) (-645.641) -- 0:00:50
      20000 -- (-642.258) (-645.365) (-630.350) [-635.067] * (-638.729) (-645.648) (-639.811) [-636.381] -- 0:01:38

      Average standard deviation of split frequencies: 0.059740

      20500 -- [-639.195] (-642.281) (-630.384) (-631.326) * (-643.225) (-657.291) (-645.871) [-641.717] -- 0:01:35
      21000 -- (-647.582) (-637.393) [-632.142] (-631.860) * (-633.543) (-645.041) (-644.747) [-637.681] -- 0:01:33
      21500 -- [-639.484] (-640.208) (-632.977) (-630.935) * (-631.533) [-639.492] (-642.132) (-641.061) -- 0:01:31
      22000 -- (-646.431) (-647.860) (-631.593) [-631.046] * (-629.779) (-637.694) (-643.394) [-636.704] -- 0:01:28
      22500 -- (-637.704) [-648.451] (-628.716) (-633.785) * (-631.757) (-642.243) (-638.074) [-636.815] -- 0:01:26
      23000 -- (-645.230) (-638.678) (-629.760) [-629.439] * [-631.814] (-632.809) (-641.138) (-638.332) -- 0:01:24
      23500 -- [-635.436] (-648.629) (-631.062) (-631.156) * (-632.613) (-633.013) (-645.222) [-639.486] -- 0:01:23
      24000 -- (-645.945) [-643.220] (-629.230) (-630.767) * (-633.129) [-632.696] (-640.722) (-644.578) -- 0:01:21
      24500 -- (-633.812) [-645.840] (-631.168) (-632.404) * (-628.835) [-629.454] (-643.624) (-649.235) -- 0:01:19
      25000 -- (-642.325) (-644.949) [-629.954] (-632.662) * (-629.449) [-629.506] (-638.883) (-640.301) -- 0:01:18

      Average standard deviation of split frequencies: 0.057546

      25500 -- (-639.675) (-638.720) [-630.264] (-632.435) * (-628.849) (-630.315) [-639.545] (-644.930) -- 0:01:16
      26000 -- (-641.403) (-637.885) (-634.659) [-630.011] * [-633.238] (-628.890) (-639.513) (-636.731) -- 0:01:14
      26500 -- (-636.667) (-641.126) [-631.569] (-630.253) * (-632.820) [-632.913] (-643.224) (-635.786) -- 0:01:13
      27000 -- (-638.106) (-634.630) [-629.095] (-631.339) * [-630.194] (-632.227) (-654.305) (-640.481) -- 0:01:12
      27500 -- (-642.303) [-636.191] (-634.582) (-631.698) * [-629.340] (-628.864) (-638.459) (-640.248) -- 0:01:10
      28000 -- (-638.067) (-639.369) [-630.624] (-630.945) * (-629.419) (-629.093) (-630.839) [-639.419] -- 0:01:09
      28500 -- (-639.883) (-633.730) (-632.049) [-631.111] * (-631.168) [-630.229] (-628.541) (-641.368) -- 0:01:08
      29000 -- [-641.057] (-644.324) (-631.124) (-630.888) * (-637.109) (-630.120) (-631.455) [-636.260] -- 0:01:06
      29500 -- (-641.520) (-639.113) [-631.622] (-631.384) * (-632.013) [-635.394] (-632.496) (-645.853) -- 0:01:05
      30000 -- (-640.266) (-644.458) [-633.981] (-629.468) * (-633.855) [-631.348] (-634.428) (-643.530) -- 0:01:04

      Average standard deviation of split frequencies: 0.051007

      30500 -- [-640.345] (-644.145) (-638.113) (-632.228) * (-631.500) [-634.281] (-638.256) (-653.765) -- 0:01:03
      31000 -- (-638.531) (-635.170) [-630.181] (-633.476) * [-629.515] (-629.514) (-629.884) (-642.376) -- 0:01:02
      31500 -- (-632.049) (-631.683) [-631.772] (-630.440) * (-630.915) (-632.118) (-633.262) [-644.616] -- 0:01:01
      32000 -- [-629.367] (-633.454) (-631.246) (-630.488) * (-630.798) [-629.875] (-633.804) (-639.636) -- 0:01:00
      32500 -- (-629.034) [-630.274] (-631.015) (-631.103) * [-633.314] (-629.090) (-631.288) (-644.078) -- 0:00:59
      33000 -- (-629.234) (-631.513) (-629.639) [-629.929] * (-629.370) [-632.397] (-629.235) (-643.370) -- 0:00:58
      33500 -- [-629.319] (-630.893) (-630.192) (-629.819) * [-628.896] (-630.406) (-629.687) (-640.473) -- 0:00:57
      34000 -- (-632.444) (-630.879) [-629.578] (-632.729) * (-629.591) (-629.621) [-629.575] (-634.139) -- 0:00:56
      34500 -- [-630.729] (-631.423) (-630.476) (-630.941) * (-633.738) [-634.980] (-632.704) (-642.448) -- 0:00:55
      35000 -- (-631.596) (-630.045) [-630.065] (-632.585) * (-629.460) [-628.646] (-636.984) (-635.912) -- 0:00:55

      Average standard deviation of split frequencies: 0.051131

      35500 -- (-632.342) (-630.071) (-629.299) [-631.981] * (-630.973) (-629.676) [-631.042] (-641.136) -- 0:01:21
      36000 -- [-628.953] (-631.749) (-633.499) (-631.326) * (-630.251) (-632.516) (-633.163) [-640.447] -- 0:01:20
      36500 -- (-629.762) (-629.159) (-631.485) [-630.603] * [-629.450] (-633.460) (-630.477) (-641.837) -- 0:01:19
      37000 -- [-628.978] (-628.609) (-630.663) (-632.351) * (-629.515) (-630.228) [-631.088] (-641.915) -- 0:01:18
      37500 -- [-630.604] (-630.322) (-629.498) (-630.083) * (-630.442) [-630.095] (-633.234) (-651.817) -- 0:01:17
      38000 -- [-631.055] (-630.315) (-631.442) (-629.806) * (-635.274) [-630.048] (-630.263) (-638.683) -- 0:01:15
      38500 -- (-629.973) [-629.253] (-630.946) (-632.725) * (-629.361) (-631.219) (-630.163) [-641.737] -- 0:01:14
      39000 -- [-629.445] (-629.117) (-634.764) (-629.833) * (-628.745) (-631.362) [-629.258] (-643.578) -- 0:01:13
      39500 -- [-629.991] (-632.231) (-630.580) (-629.588) * (-630.076) (-631.836) (-629.575) [-639.793] -- 0:01:12
      40000 -- (-632.095) (-629.718) [-629.972] (-630.112) * (-629.713) (-633.479) (-629.093) [-638.726] -- 0:01:12

      Average standard deviation of split frequencies: 0.049418

      40500 -- (-629.593) (-635.341) (-631.138) [-629.135] * (-629.038) (-634.747) [-629.315] (-642.339) -- 0:01:11
      41000 -- (-632.908) (-633.039) [-629.010] (-629.837) * (-631.845) [-631.337] (-629.748) (-635.181) -- 0:01:10
      41500 -- (-630.305) (-630.533) (-628.481) [-629.305] * (-632.961) (-629.154) [-630.723] (-641.757) -- 0:01:09
      42000 -- (-633.817) [-630.011] (-630.627) (-630.427) * (-629.477) (-632.383) (-629.641) [-642.091] -- 0:01:08
      42500 -- [-633.884] (-634.333) (-630.434) (-630.722) * [-631.111] (-629.497) (-629.154) (-643.588) -- 0:01:07
      43000 -- (-632.993) (-636.145) [-630.509] (-631.926) * (-631.596) (-631.125) [-631.228] (-665.009) -- 0:01:06
      43500 -- (-630.772) (-631.059) [-632.277] (-630.700) * [-628.820] (-633.418) (-632.068) (-639.167) -- 0:01:05
      44000 -- (-632.692) (-629.849) (-630.172) [-632.777] * [-628.592] (-629.451) (-629.970) (-632.433) -- 0:01:05
      44500 -- (-631.787) (-629.818) [-632.332] (-631.685) * [-630.202] (-631.983) (-630.869) (-634.639) -- 0:01:04
      45000 -- [-629.784] (-630.102) (-628.919) (-634.734) * [-629.080] (-631.848) (-629.877) (-632.503) -- 0:01:03

      Average standard deviation of split frequencies: 0.040101

      45500 -- (-632.097) (-630.321) [-630.013] (-630.798) * (-631.902) [-629.301] (-631.031) (-630.954) -- 0:01:02
      46000 -- [-630.648] (-629.501) (-632.014) (-633.177) * (-632.860) (-630.909) [-632.532] (-635.458) -- 0:01:02
      46500 -- (-631.636) (-631.250) (-633.135) [-629.991] * (-629.843) (-632.424) [-632.432] (-631.437) -- 0:01:01
      47000 -- (-633.354) (-635.670) [-629.908] (-629.870) * (-629.892) (-632.576) (-630.837) [-630.020] -- 0:01:00
      47500 -- [-631.107] (-630.316) (-630.571) (-629.972) * [-630.516] (-629.628) (-631.236) (-629.906) -- 0:01:00
      48000 -- [-628.724] (-629.083) (-636.445) (-630.374) * (-630.112) (-630.740) (-631.661) [-629.896] -- 0:00:59
      48500 -- (-628.755) (-630.144) (-631.598) [-632.722] * [-632.085] (-630.513) (-629.476) (-632.993) -- 0:00:58
      49000 -- [-628.792] (-633.645) (-632.605) (-631.274) * (-630.773) [-630.175] (-633.656) (-629.842) -- 0:00:58
      49500 -- (-629.287) (-629.381) [-630.223] (-634.127) * [-631.303] (-635.266) (-632.362) (-628.718) -- 0:00:57
      50000 -- (-631.070) (-630.222) (-629.914) [-631.379] * (-632.442) (-633.352) (-630.846) [-630.287] -- 0:00:57

      Average standard deviation of split frequencies: 0.044829

      50500 -- [-630.286] (-631.038) (-631.395) (-633.019) * (-631.163) [-632.518] (-630.097) (-630.828) -- 0:01:15
      51000 -- (-631.568) (-629.628) (-632.452) [-632.857] * (-629.298) [-632.102] (-631.974) (-633.305) -- 0:01:14
      51500 -- (-638.950) [-629.224] (-629.489) (-634.819) * (-629.595) [-631.209] (-629.667) (-630.870) -- 0:01:13
      52000 -- [-633.412] (-629.695) (-629.486) (-630.864) * (-631.303) [-634.119] (-630.970) (-631.201) -- 0:01:12
      52500 -- (-631.121) (-633.191) [-630.084] (-629.914) * (-630.388) (-631.776) [-631.019] (-630.017) -- 0:01:12
      53000 -- (-631.371) (-631.588) [-629.693] (-631.441) * (-631.173) (-631.061) [-631.495] (-629.807) -- 0:01:11
      53500 -- (-635.576) (-633.526) (-629.030) [-630.566] * [-629.027] (-631.612) (-632.459) (-634.419) -- 0:01:10
      54000 -- (-630.190) (-631.118) [-629.337] (-630.738) * [-629.726] (-630.621) (-634.677) (-631.869) -- 0:01:10
      54500 -- (-631.740) [-633.613] (-631.296) (-629.562) * (-629.894) (-630.470) [-635.238] (-632.048) -- 0:01:09
      55000 -- (-630.709) (-636.195) (-631.798) [-630.577] * (-634.246) (-631.339) [-632.667] (-632.159) -- 0:01:08

      Average standard deviation of split frequencies: 0.042891

      55500 -- (-630.766) (-641.039) [-632.585] (-630.061) * (-629.499) [-631.408] (-632.363) (-632.238) -- 0:01:08
      56000 -- (-631.774) (-632.976) (-636.881) [-628.973] * [-629.993] (-629.901) (-632.927) (-632.742) -- 0:01:07
      56500 -- (-632.501) (-630.260) [-630.132] (-631.788) * (-630.396) [-631.412] (-630.926) (-632.166) -- 0:01:06
      57000 -- (-636.171) (-631.058) [-631.246] (-630.670) * (-629.599) (-632.763) [-633.032] (-631.018) -- 0:01:06
      57500 -- (-631.629) (-631.469) [-630.877] (-632.793) * [-630.318] (-633.204) (-629.494) (-631.258) -- 0:01:05
      58000 -- (-629.185) (-628.688) (-631.807) [-628.999] * (-630.449) (-631.252) (-630.330) [-633.828] -- 0:01:04
      58500 -- [-629.796] (-630.174) (-631.503) (-629.584) * (-632.192) [-629.901] (-630.208) (-633.743) -- 0:01:04
      59000 -- (-629.434) (-629.564) [-630.420] (-629.859) * (-631.461) (-629.468) [-629.826] (-631.273) -- 0:01:03
      59500 -- [-630.424] (-630.888) (-630.076) (-632.207) * (-629.486) (-630.376) [-628.807] (-632.492) -- 0:01:03
      60000 -- (-630.781) (-629.023) [-629.976] (-633.950) * (-628.832) (-632.904) [-628.818] (-632.301) -- 0:01:02

      Average standard deviation of split frequencies: 0.044402

      60500 -- (-634.328) (-630.331) (-631.808) [-629.716] * [-630.223] (-636.574) (-630.320) (-633.592) -- 0:01:02
      61000 -- (-630.917) (-632.795) [-630.121] (-632.683) * [-631.538] (-635.290) (-631.202) (-632.401) -- 0:01:01
      61500 -- (-631.363) [-630.333] (-629.496) (-634.401) * [-632.129] (-633.991) (-634.450) (-634.507) -- 0:01:01
      62000 -- [-629.895] (-629.543) (-629.552) (-633.277) * (-630.543) (-631.509) [-633.394] (-630.173) -- 0:01:00
      62500 -- [-632.832] (-630.986) (-628.956) (-629.428) * [-633.568] (-629.043) (-630.083) (-630.356) -- 0:01:00
      63000 -- (-630.266) (-632.112) [-629.570] (-632.721) * [-632.914] (-631.445) (-628.879) (-631.810) -- 0:00:59
      63500 -- (-630.193) (-629.601) (-628.677) [-631.110] * (-632.295) (-631.434) (-629.092) [-630.333] -- 0:00:58
      64000 -- [-633.754] (-629.790) (-631.815) (-630.656) * (-630.331) (-638.588) [-630.553] (-629.746) -- 0:00:58
      64500 -- (-631.287) (-630.892) [-633.873] (-631.399) * (-630.525) (-629.780) [-631.726] (-629.599) -- 0:00:58
      65000 -- [-628.676] (-633.024) (-635.653) (-632.453) * (-631.707) (-631.196) (-631.738) [-631.399] -- 0:00:57

      Average standard deviation of split frequencies: 0.043476

      65500 -- (-633.891) (-630.740) [-631.324] (-629.768) * (-632.248) (-631.431) (-632.244) [-631.300] -- 0:01:11
      66000 -- [-632.074] (-629.285) (-630.255) (-630.663) * [-629.233] (-633.122) (-632.543) (-631.359) -- 0:01:10
      66500 -- (-635.743) [-631.964] (-635.911) (-629.890) * (-631.354) (-631.283) [-630.284] (-632.437) -- 0:01:10
      67000 -- [-632.502] (-631.194) (-630.651) (-632.842) * (-633.424) (-630.380) [-631.486] (-630.223) -- 0:01:09
      67500 -- (-630.325) (-630.812) (-631.569) [-629.110] * (-629.552) [-629.926] (-631.822) (-632.105) -- 0:01:09
      68000 -- (-631.066) [-631.966] (-630.651) (-631.596) * [-631.778] (-632.846) (-631.408) (-630.744) -- 0:01:08
      68500 -- (-629.771) (-629.588) (-630.989) [-633.478] * [-630.595] (-635.321) (-629.670) (-631.169) -- 0:01:07
      69000 -- (-631.772) (-630.087) (-631.050) [-637.122] * (-632.214) (-630.464) (-632.654) [-629.255] -- 0:01:07
      69500 -- [-633.532] (-630.940) (-630.722) (-633.493) * [-629.743] (-631.231) (-632.208) (-629.352) -- 0:01:06
      70000 -- [-633.483] (-631.752) (-631.601) (-635.573) * [-630.024] (-631.205) (-633.737) (-630.216) -- 0:01:06

      Average standard deviation of split frequencies: 0.046406

      70500 -- (-629.314) (-632.935) [-629.583] (-632.460) * (-632.137) (-632.754) [-629.548] (-630.727) -- 0:01:05
      71000 -- [-632.235] (-630.385) (-628.690) (-634.485) * (-629.706) [-632.331] (-630.266) (-628.943) -- 0:01:05
      71500 -- (-629.948) (-631.202) [-630.667] (-632.805) * (-631.224) [-630.413] (-633.262) (-630.147) -- 0:01:04
      72000 -- (-628.764) (-632.915) (-629.944) [-629.988] * [-631.880] (-628.618) (-636.661) (-631.762) -- 0:01:04
      72500 -- [-629.037] (-631.450) (-632.991) (-631.322) * [-629.394] (-628.876) (-630.196) (-632.333) -- 0:01:03
      73000 -- (-631.139) [-632.022] (-629.846) (-632.867) * (-628.784) [-628.997] (-631.074) (-633.516) -- 0:01:03
      73500 -- (-632.903) [-630.507] (-630.276) (-631.865) * (-631.387) (-631.121) [-630.436] (-629.241) -- 0:01:03
      74000 -- (-629.659) (-635.777) [-630.023] (-632.643) * (-631.266) (-630.223) [-630.514] (-629.254) -- 0:01:02
      74500 -- (-630.598) (-634.764) (-630.531) [-631.211] * (-636.536) [-629.671] (-632.865) (-630.962) -- 0:01:02
      75000 -- (-630.224) [-632.295] (-629.188) (-630.658) * (-629.443) [-631.248] (-636.267) (-632.049) -- 0:01:01

      Average standard deviation of split frequencies: 0.042610

      75500 -- (-629.710) [-632.865] (-632.278) (-629.354) * (-630.999) (-631.461) (-634.148) [-629.578] -- 0:01:01
      76000 -- [-630.973] (-629.707) (-629.675) (-630.462) * (-633.336) [-629.340] (-636.015) (-630.103) -- 0:01:00
      76500 -- [-629.619] (-629.365) (-632.273) (-631.470) * (-629.934) [-631.242] (-633.059) (-632.707) -- 0:01:00
      77000 -- (-631.014) [-632.856] (-635.919) (-632.056) * (-631.107) [-629.720] (-632.565) (-630.384) -- 0:00:59
      77500 -- (-628.901) [-635.592] (-634.565) (-631.720) * (-631.965) (-635.184) [-632.995] (-631.445) -- 0:00:59
      78000 -- [-629.447] (-635.138) (-632.265) (-630.744) * (-631.117) (-631.772) [-632.995] (-630.164) -- 0:00:59
      78500 -- (-630.588) (-635.135) (-636.628) [-630.247] * (-631.823) (-633.686) [-629.459] (-630.730) -- 0:00:58
      79000 -- (-630.580) (-631.844) [-628.915] (-631.150) * (-632.287) [-631.866] (-633.199) (-631.962) -- 0:00:58
      79500 -- [-630.720] (-632.086) (-628.710) (-631.830) * (-630.605) [-629.199] (-634.838) (-629.063) -- 0:00:57
      80000 -- (-631.783) [-631.310] (-630.523) (-632.777) * [-630.214] (-628.974) (-632.327) (-632.922) -- 0:00:57

      Average standard deviation of split frequencies: 0.040907

      80500 -- [-631.164] (-633.411) (-628.792) (-629.115) * (-631.850) [-628.546] (-630.970) (-632.222) -- 0:00:57
      81000 -- (-634.610) (-634.195) [-628.944] (-628.934) * [-630.653] (-630.878) (-629.568) (-630.935) -- 0:00:56
      81500 -- (-637.899) [-630.328] (-629.216) (-630.446) * (-631.422) [-630.260] (-631.949) (-630.059) -- 0:00:56
      82000 -- (-632.012) [-630.997] (-630.843) (-632.858) * (-631.006) (-630.867) [-632.838] (-630.803) -- 0:00:55
      82500 -- (-630.583) (-631.215) (-629.154) [-631.356] * [-631.329] (-629.418) (-637.556) (-631.364) -- 0:00:55
      83000 -- (-631.802) [-632.109] (-631.483) (-630.488) * (-631.006) (-631.290) (-634.770) [-633.797] -- 0:01:06
      83500 -- (-630.612) (-631.440) (-629.756) [-630.340] * (-629.500) [-632.408] (-633.834) (-632.177) -- 0:01:05
      84000 -- [-632.581] (-630.730) (-631.223) (-628.994) * [-630.908] (-632.873) (-629.216) (-631.075) -- 0:01:05
      84500 -- [-632.468] (-634.666) (-637.309) (-629.869) * (-630.817) (-630.526) (-629.944) [-632.133] -- 0:01:05
      85000 -- [-630.236] (-636.510) (-629.438) (-629.737) * (-633.147) [-628.860] (-630.309) (-631.145) -- 0:01:04

      Average standard deviation of split frequencies: 0.038121

      85500 -- [-629.262] (-632.776) (-630.025) (-629.222) * [-633.356] (-631.073) (-633.127) (-629.545) -- 0:01:04
      86000 -- [-628.804] (-631.529) (-630.303) (-631.750) * [-631.354] (-634.280) (-629.809) (-634.189) -- 0:01:03
      86500 -- [-633.642] (-630.587) (-632.705) (-632.086) * (-632.107) (-634.802) [-630.915] (-632.009) -- 0:01:03
      87000 -- [-629.186] (-632.467) (-631.930) (-630.644) * (-631.569) [-629.168] (-632.240) (-632.398) -- 0:01:02
      87500 -- (-632.729) (-631.831) [-631.948] (-630.289) * [-631.274] (-629.472) (-634.543) (-631.563) -- 0:01:02
      88000 -- (-634.140) (-630.189) [-629.213] (-630.423) * (-629.335) [-631.336] (-631.659) (-631.297) -- 0:01:02
      88500 -- (-631.519) [-631.158] (-630.320) (-634.283) * [-628.646] (-633.334) (-630.189) (-629.713) -- 0:01:01
      89000 -- [-632.779] (-630.214) (-630.650) (-631.654) * (-629.842) (-630.975) (-629.559) [-629.337] -- 0:01:01
      89500 -- (-630.790) (-629.711) (-630.628) [-631.092] * [-629.279] (-630.841) (-631.745) (-633.005) -- 0:01:01
      90000 -- (-631.358) (-629.903) [-632.016] (-637.120) * (-632.651) (-629.303) [-634.956] (-630.384) -- 0:01:00

      Average standard deviation of split frequencies: 0.038759

      90500 -- [-629.974] (-633.190) (-629.635) (-631.056) * [-630.270] (-633.782) (-636.029) (-632.122) -- 0:01:00
      91000 -- [-630.497] (-631.982) (-631.853) (-630.657) * (-631.142) (-632.993) [-632.807] (-629.563) -- 0:00:59
      91500 -- [-629.186] (-634.183) (-632.587) (-630.969) * (-632.541) (-630.855) (-639.207) [-629.453] -- 0:00:59
      92000 -- (-629.649) (-633.562) (-632.730) [-630.580] * [-630.360] (-630.401) (-633.775) (-630.209) -- 0:00:59
      92500 -- (-631.390) (-636.059) [-630.859] (-631.538) * (-632.055) (-630.952) [-628.960] (-629.562) -- 0:00:58
      93000 -- (-630.343) (-634.625) [-630.411] (-630.610) * [-633.461] (-629.107) (-629.189) (-629.610) -- 0:00:58
      93500 -- (-630.196) (-630.677) (-632.602) [-629.676] * [-632.827] (-629.256) (-629.189) (-630.644) -- 0:00:58
      94000 -- (-630.734) (-629.840) (-634.698) [-629.544] * (-635.383) (-631.277) (-630.576) [-629.823] -- 0:00:57
      94500 -- (-629.267) [-632.081] (-632.428) (-633.603) * (-632.186) (-633.065) [-630.429] (-631.910) -- 0:00:57
      95000 -- (-630.991) (-630.369) [-631.335] (-629.787) * (-631.130) (-629.985) [-629.070] (-630.361) -- 0:00:57

      Average standard deviation of split frequencies: 0.039518

      95500 -- (-629.327) (-629.929) (-630.496) [-629.934] * [-632.758] (-632.803) (-630.018) (-631.447) -- 0:00:56
      96000 -- (-630.524) (-630.176) (-629.637) [-629.533] * (-631.138) (-631.378) [-629.976] (-632.082) -- 0:00:56
      96500 -- (-632.620) [-631.534] (-629.996) (-629.588) * (-631.366) (-630.115) (-630.611) [-632.052] -- 0:00:56
      97000 -- (-634.739) (-629.754) (-631.497) [-628.658] * (-630.547) (-630.142) (-631.111) [-636.288] -- 0:00:55
      97500 -- (-630.262) (-629.984) (-631.372) [-630.014] * [-630.176] (-631.039) (-631.413) (-633.248) -- 0:00:55
      98000 -- [-634.347] (-630.073) (-629.449) (-630.231) * (-631.567) (-630.571) (-629.693) [-629.702] -- 0:00:55
      98500 -- [-630.483] (-630.172) (-633.516) (-630.123) * [-629.907] (-631.180) (-632.066) (-629.190) -- 0:00:54
      99000 -- (-640.552) [-630.005] (-633.843) (-631.460) * (-630.384) [-631.012] (-636.668) (-631.750) -- 0:00:54
      99500 -- (-631.352) [-631.681] (-631.273) (-630.398) * (-632.834) [-631.062] (-634.491) (-631.678) -- 0:00:54
      100000 -- [-629.567] (-630.083) (-631.641) (-633.032) * (-630.487) (-631.728) [-631.853] (-631.570) -- 0:01:02

      Average standard deviation of split frequencies: 0.036571

      100500 -- (-631.175) [-630.581] (-633.905) (-632.390) * (-629.796) [-629.906] (-630.654) (-632.048) -- 0:01:02
      101000 -- [-630.425] (-629.300) (-633.665) (-633.138) * (-630.615) (-629.553) [-629.296] (-633.279) -- 0:01:02
      101500 -- [-630.881] (-633.372) (-634.150) (-632.507) * [-633.968] (-631.220) (-631.766) (-633.294) -- 0:01:01
      102000 -- (-630.383) (-632.757) [-630.884] (-629.790) * (-633.293) [-632.616] (-629.791) (-629.748) -- 0:01:01
      102500 -- (-630.426) (-636.993) [-634.542] (-630.364) * (-631.065) (-631.872) (-635.526) [-632.843] -- 0:01:01
      103000 -- [-631.712] (-632.037) (-634.856) (-629.550) * (-628.983) (-630.157) (-632.125) [-631.704] -- 0:01:00
      103500 -- [-631.911] (-633.591) (-631.486) (-632.547) * (-629.101) [-628.960] (-632.823) (-630.388) -- 0:01:00
      104000 -- (-630.617) (-631.125) (-629.194) [-630.138] * (-633.073) [-630.326] (-638.968) (-631.722) -- 0:01:00
      104500 -- (-632.049) (-630.550) [-630.405] (-628.903) * [-630.687] (-636.703) (-634.995) (-629.794) -- 0:00:59
      105000 -- (-631.369) [-629.788] (-629.934) (-631.266) * (-629.751) (-630.658) (-630.631) [-631.191] -- 0:00:59

      Average standard deviation of split frequencies: 0.034224

      105500 -- (-628.986) (-630.410) [-632.810] (-631.762) * (-630.432) (-636.460) [-629.988] (-629.409) -- 0:00:59
      106000 -- (-629.426) (-629.618) (-628.735) [-630.365] * (-629.895) (-633.079) (-631.711) [-630.578] -- 0:00:59
      106500 -- [-629.675] (-630.494) (-633.589) (-633.780) * [-629.554] (-632.191) (-630.316) (-629.656) -- 0:00:58
      107000 -- (-630.566) [-634.132] (-630.128) (-629.468) * (-630.058) (-634.960) (-631.632) [-629.808] -- 0:00:58
      107500 -- (-629.545) [-631.201] (-629.374) (-629.802) * (-629.304) (-630.488) (-633.271) [-630.641] -- 0:00:58
      108000 -- (-629.446) [-630.019] (-630.454) (-632.254) * (-631.904) (-628.956) (-631.601) [-630.923] -- 0:00:57
      108500 -- (-629.395) [-631.033] (-633.660) (-633.761) * [-630.404] (-629.048) (-630.885) (-629.246) -- 0:00:57
      109000 -- [-629.723] (-631.602) (-632.748) (-631.014) * [-631.455] (-629.672) (-629.309) (-632.089) -- 0:00:57
      109500 -- (-629.279) [-632.757] (-633.136) (-629.441) * (-632.216) [-632.945] (-630.110) (-636.381) -- 0:00:56
      110000 -- (-629.373) [-631.647] (-631.383) (-630.755) * (-632.670) [-632.744] (-631.686) (-635.415) -- 0:00:56

      Average standard deviation of split frequencies: 0.032596

      110500 -- (-629.464) [-630.086] (-631.928) (-630.471) * (-634.563) [-631.072] (-630.253) (-633.882) -- 0:00:56
      111000 -- (-631.043) (-629.950) (-629.433) [-629.964] * (-632.020) [-630.130] (-630.860) (-630.963) -- 0:00:56
      111500 -- [-629.541] (-628.871) (-630.032) (-629.992) * (-630.625) [-631.947] (-629.327) (-633.913) -- 0:00:55
      112000 -- (-629.235) (-629.799) [-630.324] (-631.098) * (-629.527) [-631.556] (-629.567) (-630.540) -- 0:00:55
      112500 -- (-629.671) (-630.424) (-630.524) [-631.683] * (-629.395) (-629.701) [-630.812] (-631.491) -- 0:00:55
      113000 -- (-628.574) [-630.506] (-632.923) (-632.352) * (-630.273) (-629.016) [-629.403] (-640.003) -- 0:00:54
      113500 -- (-629.654) (-629.747) (-629.684) [-632.031] * (-629.065) [-635.798] (-629.596) (-635.309) -- 0:00:54
      114000 -- (-631.359) [-629.266] (-632.867) (-634.897) * [-629.892] (-629.678) (-632.357) (-630.865) -- 0:00:54
      114500 -- (-630.139) (-628.640) (-631.180) [-628.748] * [-629.520] (-636.055) (-631.782) (-630.636) -- 0:00:54
      115000 -- (-629.888) [-630.316] (-630.223) (-629.113) * (-629.033) (-631.944) [-634.070] (-629.645) -- 0:00:53

      Average standard deviation of split frequencies: 0.031627

      115500 -- (-630.765) [-631.829] (-631.136) (-634.066) * [-631.171] (-631.217) (-630.364) (-631.236) -- 0:00:53
      116000 -- (-633.284) (-630.304) (-634.510) [-631.358] * (-630.396) (-633.143) [-634.505] (-635.038) -- 0:00:53
      116500 -- [-631.610] (-633.208) (-630.707) (-630.295) * (-633.221) [-629.383] (-631.345) (-633.639) -- 0:00:53
      117000 -- (-632.124) (-629.535) [-629.565] (-630.816) * (-629.690) [-629.758] (-634.090) (-631.523) -- 0:01:00
      117500 -- (-630.942) [-630.772] (-629.433) (-629.519) * (-631.063) [-631.104] (-629.493) (-630.589) -- 0:01:00
      118000 -- (-630.598) [-628.809] (-631.569) (-632.260) * [-629.263] (-632.081) (-630.294) (-632.000) -- 0:00:59
      118500 -- (-634.873) (-629.613) [-629.617] (-634.833) * (-629.621) (-629.271) (-633.084) [-632.330] -- 0:00:59
      119000 -- (-632.896) (-628.905) (-632.023) [-630.678] * (-629.666) (-629.094) [-631.882] (-631.255) -- 0:00:59
      119500 -- (-630.078) (-632.416) [-632.469] (-630.299) * (-631.961) [-628.606] (-631.699) (-630.051) -- 0:00:58
      120000 -- (-634.776) (-631.445) [-631.544] (-631.343) * (-631.412) (-628.905) (-633.105) [-630.154] -- 0:00:58

      Average standard deviation of split frequencies: 0.031067

      120500 -- [-632.250] (-631.641) (-631.042) (-630.227) * (-632.418) (-630.334) [-631.069] (-630.074) -- 0:00:58
      121000 -- [-630.915] (-630.955) (-630.513) (-631.007) * [-635.786] (-630.493) (-630.907) (-631.977) -- 0:00:58
      121500 -- (-631.236) [-630.853] (-630.458) (-638.370) * (-629.573) (-635.014) (-631.656) [-630.281] -- 0:00:57
      122000 -- (-630.455) [-629.140] (-630.480) (-630.552) * (-629.852) (-631.304) [-629.665] (-634.601) -- 0:00:57
      122500 -- (-633.864) [-629.063] (-633.060) (-630.544) * (-628.997) (-632.947) (-628.989) [-631.385] -- 0:00:57
      123000 -- [-631.076] (-633.409) (-632.701) (-630.081) * (-630.203) [-631.278] (-629.130) (-628.958) -- 0:00:57
      123500 -- (-631.280) [-633.256] (-628.755) (-632.531) * (-629.558) (-629.449) [-629.487] (-629.972) -- 0:00:56
      124000 -- [-631.895] (-630.309) (-631.473) (-632.896) * (-630.387) (-629.959) [-631.407] (-630.598) -- 0:00:56
      124500 -- (-629.202) [-630.869] (-632.049) (-630.723) * [-629.460] (-630.815) (-630.324) (-631.505) -- 0:00:56
      125000 -- (-628.675) [-629.521] (-630.277) (-631.426) * (-629.352) [-632.151] (-630.066) (-631.415) -- 0:00:56

      Average standard deviation of split frequencies: 0.029768

      125500 -- (-631.004) (-629.564) (-630.825) [-630.467] * [-629.404] (-630.402) (-629.614) (-629.480) -- 0:00:55
      126000 -- (-631.695) (-628.584) [-633.919] (-629.419) * [-630.606] (-631.219) (-629.971) (-632.874) -- 0:00:55
      126500 -- (-630.036) (-629.304) [-631.513] (-629.989) * (-631.099) (-630.883) (-629.347) [-631.776] -- 0:00:55
      127000 -- [-634.551] (-629.388) (-630.792) (-630.485) * (-628.524) (-638.743) (-631.440) [-628.632] -- 0:00:54
      127500 -- (-635.978) [-629.645] (-630.177) (-632.757) * [-628.487] (-634.470) (-631.504) (-633.155) -- 0:00:54
      128000 -- (-637.192) (-630.552) [-629.144] (-634.994) * [-629.357] (-633.274) (-630.697) (-628.967) -- 0:00:54
      128500 -- (-633.090) (-631.108) (-629.327) [-632.281] * [-632.717] (-631.568) (-634.197) (-633.895) -- 0:00:54
      129000 -- (-634.944) (-631.860) [-629.969] (-629.521) * (-638.137) (-633.222) (-630.125) [-629.807] -- 0:00:54
      129500 -- [-635.547] (-631.461) (-630.425) (-628.825) * (-631.173) (-634.352) (-629.185) [-631.307] -- 0:00:53
      130000 -- (-630.890) (-630.669) [-631.565] (-629.311) * [-632.205] (-630.743) (-629.499) (-634.712) -- 0:00:53

      Average standard deviation of split frequencies: 0.025418

      130500 -- (-630.652) (-630.225) (-630.858) [-629.264] * (-630.495) (-630.988) (-632.103) [-629.555] -- 0:00:53
      131000 -- (-632.461) (-633.307) [-629.721] (-630.047) * (-631.351) (-629.606) [-630.353] (-631.892) -- 0:00:53
      131500 -- (-630.065) (-631.576) (-630.353) [-634.355] * (-635.362) [-630.529] (-629.122) (-633.039) -- 0:00:52
      132000 -- (-636.273) (-635.036) [-631.187] (-629.803) * [-631.677] (-628.778) (-629.835) (-635.958) -- 0:00:52
      132500 -- (-640.590) (-634.260) (-630.616) [-629.422] * (-630.332) (-629.309) (-631.693) [-632.671] -- 0:00:52
      133000 -- (-633.629) (-629.337) [-629.906] (-637.984) * [-629.440] (-630.987) (-631.223) (-633.787) -- 0:00:52
      133500 -- (-630.152) [-630.948] (-628.551) (-632.263) * (-632.022) (-631.799) [-629.734] (-633.212) -- 0:00:51
      134000 -- (-632.261) (-630.257) (-630.353) [-629.494] * (-630.842) (-630.642) [-629.440] (-632.164) -- 0:00:58
      134500 -- (-633.663) [-631.002] (-630.902) (-631.163) * [-630.596] (-630.183) (-629.633) (-634.448) -- 0:00:57
      135000 -- (-629.793) (-631.230) (-630.869) [-631.037] * [-629.071] (-633.593) (-630.253) (-630.800) -- 0:00:57

      Average standard deviation of split frequencies: 0.027069

      135500 -- (-631.424) (-629.382) [-629.744] (-629.895) * (-628.862) (-632.966) (-629.778) [-630.046] -- 0:00:57
      136000 -- (-631.474) (-628.591) [-631.023] (-631.110) * (-631.307) (-629.994) (-633.116) [-629.270] -- 0:00:57
      136500 -- (-632.206) [-634.249] (-637.599) (-631.486) * (-631.471) (-629.989) [-637.825] (-629.850) -- 0:00:56
      137000 -- [-632.180] (-632.669) (-636.627) (-631.646) * (-633.870) (-628.920) (-629.480) [-631.170] -- 0:00:56
      137500 -- (-629.724) (-630.047) [-631.928] (-630.449) * (-636.393) [-629.459] (-629.396) (-629.325) -- 0:00:56
      138000 -- (-629.461) [-629.765] (-633.410) (-630.549) * [-631.964] (-629.700) (-630.431) (-632.630) -- 0:00:56
      138500 -- [-630.605] (-630.500) (-632.020) (-630.675) * (-633.782) [-630.550] (-630.316) (-631.794) -- 0:00:55
      139000 -- (-631.869) [-632.394] (-634.153) (-629.990) * (-633.046) [-630.787] (-630.940) (-633.540) -- 0:00:55
      139500 -- (-633.375) (-632.545) [-630.575] (-629.284) * (-631.265) (-629.548) (-636.668) [-633.536] -- 0:00:55
      140000 -- [-630.794] (-631.252) (-630.859) (-629.123) * (-631.622) [-629.348] (-632.886) (-630.809) -- 0:00:55

      Average standard deviation of split frequencies: 0.021448

      140500 -- [-629.406] (-634.829) (-632.629) (-629.638) * (-630.918) [-630.070] (-635.778) (-629.686) -- 0:00:55
      141000 -- [-629.385] (-630.572) (-631.115) (-628.946) * (-635.490) (-630.990) (-630.718) [-629.211] -- 0:00:54
      141500 -- [-629.397] (-632.463) (-629.710) (-629.496) * (-629.533) [-631.798] (-629.277) (-630.389) -- 0:00:54
      142000 -- (-634.742) (-638.792) (-629.117) [-632.907] * (-631.958) (-637.343) (-630.030) [-630.070] -- 0:00:54
      142500 -- (-634.606) (-633.268) (-629.547) [-629.297] * (-629.222) (-629.690) [-629.389] (-629.309) -- 0:00:54
      143000 -- (-631.144) (-633.164) [-630.660] (-630.868) * (-628.838) (-629.419) [-629.180] (-630.631) -- 0:00:53
      143500 -- (-633.736) [-631.413] (-629.447) (-631.104) * [-630.392] (-634.231) (-633.323) (-630.499) -- 0:00:53
      144000 -- (-629.545) [-632.461] (-630.878) (-631.373) * (-629.970) (-632.337) (-633.831) [-631.969] -- 0:00:53
      144500 -- (-633.751) (-632.024) (-630.062) [-630.216] * (-630.632) [-632.278] (-631.347) (-634.263) -- 0:00:53
      145000 -- (-629.400) (-632.482) [-629.853] (-631.702) * (-629.962) [-631.087] (-630.372) (-631.558) -- 0:00:53

      Average standard deviation of split frequencies: 0.022440

      145500 -- (-630.229) (-635.208) (-634.101) [-629.748] * (-631.302) (-631.657) (-631.464) [-631.598] -- 0:00:52
      146000 -- (-630.061) (-631.740) (-629.795) [-631.027] * [-630.980] (-629.235) (-629.399) (-630.689) -- 0:00:52
      146500 -- (-633.553) (-633.859) (-632.755) [-631.478] * (-630.293) [-629.892] (-634.050) (-636.562) -- 0:00:52
      147000 -- (-632.499) [-630.074] (-630.411) (-629.700) * [-631.010] (-629.729) (-629.124) (-638.020) -- 0:00:52
      147500 -- (-632.031) (-629.586) [-633.090] (-635.344) * (-635.241) (-630.584) (-630.304) [-633.787] -- 0:00:52
      148000 -- (-629.582) [-629.388] (-629.329) (-630.639) * (-631.299) [-634.191] (-630.159) (-628.867) -- 0:00:51
      148500 -- (-632.188) (-629.326) [-633.317] (-633.074) * (-633.053) (-635.526) (-632.686) [-629.014] -- 0:00:51
      149000 -- (-632.372) (-629.613) [-630.262] (-630.452) * (-630.954) (-632.078) (-632.545) [-632.686] -- 0:00:51
      149500 -- (-632.136) (-630.122) (-634.305) [-629.905] * (-630.668) (-630.824) (-629.753) [-631.587] -- 0:00:51
      150000 -- (-631.880) (-630.726) [-629.775] (-632.793) * (-630.450) (-631.826) [-630.130] (-631.165) -- 0:00:51

      Average standard deviation of split frequencies: 0.021589

      150500 -- (-630.338) [-628.949] (-630.033) (-634.736) * (-632.124) (-632.463) (-632.187) [-631.570] -- 0:00:56
      151000 -- (-630.390) (-628.883) (-632.169) [-632.234] * (-629.780) (-636.608) [-630.407] (-631.469) -- 0:00:56
      151500 -- (-629.772) [-631.420] (-630.773) (-639.171) * [-631.652] (-631.215) (-634.827) (-633.480) -- 0:00:56
      152000 -- (-630.838) [-633.632] (-629.823) (-639.125) * [-629.767] (-632.253) (-633.976) (-629.269) -- 0:00:55
      152500 -- (-630.044) (-632.485) [-630.235] (-636.600) * [-628.884] (-633.080) (-632.325) (-632.214) -- 0:00:55
      153000 -- (-629.980) (-632.014) [-634.079] (-630.880) * (-629.540) (-633.058) (-629.153) [-633.421] -- 0:00:55
      153500 -- (-632.972) [-632.157] (-630.531) (-631.326) * (-631.861) (-629.442) [-630.513] (-633.232) -- 0:00:55
      154000 -- (-631.665) (-633.977) (-629.913) [-634.037] * (-632.568) [-634.362] (-629.424) (-632.168) -- 0:00:54
      154500 -- (-629.931) (-630.559) (-630.110) [-630.312] * (-632.561) [-631.103] (-629.478) (-639.749) -- 0:00:54
      155000 -- (-630.378) (-631.874) [-630.972] (-631.553) * (-633.156) [-628.746] (-632.068) (-629.760) -- 0:00:54

      Average standard deviation of split frequencies: 0.019721

      155500 -- (-630.735) (-633.044) [-629.855] (-629.973) * [-634.813] (-629.329) (-630.784) (-629.837) -- 0:00:54
      156000 -- (-631.547) (-629.198) [-630.037] (-629.054) * (-628.831) (-632.942) (-641.609) [-629.928] -- 0:00:54
      156500 -- (-630.928) (-630.183) (-631.710) [-628.962] * (-629.950) [-629.813] (-631.759) (-635.003) -- 0:00:53
      157000 -- (-630.116) (-629.793) [-629.933] (-629.903) * (-631.781) (-629.166) [-636.907] (-631.559) -- 0:00:53
      157500 -- (-631.715) (-630.485) [-630.431] (-632.440) * [-631.570] (-632.130) (-634.945) (-632.080) -- 0:00:53
      158000 -- (-632.121) [-631.328] (-632.299) (-629.200) * (-637.072) (-632.546) (-630.545) [-635.778] -- 0:00:53
      158500 -- (-634.104) (-630.939) (-631.344) [-628.656] * (-631.072) (-632.484) [-628.914] (-632.611) -- 0:00:53
      159000 -- (-630.889) [-630.276] (-630.215) (-630.633) * (-632.546) [-632.710] (-629.445) (-630.888) -- 0:00:52
      159500 -- [-629.275] (-630.619) (-629.090) (-630.478) * (-629.409) [-629.719] (-630.742) (-630.239) -- 0:00:52
      160000 -- (-629.789) (-629.436) [-630.886] (-630.875) * (-630.667) (-632.130) [-630.702] (-633.702) -- 0:00:52

      Average standard deviation of split frequencies: 0.017751

      160500 -- (-629.398) [-631.343] (-635.777) (-630.994) * (-631.914) (-630.770) [-628.819] (-630.116) -- 0:00:52
      161000 -- (-630.436) [-630.809] (-636.036) (-632.126) * [-629.152] (-629.758) (-631.115) (-630.342) -- 0:00:52
      161500 -- [-632.306] (-633.962) (-631.143) (-629.715) * (-633.519) (-630.568) [-631.477] (-632.010) -- 0:00:51
      162000 -- (-631.048) (-629.828) [-629.832] (-630.049) * (-630.136) [-630.978] (-631.582) (-630.082) -- 0:00:51
      162500 -- (-630.154) (-634.427) [-630.658] (-629.146) * (-632.035) (-629.385) (-631.235) [-629.772] -- 0:00:51
      163000 -- (-634.188) (-632.333) (-631.490) [-630.476] * [-636.469] (-632.301) (-630.790) (-630.625) -- 0:00:51
      163500 -- (-632.396) (-629.375) (-629.763) [-629.994] * (-632.688) (-632.813) [-633.018] (-632.831) -- 0:00:51
      164000 -- (-630.844) (-633.360) (-631.448) [-633.630] * (-630.597) (-630.682) (-630.378) [-629.896] -- 0:00:50
      164500 -- (-629.194) (-631.874) (-635.227) [-631.797] * (-630.840) (-636.364) [-631.378] (-629.740) -- 0:00:50
      165000 -- (-629.370) (-632.131) [-638.423] (-628.733) * (-634.038) [-632.626] (-629.500) (-633.920) -- 0:00:50

      Average standard deviation of split frequencies: 0.018774

      165500 -- (-630.070) (-633.146) [-637.951] (-630.187) * (-635.009) (-630.527) (-628.813) [-631.799] -- 0:00:50
      166000 -- [-630.385] (-631.900) (-631.771) (-630.914) * (-629.438) [-629.298] (-628.872) (-631.923) -- 0:00:50
      166500 -- (-630.512) (-630.342) (-633.579) [-629.405] * (-629.083) (-629.812) [-628.730] (-631.687) -- 0:00:50
      167000 -- (-629.740) (-629.077) [-630.455] (-629.405) * (-631.102) (-630.254) [-632.052] (-633.684) -- 0:00:49
      167500 -- (-629.297) [-630.958] (-630.096) (-630.644) * (-633.689) (-630.158) (-635.491) [-629.252] -- 0:00:54
      168000 -- (-630.686) [-630.349] (-628.714) (-629.975) * (-629.560) (-629.132) (-634.405) [-629.735] -- 0:00:54
      168500 -- (-630.376) (-628.424) [-629.782] (-629.656) * (-637.599) (-631.404) [-631.091] (-630.094) -- 0:00:54
      169000 -- (-629.480) (-631.141) (-629.889) [-632.743] * [-631.926] (-629.098) (-631.116) (-629.902) -- 0:00:54
      169500 -- [-634.161] (-630.402) (-629.083) (-630.124) * [-630.408] (-632.912) (-630.033) (-629.862) -- 0:00:53
      170000 -- [-630.569] (-629.527) (-629.427) (-632.326) * (-628.751) [-631.777] (-636.240) (-630.027) -- 0:00:53

      Average standard deviation of split frequencies: 0.020472

      170500 -- (-631.377) (-631.798) (-630.455) [-632.564] * [-630.488] (-631.991) (-633.932) (-631.166) -- 0:00:53
      171000 -- (-633.829) (-629.790) [-630.243] (-632.682) * (-631.334) [-630.383] (-630.275) (-631.485) -- 0:00:53
      171500 -- (-629.910) (-633.875) [-630.353] (-631.265) * (-631.801) (-633.179) (-630.091) [-633.235] -- 0:00:53
      172000 -- (-632.901) (-632.104) [-629.023] (-632.421) * (-631.711) (-635.304) (-629.748) [-630.922] -- 0:00:52
      172500 -- [-628.987] (-630.045) (-629.008) (-631.502) * (-630.431) [-631.827] (-630.847) (-630.578) -- 0:00:52
      173000 -- [-630.416] (-628.863) (-630.342) (-632.658) * (-628.746) [-635.139] (-630.606) (-636.210) -- 0:00:52
      173500 -- (-630.139) [-629.853] (-632.522) (-632.278) * (-630.195) (-630.602) (-631.067) [-633.031] -- 0:00:52
      174000 -- (-631.793) (-630.699) (-637.473) [-630.778] * (-630.371) (-631.408) [-628.958] (-631.237) -- 0:00:52
      174500 -- [-630.864] (-629.799) (-629.855) (-631.954) * (-631.321) (-640.623) (-631.105) [-632.021] -- 0:00:52
      175000 -- (-632.130) [-630.694] (-631.279) (-631.856) * (-632.543) (-636.073) [-629.366] (-629.915) -- 0:00:51

      Average standard deviation of split frequencies: 0.018005

      175500 -- [-631.375] (-629.608) (-631.523) (-629.918) * (-630.609) [-632.124] (-630.934) (-629.908) -- 0:00:51
      176000 -- (-631.246) (-632.409) (-631.073) [-631.271] * [-630.376] (-632.280) (-629.035) (-631.510) -- 0:00:51
      176500 -- [-630.626] (-630.078) (-629.468) (-635.930) * (-630.963) (-628.959) [-631.727] (-630.044) -- 0:00:51
      177000 -- [-630.276] (-630.311) (-629.083) (-633.896) * (-630.937) (-632.377) (-630.764) [-630.201] -- 0:00:51
      177500 -- [-631.771] (-631.034) (-629.695) (-632.816) * (-629.191) (-632.612) (-631.468) [-630.683] -- 0:00:50
      178000 -- (-631.491) (-628.698) (-632.944) [-633.078] * (-629.785) (-629.974) (-631.219) [-633.285] -- 0:00:50
      178500 -- (-631.807) (-632.935) [-632.331] (-635.509) * (-630.133) [-630.304] (-629.800) (-633.842) -- 0:00:50
      179000 -- (-630.675) [-631.513] (-631.109) (-632.877) * (-632.649) (-630.719) [-633.166] (-632.260) -- 0:00:50
      179500 -- [-629.407] (-629.333) (-629.408) (-633.190) * (-633.183) (-631.850) (-629.321) [-629.587] -- 0:00:50
      180000 -- (-629.468) (-629.323) (-629.054) [-630.235] * (-630.010) [-631.146] (-631.293) (-630.450) -- 0:00:50

      Average standard deviation of split frequencies: 0.018700

      180500 -- (-629.056) (-631.094) [-629.015] (-629.532) * (-629.436) [-631.464] (-629.276) (-630.949) -- 0:00:49
      181000 -- (-632.227) (-634.842) [-631.988] (-631.616) * (-630.773) (-631.477) (-630.020) [-629.632] -- 0:00:49
      181500 -- (-631.344) (-630.225) [-628.414] (-632.835) * (-633.162) [-629.342] (-629.781) (-632.067) -- 0:00:49
      182000 -- (-632.814) (-630.021) [-629.800] (-630.051) * [-629.862] (-629.930) (-631.126) (-630.858) -- 0:00:49
      182500 -- (-631.001) (-629.756) [-630.588] (-630.396) * [-632.499] (-629.684) (-631.032) (-634.005) -- 0:00:49
      183000 -- (-631.245) [-628.953] (-634.917) (-633.277) * [-631.796] (-629.656) (-629.857) (-632.065) -- 0:00:49
      183500 -- (-631.804) (-630.970) (-632.246) [-631.293] * (-635.801) (-631.689) [-632.111] (-632.878) -- 0:00:48
      184000 -- [-629.791] (-631.856) (-629.759) (-632.603) * [-629.908] (-631.193) (-629.465) (-633.038) -- 0:00:48
      184500 -- (-632.849) (-629.492) (-632.632) [-630.942] * (-630.714) [-629.823] (-628.735) (-630.878) -- 0:00:53
      185000 -- (-632.239) (-629.168) (-632.220) [-631.229] * [-629.126] (-633.312) (-631.068) (-631.250) -- 0:00:52

      Average standard deviation of split frequencies: 0.017207

      185500 -- (-632.944) [-630.080] (-630.892) (-633.374) * [-629.145] (-633.013) (-630.660) (-629.635) -- 0:00:52
      186000 -- [-631.748] (-630.059) (-630.411) (-632.970) * (-632.631) (-631.687) [-630.273] (-629.495) -- 0:00:52
      186500 -- (-633.156) (-630.730) (-631.865) [-632.266] * (-630.496) (-635.381) [-630.478] (-630.469) -- 0:00:52
      187000 -- (-629.611) [-629.247] (-629.461) (-635.904) * (-629.997) [-635.972] (-631.619) (-630.540) -- 0:00:52
      187500 -- (-635.066) (-631.612) (-629.693) [-631.375] * [-633.080] (-631.278) (-629.560) (-631.143) -- 0:00:52
      188000 -- (-633.059) (-630.457) (-629.449) [-631.243] * (-633.396) (-631.339) [-630.115] (-631.652) -- 0:00:51
      188500 -- (-634.999) [-631.386] (-634.201) (-629.810) * (-633.513) [-635.015] (-631.580) (-632.742) -- 0:00:51
      189000 -- (-630.358) [-629.342] (-632.210) (-628.858) * (-629.947) (-632.710) [-632.433] (-630.400) -- 0:00:51
      189500 -- [-629.364] (-630.391) (-633.010) (-631.102) * (-632.482) (-632.350) (-633.422) [-630.759] -- 0:00:51
      190000 -- (-630.785) [-629.853] (-632.011) (-634.344) * (-629.726) (-632.339) (-635.142) [-632.705] -- 0:00:51

      Average standard deviation of split frequencies: 0.015933

      190500 -- [-632.853] (-631.376) (-633.322) (-635.035) * (-631.513) (-634.364) (-635.700) [-637.182] -- 0:00:50
      191000 -- (-632.044) [-629.604] (-631.576) (-632.953) * [-631.125] (-631.264) (-630.654) (-631.134) -- 0:00:50
      191500 -- (-632.733) (-629.684) [-633.802] (-629.799) * [-634.807] (-631.443) (-631.948) (-631.418) -- 0:00:50
      192000 -- (-631.487) [-629.849] (-630.140) (-630.973) * [-636.188] (-630.949) (-633.788) (-633.886) -- 0:00:50
      192500 -- [-628.971] (-631.224) (-630.960) (-631.193) * (-630.437) (-629.126) [-631.440] (-633.567) -- 0:00:50
      193000 -- (-628.961) (-631.874) [-629.808] (-631.220) * [-630.308] (-629.597) (-630.257) (-631.186) -- 0:00:50
      193500 -- (-634.743) [-630.353] (-633.810) (-630.353) * (-633.186) [-634.861] (-629.014) (-633.688) -- 0:00:50
      194000 -- (-635.218) (-631.843) [-633.372] (-633.309) * [-629.001] (-629.938) (-629.510) (-630.068) -- 0:00:49
      194500 -- [-630.362] (-636.121) (-630.182) (-628.748) * (-630.784) (-628.733) (-632.526) [-633.133] -- 0:00:49
      195000 -- (-635.291) (-631.566) (-635.481) [-631.922] * (-630.036) [-629.997] (-636.269) (-632.799) -- 0:00:49

      Average standard deviation of split frequencies: 0.014714

      195500 -- (-633.630) [-630.897] (-630.091) (-632.877) * (-635.210) (-633.414) [-631.468] (-632.207) -- 0:00:49
      196000 -- [-632.118] (-631.348) (-630.336) (-629.067) * [-629.396] (-632.191) (-630.764) (-631.725) -- 0:00:49
      196500 -- (-630.859) [-630.345] (-631.319) (-630.084) * (-632.919) (-632.559) (-629.819) [-631.203] -- 0:00:49
      197000 -- [-630.086] (-631.459) (-629.929) (-631.294) * [-629.690] (-633.637) (-630.632) (-631.726) -- 0:00:48
      197500 -- (-630.928) (-632.153) [-630.023] (-633.486) * (-633.874) (-631.897) (-630.158) [-631.773] -- 0:00:48
      198000 -- (-632.908) (-631.165) (-629.033) [-632.743] * (-631.655) (-632.641) (-630.643) [-631.669] -- 0:00:48
      198500 -- (-631.425) (-629.849) [-629.474] (-630.446) * (-631.634) (-629.930) (-630.823) [-635.254] -- 0:00:48
      199000 -- (-629.579) [-632.260] (-630.564) (-628.920) * (-633.034) [-632.932] (-632.535) (-634.457) -- 0:00:48
      199500 -- (-630.980) (-629.463) (-630.593) [-630.620] * [-631.334] (-631.988) (-631.437) (-633.129) -- 0:00:48
      200000 -- (-631.362) (-629.225) (-631.812) [-629.490] * [-630.688] (-631.984) (-629.589) (-632.584) -- 0:00:48

      Average standard deviation of split frequencies: 0.014786

      200500 -- [-629.041] (-630.049) (-631.535) (-628.751) * (-629.629) [-633.938] (-629.838) (-629.038) -- 0:00:47
      201000 -- (-630.611) (-629.404) [-629.920] (-628.963) * (-631.483) [-630.907] (-632.804) (-629.631) -- 0:00:47
      201500 -- (-630.890) (-630.041) (-631.817) [-629.582] * (-630.885) (-628.521) [-633.128] (-632.283) -- 0:00:51
      202000 -- [-631.521] (-637.693) (-637.501) (-632.838) * (-630.941) (-628.474) (-630.998) [-630.673] -- 0:00:51
      202500 -- (-633.456) (-629.837) [-630.354] (-631.908) * (-629.801) (-632.532) [-631.825] (-632.133) -- 0:00:51
      203000 -- (-629.822) (-629.983) (-629.479) [-629.760] * (-629.734) [-629.426] (-632.792) (-630.914) -- 0:00:51
      203500 -- [-630.197] (-630.986) (-630.547) (-631.029) * [-630.448] (-630.827) (-631.320) (-629.555) -- 0:00:50
      204000 -- (-630.168) (-633.396) [-630.259] (-629.821) * (-633.490) (-640.622) (-632.109) [-631.458] -- 0:00:50
      204500 -- (-629.272) (-633.967) (-632.547) [-628.728] * (-630.994) [-630.245] (-635.420) (-631.478) -- 0:00:50
      205000 -- (-631.952) (-634.321) [-629.148] (-633.415) * [-630.548] (-630.360) (-632.924) (-633.284) -- 0:00:50

      Average standard deviation of split frequencies: 0.014134

      205500 -- [-628.541] (-632.406) (-630.280) (-630.587) * (-631.337) [-629.803] (-636.327) (-631.070) -- 0:00:50
      206000 -- (-632.719) [-631.999] (-629.766) (-629.586) * (-644.593) (-629.301) [-631.474] (-629.485) -- 0:00:50
      206500 -- (-634.034) (-631.722) (-631.997) [-629.186] * (-636.069) [-628.722] (-638.895) (-632.064) -- 0:00:49
      207000 -- (-629.914) [-629.342] (-636.410) (-629.678) * [-628.743] (-631.879) (-633.127) (-631.898) -- 0:00:49
      207500 -- (-632.707) (-630.233) (-633.153) [-628.952] * (-630.669) [-632.809] (-633.482) (-630.977) -- 0:00:49
      208000 -- [-630.356] (-630.283) (-630.583) (-628.729) * (-629.699) (-630.794) [-630.783] (-630.412) -- 0:00:49
      208500 -- (-633.868) (-629.084) [-631.312] (-631.356) * [-629.579] (-630.444) (-630.459) (-630.559) -- 0:00:49
      209000 -- (-629.236) [-633.479] (-630.411) (-630.837) * (-630.492) (-633.812) [-634.093] (-632.330) -- 0:00:49
      209500 -- (-629.247) (-630.779) [-632.626] (-633.224) * [-630.696] (-635.041) (-631.062) (-630.433) -- 0:00:49
      210000 -- (-630.824) (-630.297) (-632.057) [-630.635] * (-629.939) (-632.343) (-629.457) [-631.187] -- 0:00:48

      Average standard deviation of split frequencies: 0.013426

      210500 -- (-636.185) (-631.003) (-631.779) [-629.351] * (-631.279) [-630.741] (-632.769) (-630.151) -- 0:00:48
      211000 -- (-633.881) (-628.823) [-632.145] (-629.074) * [-630.738] (-632.781) (-632.269) (-629.564) -- 0:00:48
      211500 -- (-631.389) (-632.235) (-630.599) [-629.255] * (-630.667) (-632.014) (-630.620) [-629.147] -- 0:00:48
      212000 -- (-629.870) (-630.529) [-628.961] (-629.091) * [-629.742] (-631.369) (-631.759) (-629.480) -- 0:00:48
      212500 -- (-630.233) (-632.700) [-635.230] (-632.382) * (-631.661) [-632.311] (-630.282) (-631.024) -- 0:00:48
      213000 -- (-630.375) [-630.333] (-631.983) (-631.892) * (-629.422) (-631.591) (-628.792) [-629.320] -- 0:00:48
      213500 -- (-629.683) [-629.737] (-631.368) (-631.513) * (-631.828) (-631.250) [-629.597] (-630.123) -- 0:00:47
      214000 -- [-630.012] (-636.828) (-631.714) (-630.176) * [-630.104] (-631.195) (-630.806) (-632.058) -- 0:00:47
      214500 -- (-632.613) (-632.719) (-635.357) [-633.296] * (-632.085) (-630.178) [-628.973] (-631.803) -- 0:00:47
      215000 -- [-630.150] (-629.826) (-634.712) (-633.039) * (-631.459) (-631.450) [-634.984] (-631.275) -- 0:00:47

      Average standard deviation of split frequencies: 0.012838

      215500 -- (-629.068) [-629.988] (-633.522) (-634.098) * (-633.514) [-629.166] (-632.564) (-630.770) -- 0:00:47
      216000 -- (-631.320) (-634.712) (-634.711) [-630.055] * (-633.312) [-633.461] (-630.199) (-632.381) -- 0:00:47
      216500 -- [-631.101] (-631.861) (-630.077) (-629.581) * (-632.806) (-630.257) [-630.647] (-631.430) -- 0:00:47
      217000 -- (-630.986) (-629.733) [-631.159] (-635.336) * (-635.263) [-630.845] (-629.939) (-629.789) -- 0:00:46
      217500 -- (-630.233) (-629.504) [-629.298] (-634.988) * (-639.687) (-629.865) (-629.958) [-631.510] -- 0:00:46
      218000 -- (-630.650) (-630.068) (-630.851) [-631.652] * (-635.737) (-628.988) (-632.080) [-631.417] -- 0:00:46
      218500 -- (-629.514) [-630.810] (-631.390) (-630.437) * (-631.918) [-629.430] (-629.760) (-630.808) -- 0:00:50
      219000 -- (-629.480) (-631.190) (-629.440) [-629.962] * (-631.380) (-629.312) [-631.410] (-632.152) -- 0:00:49
      219500 -- (-629.636) (-630.538) (-630.899) [-630.512] * (-629.646) (-631.561) (-631.197) [-635.550] -- 0:00:49
      220000 -- (-631.846) (-632.262) [-629.143] (-629.446) * (-629.648) [-633.002] (-629.970) (-629.297) -- 0:00:49

      Average standard deviation of split frequencies: 0.012315

      220500 -- (-631.488) (-630.609) [-630.448] (-635.020) * (-631.153) [-630.669] (-628.556) (-630.959) -- 0:00:49
      221000 -- (-631.913) [-629.634] (-628.891) (-631.678) * [-630.102] (-634.055) (-629.239) (-629.644) -- 0:00:49
      221500 -- (-632.840) (-628.782) [-628.696] (-629.598) * (-630.277) (-630.159) [-630.746] (-631.807) -- 0:00:49
      222000 -- (-632.795) (-629.528) [-631.740] (-629.312) * [-629.699] (-633.153) (-630.767) (-634.300) -- 0:00:49
      222500 -- (-633.384) [-630.360] (-629.285) (-629.653) * [-632.150] (-631.756) (-631.170) (-638.967) -- 0:00:48
      223000 -- (-631.709) [-628.769] (-629.587) (-634.143) * (-632.420) [-628.865] (-632.343) (-634.467) -- 0:00:48
      223500 -- (-630.616) [-630.304] (-629.715) (-633.216) * (-629.467) [-630.619] (-629.525) (-635.484) -- 0:00:48
      224000 -- (-630.119) (-631.052) (-629.607) [-630.550] * (-631.802) (-631.989) (-631.593) [-630.228] -- 0:00:48
      224500 -- [-629.997] (-629.327) (-629.588) (-629.878) * (-631.660) (-633.633) (-629.112) [-630.530] -- 0:00:48
      225000 -- [-629.395] (-629.753) (-630.535) (-629.584) * (-630.569) (-631.777) [-629.978] (-638.429) -- 0:00:48

      Average standard deviation of split frequencies: 0.011902

      225500 -- (-630.384) (-630.158) (-629.273) [-629.802] * [-631.483] (-630.891) (-630.121) (-635.844) -- 0:00:48
      226000 -- (-630.581) [-630.270] (-630.301) (-633.498) * (-629.716) [-633.942] (-631.395) (-630.174) -- 0:00:47
      226500 -- (-633.868) (-631.196) [-632.129] (-632.932) * [-630.727] (-630.578) (-628.765) (-630.239) -- 0:00:47
      227000 -- (-631.984) (-631.296) [-629.720] (-629.952) * (-631.049) (-630.018) (-630.524) [-630.942] -- 0:00:47
      227500 -- (-643.813) (-632.681) (-629.502) [-630.506] * (-633.703) [-632.097] (-632.092) (-629.243) -- 0:00:47
      228000 -- (-630.736) (-630.484) [-629.944] (-629.354) * (-629.690) (-630.759) [-631.502] (-630.121) -- 0:00:47
      228500 -- (-633.515) (-630.826) [-630.649] (-629.441) * (-630.693) (-634.449) (-632.768) [-630.480] -- 0:00:47
      229000 -- (-633.845) (-631.719) [-629.776] (-633.416) * (-631.348) (-632.699) (-628.914) [-630.411] -- 0:00:47
      229500 -- (-629.741) (-632.038) [-632.127] (-632.809) * [-632.695] (-631.889) (-631.410) (-633.852) -- 0:00:47
      230000 -- [-629.795] (-630.862) (-629.530) (-629.861) * (-630.251) [-630.938] (-634.699) (-629.646) -- 0:00:46

      Average standard deviation of split frequencies: 0.011420

      230500 -- (-630.802) (-629.875) [-628.666] (-631.759) * (-630.598) (-629.438) (-630.594) [-631.380] -- 0:00:46
      231000 -- (-630.523) (-631.238) (-629.890) [-633.958] * [-636.867] (-628.867) (-630.884) (-629.856) -- 0:00:46
      231500 -- (-630.922) [-630.988] (-630.715) (-633.135) * (-632.241) (-630.547) (-629.286) [-629.849] -- 0:00:46
      232000 -- (-632.996) (-629.268) (-630.988) [-631.849] * [-629.384] (-632.664) (-629.076) (-629.873) -- 0:00:46
      232500 -- [-633.119] (-630.513) (-629.127) (-632.590) * (-630.985) (-633.646) [-629.649] (-631.864) -- 0:00:46
      233000 -- (-632.565) (-630.719) [-629.452] (-630.143) * (-635.736) [-632.005] (-632.890) (-631.600) -- 0:00:46
      233500 -- (-630.196) (-631.761) [-630.161] (-632.068) * (-636.489) (-630.437) (-632.546) [-629.969] -- 0:00:45
      234000 -- [-630.083] (-630.483) (-631.920) (-632.819) * (-637.847) [-634.796] (-630.917) (-629.586) -- 0:00:45
      234500 -- (-632.268) [-631.855] (-631.198) (-630.678) * (-632.345) (-630.127) [-629.548] (-630.999) -- 0:00:45
      235000 -- (-631.909) (-634.493) (-630.962) [-632.760] * [-629.248] (-630.069) (-630.032) (-634.638) -- 0:00:45

      Average standard deviation of split frequencies: 0.011750

      235500 -- [-630.441] (-629.134) (-630.326) (-633.180) * (-631.634) (-630.772) (-630.751) [-632.788] -- 0:00:48
      236000 -- [-632.608] (-629.759) (-630.673) (-631.091) * (-629.487) (-629.223) [-628.627] (-630.577) -- 0:00:48
      236500 -- (-633.810) (-631.399) [-630.842] (-633.592) * (-633.997) (-630.855) [-632.842] (-630.949) -- 0:00:48
      237000 -- (-635.311) [-631.173] (-629.363) (-633.671) * (-633.235) (-628.987) [-631.044] (-631.168) -- 0:00:48
      237500 -- (-629.855) [-630.641] (-630.460) (-628.710) * (-632.170) [-630.719] (-633.032) (-630.696) -- 0:00:48
      238000 -- (-636.944) (-632.324) (-635.773) [-630.954] * (-630.518) (-633.605) [-631.761] (-628.755) -- 0:00:48
      238500 -- (-632.455) [-630.527] (-630.961) (-630.327) * [-628.934] (-629.857) (-633.569) (-629.239) -- 0:00:47
      239000 -- (-631.557) [-630.727] (-629.874) (-630.817) * (-629.074) [-629.987] (-636.078) (-632.071) -- 0:00:47
      239500 -- [-629.094] (-629.804) (-629.528) (-632.938) * [-634.146] (-635.801) (-631.584) (-632.794) -- 0:00:47
      240000 -- [-628.961] (-630.841) (-631.055) (-630.473) * (-633.497) (-631.256) (-631.610) [-632.407] -- 0:00:47

      Average standard deviation of split frequencies: 0.010283

      240500 -- (-630.797) (-632.464) (-629.864) [-634.544] * [-630.992] (-630.783) (-634.147) (-632.923) -- 0:00:47
      241000 -- (-628.648) [-631.696] (-628.929) (-631.942) * (-630.379) [-629.840] (-634.259) (-635.747) -- 0:00:47
      241500 -- [-630.156] (-629.436) (-630.151) (-631.919) * (-632.869) [-631.222] (-630.632) (-632.951) -- 0:00:47
      242000 -- (-630.558) (-629.420) [-632.223] (-632.470) * [-632.978] (-631.849) (-629.928) (-631.308) -- 0:00:46
      242500 -- (-635.662) [-630.254] (-633.601) (-636.533) * (-630.290) (-630.231) [-630.753] (-631.215) -- 0:00:46
      243000 -- (-631.850) (-630.812) (-636.435) [-632.040] * (-633.779) (-630.496) [-630.980] (-629.820) -- 0:00:46
      243500 -- [-632.861] (-629.204) (-636.625) (-633.108) * (-630.620) (-629.610) [-629.691] (-630.618) -- 0:00:46
      244000 -- (-631.389) [-629.901] (-633.191) (-632.900) * (-630.299) [-631.870] (-633.370) (-634.554) -- 0:00:46
      244500 -- [-632.134] (-633.066) (-630.583) (-632.084) * [-629.798] (-629.808) (-631.474) (-629.337) -- 0:00:46
      245000 -- (-631.704) (-631.507) [-633.257] (-634.175) * (-633.055) [-632.833] (-631.673) (-629.210) -- 0:00:46

      Average standard deviation of split frequencies: 0.010540

      245500 -- (-633.787) (-634.539) (-630.385) [-632.147] * (-629.820) (-629.303) [-630.435] (-631.624) -- 0:00:46
      246000 -- (-632.462) (-632.697) [-629.460] (-631.462) * (-634.455) (-631.655) [-633.605] (-631.644) -- 0:00:45
      246500 -- (-631.922) [-631.386] (-630.222) (-629.822) * (-631.780) (-629.958) (-637.754) [-630.298] -- 0:00:45
      247000 -- (-632.475) (-630.657) [-631.321] (-628.985) * [-628.759] (-630.302) (-630.810) (-630.316) -- 0:00:45
      247500 -- (-635.584) (-629.681) [-630.542] (-632.611) * (-630.643) (-635.079) [-628.888] (-629.932) -- 0:00:45
      248000 -- (-632.927) [-629.663] (-631.420) (-631.061) * (-631.784) (-631.812) (-632.050) [-628.873] -- 0:00:45
      248500 -- (-630.911) [-629.807] (-636.017) (-629.055) * [-630.779] (-632.507) (-635.374) (-630.968) -- 0:00:45
      249000 -- (-629.836) (-632.158) (-630.216) [-629.928] * (-630.106) (-632.309) (-631.030) [-630.541] -- 0:00:45
      249500 -- (-630.661) (-630.760) [-631.947] (-632.953) * [-630.033] (-633.419) (-630.838) (-637.325) -- 0:00:45
      250000 -- (-633.282) (-630.409) [-629.866] (-634.243) * [-630.358] (-631.521) (-631.064) (-634.985) -- 0:00:45

      Average standard deviation of split frequencies: 0.010226

      250500 -- [-634.245] (-629.293) (-633.416) (-632.107) * [-629.065] (-631.237) (-630.632) (-631.001) -- 0:00:44
      251000 -- (-636.041) (-631.766) [-633.606] (-635.007) * [-629.678] (-633.367) (-632.189) (-634.371) -- 0:00:44
      251500 -- [-630.303] (-630.874) (-630.139) (-632.356) * (-629.597) [-631.403] (-630.939) (-632.792) -- 0:00:44
      252000 -- (-629.084) [-630.748] (-630.504) (-630.507) * (-630.559) (-635.229) (-629.996) [-631.331] -- 0:00:47
      252500 -- (-630.962) (-633.396) [-630.502] (-630.513) * (-629.677) (-633.174) (-630.472) [-637.498] -- 0:00:47
      253000 -- [-632.103] (-630.373) (-629.399) (-631.681) * (-630.015) (-631.222) [-631.817] (-634.281) -- 0:00:47
      253500 -- (-630.221) [-629.124] (-629.692) (-629.375) * (-630.793) (-630.411) (-631.719) [-630.496] -- 0:00:47
      254000 -- (-631.293) [-631.196] (-630.144) (-629.414) * [-630.419] (-630.262) (-630.004) (-632.184) -- 0:00:46
      254500 -- [-632.654] (-629.899) (-633.821) (-629.427) * (-631.190) [-631.579] (-630.724) (-631.667) -- 0:00:46
      255000 -- (-633.131) (-630.178) [-633.290] (-632.294) * (-631.586) (-632.548) [-629.087] (-632.052) -- 0:00:46

      Average standard deviation of split frequencies: 0.010243

      255500 -- (-629.223) [-629.899] (-631.220) (-633.394) * (-631.711) [-629.353] (-630.247) (-631.906) -- 0:00:46
      256000 -- [-630.957] (-629.538) (-633.167) (-631.860) * (-631.035) (-631.678) [-630.335] (-631.538) -- 0:00:46
      256500 -- (-631.542) (-629.168) [-631.006] (-634.819) * [-629.525] (-629.720) (-631.101) (-629.343) -- 0:00:46
      257000 -- (-631.194) [-629.723] (-630.077) (-629.835) * [-630.596] (-631.688) (-632.788) (-628.751) -- 0:00:46
      257500 -- (-632.932) [-629.777] (-630.724) (-632.822) * (-631.139) (-633.359) (-629.201) [-629.636] -- 0:00:46
      258000 -- (-631.700) (-629.869) (-632.811) [-630.059] * (-632.519) (-634.334) (-629.216) [-630.533] -- 0:00:46
      258500 -- (-633.260) (-632.239) (-630.145) [-632.014] * (-633.687) [-629.481] (-634.360) (-632.612) -- 0:00:45
      259000 -- (-636.263) (-635.213) [-632.138] (-631.886) * (-632.582) [-630.212] (-635.530) (-629.348) -- 0:00:45
      259500 -- [-630.299] (-629.656) (-631.802) (-631.651) * (-630.054) [-633.024] (-633.516) (-630.515) -- 0:00:45
      260000 -- (-632.431) (-632.736) (-635.826) [-631.259] * (-629.730) [-629.127] (-632.542) (-629.143) -- 0:00:45

      Average standard deviation of split frequencies: 0.009607

      260500 -- (-630.203) [-632.573] (-630.867) (-634.671) * (-631.268) (-632.973) [-631.462] (-630.998) -- 0:00:45
      261000 -- (-630.109) (-631.118) (-630.236) [-629.851] * (-629.885) (-630.864) [-630.729] (-629.826) -- 0:00:45
      261500 -- (-632.537) [-630.424] (-631.115) (-629.018) * (-630.664) [-629.503] (-632.725) (-634.617) -- 0:00:45
      262000 -- (-632.427) (-631.971) [-628.820] (-630.916) * (-630.372) (-629.708) [-628.870] (-631.274) -- 0:00:45
      262500 -- (-632.109) (-631.635) (-628.772) [-631.183] * (-631.336) [-630.724] (-629.172) (-630.366) -- 0:00:44
      263000 -- (-630.447) (-636.341) [-629.973] (-629.940) * (-630.764) [-630.799] (-629.438) (-630.084) -- 0:00:44
      263500 -- [-630.698] (-631.963) (-631.572) (-630.212) * (-631.097) (-631.734) (-629.073) [-629.321] -- 0:00:44
      264000 -- (-630.338) (-629.119) (-628.863) [-632.250] * (-634.429) [-632.009] (-632.024) (-632.496) -- 0:00:44
      264500 -- (-629.482) (-628.500) (-631.043) [-629.468] * [-631.429] (-631.768) (-629.148) (-635.566) -- 0:00:44
      265000 -- (-628.540) (-630.708) [-631.750] (-629.651) * (-631.940) [-630.000] (-632.427) (-633.692) -- 0:00:44

      Average standard deviation of split frequencies: 0.008236

      265500 -- (-629.985) [-636.293] (-629.448) (-629.011) * [-630.750] (-630.600) (-631.297) (-630.394) -- 0:00:44
      266000 -- (-630.727) (-632.597) [-630.890] (-630.487) * (-630.475) [-633.091] (-632.743) (-630.700) -- 0:00:44
      266500 -- (-635.514) (-631.044) (-629.172) [-633.108] * [-628.881] (-636.165) (-630.156) (-633.500) -- 0:00:44
      267000 -- (-635.877) (-631.426) [-629.603] (-633.655) * (-629.974) (-629.723) [-630.205] (-631.334) -- 0:00:43
      267500 -- [-630.959] (-631.997) (-631.470) (-634.101) * (-632.938) (-629.363) (-630.023) [-631.691] -- 0:00:43
      268000 -- (-630.378) (-631.193) [-631.164] (-632.208) * [-630.688] (-629.690) (-629.949) (-629.817) -- 0:00:43
      268500 -- [-630.882] (-632.696) (-636.007) (-633.638) * (-636.116) [-632.441] (-633.315) (-629.020) -- 0:00:43
      269000 -- (-629.371) [-631.185] (-632.689) (-631.853) * (-631.796) [-631.827] (-632.800) (-630.286) -- 0:00:46
      269500 -- [-630.126] (-635.174) (-633.016) (-632.359) * [-629.145] (-632.073) (-633.231) (-629.764) -- 0:00:46
      270000 -- (-629.685) (-631.244) (-634.772) [-629.436] * (-630.865) (-631.762) [-630.525] (-630.180) -- 0:00:45

      Average standard deviation of split frequencies: 0.007946

      270500 -- (-630.772) (-632.096) [-629.448] (-629.924) * (-629.208) (-630.405) (-633.028) [-629.523] -- 0:00:45
      271000 -- (-632.653) (-630.134) [-629.337] (-628.585) * (-629.395) [-630.232] (-633.302) (-632.021) -- 0:00:45
      271500 -- (-632.945) [-629.322] (-630.316) (-630.002) * (-630.473) (-635.867) (-632.035) [-631.121] -- 0:00:45
      272000 -- (-629.410) [-630.006] (-631.150) (-629.939) * (-631.707) (-631.422) [-629.231] (-631.084) -- 0:00:45
      272500 -- (-630.773) (-629.421) (-633.207) [-630.632] * (-629.975) [-629.756] (-630.748) (-630.201) -- 0:00:45
      273000 -- (-630.550) (-629.747) [-631.946] (-633.667) * (-629.384) [-631.776] (-629.329) (-631.251) -- 0:00:45
      273500 -- (-630.175) [-633.518] (-628.736) (-631.035) * (-629.561) (-634.066) [-629.448] (-631.043) -- 0:00:45
      274000 -- (-633.051) [-630.547] (-633.391) (-633.981) * [-630.272] (-636.531) (-628.949) (-630.205) -- 0:00:45
      274500 -- (-631.937) (-629.193) (-635.872) [-629.723] * (-632.799) (-631.030) (-629.738) [-629.627] -- 0:00:44
      275000 -- (-631.590) (-632.224) [-631.051] (-631.393) * (-629.382) (-632.672) [-629.235] (-631.612) -- 0:00:44

      Average standard deviation of split frequencies: 0.008220

      275500 -- (-633.995) (-632.231) (-630.704) [-633.375] * [-629.362] (-630.929) (-636.245) (-629.821) -- 0:00:44
      276000 -- [-634.380] (-631.775) (-630.561) (-632.165) * (-629.897) [-630.228] (-631.396) (-632.401) -- 0:00:44
      276500 -- (-632.121) [-630.805] (-630.781) (-631.043) * (-630.222) (-629.403) [-630.133] (-631.002) -- 0:00:44
      277000 -- (-636.811) [-630.911] (-634.972) (-632.849) * (-632.041) (-629.011) [-628.689] (-631.677) -- 0:00:44
      277500 -- (-631.041) [-630.364] (-630.497) (-629.978) * (-630.502) (-631.128) [-629.535] (-630.789) -- 0:00:44
      278000 -- (-631.984) [-630.984] (-630.450) (-630.795) * (-630.505) (-630.983) [-629.395] (-630.780) -- 0:00:44
      278500 -- (-628.958) (-632.931) [-629.824] (-631.174) * (-630.685) (-630.614) (-629.458) [-629.965] -- 0:00:44
      279000 -- [-629.214] (-631.278) (-630.844) (-630.691) * (-630.166) (-631.664) (-629.029) [-630.160] -- 0:00:43
      279500 -- [-629.692] (-632.492) (-631.247) (-632.604) * (-631.518) (-630.436) [-630.454] (-630.696) -- 0:00:43
      280000 -- (-630.670) (-636.390) (-630.885) [-632.075] * (-632.936) (-630.571) [-631.994] (-632.107) -- 0:00:43

      Average standard deviation of split frequencies: 0.007838

      280500 -- (-630.286) [-628.800] (-630.960) (-629.918) * (-629.867) (-631.235) (-633.316) [-631.259] -- 0:00:43
      281000 -- [-630.486] (-630.063) (-633.489) (-630.705) * (-633.847) [-629.726] (-631.813) (-628.863) -- 0:00:43
      281500 -- [-631.140] (-632.379) (-636.579) (-629.545) * (-633.103) [-631.151] (-629.338) (-629.456) -- 0:00:43
      282000 -- (-634.239) (-631.233) (-635.502) [-629.496] * [-630.447] (-629.133) (-629.078) (-631.104) -- 0:00:43
      282500 -- [-630.471] (-630.092) (-636.195) (-628.999) * (-629.364) [-629.115] (-631.991) (-630.415) -- 0:00:43
      283000 -- [-630.264] (-633.642) (-634.399) (-633.715) * [-629.752] (-630.303) (-630.902) (-631.269) -- 0:00:43
      283500 -- (-630.399) (-628.859) [-630.274] (-628.683) * (-630.623) (-631.290) (-635.904) [-631.030] -- 0:00:42
      284000 -- (-630.801) (-631.881) [-630.547] (-631.329) * (-630.474) (-634.368) (-634.928) [-629.480] -- 0:00:42
      284500 -- (-631.751) (-631.061) [-631.607] (-630.692) * (-631.194) (-630.967) (-630.839) [-632.400] -- 0:00:42
      285000 -- [-630.604] (-630.683) (-629.407) (-632.131) * (-629.122) [-633.349] (-630.954) (-631.641) -- 0:00:42

      Average standard deviation of split frequencies: 0.008344

      285500 -- [-628.745] (-631.159) (-632.951) (-630.630) * (-629.876) [-631.318] (-633.865) (-629.693) -- 0:00:42
      286000 -- [-630.037] (-630.360) (-628.936) (-630.208) * (-632.994) [-632.490] (-631.629) (-633.517) -- 0:00:44
      286500 -- (-630.513) [-630.645] (-630.350) (-638.901) * (-631.741) [-631.628] (-631.112) (-630.792) -- 0:00:44
      287000 -- [-629.178] (-632.510) (-630.450) (-631.523) * (-632.750) (-629.450) (-629.112) [-628.985] -- 0:00:44
      287500 -- [-628.981] (-628.998) (-629.474) (-632.321) * (-637.875) (-629.651) (-632.021) [-632.857] -- 0:00:44
      288000 -- (-628.821) (-630.006) (-631.577) [-630.467] * (-632.327) [-629.953] (-631.170) (-634.199) -- 0:00:44
      288500 -- (-629.696) (-629.371) (-632.155) [-633.729] * (-632.724) (-629.445) (-631.339) [-630.670] -- 0:00:44
      289000 -- (-629.326) [-631.907] (-630.882) (-629.444) * [-631.302] (-632.918) (-630.364) (-631.083) -- 0:00:44
      289500 -- [-630.671] (-631.578) (-632.127) (-632.629) * (-632.907) (-629.394) (-632.915) [-633.650] -- 0:00:44
      290000 -- (-633.175) (-631.011) [-629.255] (-630.366) * (-632.418) (-629.285) [-629.753] (-633.004) -- 0:00:44

      Average standard deviation of split frequencies: 0.007906

      290500 -- (-632.727) [-630.307] (-630.509) (-628.845) * (-629.930) (-628.726) [-629.333] (-630.261) -- 0:00:43
      291000 -- (-629.608) (-631.485) (-630.593) [-629.037] * (-629.906) (-629.452) (-633.204) [-631.031] -- 0:00:43
      291500 -- (-631.615) (-632.482) [-632.422] (-629.003) * (-629.900) (-629.941) [-632.014] (-633.775) -- 0:00:43
      292000 -- [-630.800] (-632.351) (-629.157) (-632.127) * (-632.071) (-631.434) [-634.614] (-639.514) -- 0:00:43
      292500 -- (-632.376) [-634.241] (-631.539) (-629.529) * (-634.174) (-631.706) [-631.755] (-630.720) -- 0:00:43
      293000 -- (-631.724) [-630.779] (-632.119) (-632.903) * [-628.610] (-631.611) (-630.229) (-629.487) -- 0:00:43
      293500 -- [-631.243] (-630.240) (-629.395) (-629.850) * (-629.884) (-630.971) [-631.775] (-629.205) -- 0:00:43
      294000 -- [-633.868] (-635.354) (-630.453) (-629.127) * (-631.642) [-631.056] (-634.168) (-632.817) -- 0:00:43
      294500 -- (-630.311) (-632.993) [-633.145] (-629.155) * [-631.534] (-630.704) (-633.843) (-630.185) -- 0:00:43
      295000 -- (-630.628) (-631.564) [-633.613] (-629.137) * (-630.916) (-632.618) [-630.232] (-630.049) -- 0:00:43

      Average standard deviation of split frequencies: 0.008461

      295500 -- (-630.781) [-632.404] (-635.539) (-630.739) * (-632.071) (-631.822) [-630.705] (-629.529) -- 0:00:42
      296000 -- (-631.357) (-630.950) [-629.866] (-631.830) * (-631.251) [-629.405] (-630.344) (-630.431) -- 0:00:42
      296500 -- (-633.931) (-628.981) [-630.629] (-629.452) * (-631.411) (-632.394) (-633.754) [-629.232] -- 0:00:42
      297000 -- (-632.082) [-629.094] (-632.895) (-633.969) * (-630.017) (-631.038) (-633.762) [-629.052] -- 0:00:42
      297500 -- (-630.570) (-631.114) (-632.891) [-632.460] * [-628.866] (-630.691) (-629.713) (-631.274) -- 0:00:42
      298000 -- (-634.971) (-629.586) (-634.888) [-630.773] * (-629.549) (-630.344) [-629.800] (-631.868) -- 0:00:42
      298500 -- (-632.614) (-629.536) (-630.574) [-629.784] * [-631.249] (-631.359) (-631.640) (-629.422) -- 0:00:42
      299000 -- (-632.313) [-628.787] (-631.221) (-634.233) * [-633.042] (-634.015) (-630.366) (-629.454) -- 0:00:42
      299500 -- [-633.588] (-633.662) (-629.706) (-630.768) * [-632.634] (-631.835) (-630.461) (-631.339) -- 0:00:42
      300000 -- (-631.491) (-632.804) (-631.021) [-630.648] * (-630.164) [-631.567] (-630.744) (-632.269) -- 0:00:42

      Average standard deviation of split frequencies: 0.007378

      300500 -- (-632.672) (-631.143) (-631.285) [-630.666] * (-629.896) (-631.202) [-630.689] (-629.405) -- 0:00:41
      301000 -- (-631.465) (-629.717) [-629.402] (-631.074) * (-629.950) (-634.904) [-630.800] (-630.554) -- 0:00:41
      301500 -- (-631.323) (-628.988) (-630.019) [-630.788] * (-631.566) [-631.082] (-631.621) (-630.172) -- 0:00:41
      302000 -- [-630.792] (-630.801) (-637.506) (-632.115) * (-629.882) (-629.209) [-630.058] (-630.226) -- 0:00:41
      302500 -- (-632.446) [-630.749] (-629.978) (-632.646) * (-631.599) [-630.553] (-629.328) (-629.682) -- 0:00:41
      303000 -- [-632.373] (-632.305) (-632.934) (-628.949) * (-631.912) (-628.989) (-632.049) [-634.589] -- 0:00:43
      303500 -- (-632.769) (-632.278) (-631.662) [-630.789] * (-630.436) [-632.363] (-628.962) (-635.114) -- 0:00:43
      304000 -- (-633.174) [-633.819] (-634.026) (-630.228) * (-634.498) [-631.926] (-629.575) (-635.150) -- 0:00:43
      304500 -- [-635.455] (-630.104) (-633.257) (-629.867) * (-632.146) (-630.897) (-631.951) [-635.076] -- 0:00:43
      305000 -- (-630.225) (-628.935) [-631.841] (-628.991) * (-629.455) (-629.229) (-633.832) [-633.495] -- 0:00:43

      Average standard deviation of split frequencies: 0.006978

      305500 -- (-629.237) [-629.024] (-631.977) (-631.919) * (-628.971) [-630.152] (-634.044) (-631.745) -- 0:00:43
      306000 -- (-630.505) (-633.473) (-630.532) [-629.125] * (-631.370) (-631.510) [-629.000] (-631.792) -- 0:00:43
      306500 -- (-629.973) (-632.318) [-632.493] (-628.710) * (-631.449) (-631.404) (-629.162) [-629.665] -- 0:00:42
      307000 -- (-630.182) [-628.699] (-632.015) (-630.015) * [-629.699] (-632.430) (-628.964) (-630.530) -- 0:00:42
      307500 -- (-629.965) (-629.022) [-631.464] (-629.933) * [-630.591] (-632.721) (-628.868) (-629.343) -- 0:00:42
      308000 -- (-632.018) [-630.093] (-633.726) (-629.465) * (-633.807) [-631.807] (-630.186) (-632.144) -- 0:00:42
      308500 -- (-628.637) [-630.876] (-633.283) (-630.639) * [-631.854] (-630.247) (-629.632) (-629.253) -- 0:00:42
      309000 -- [-630.574] (-631.036) (-629.673) (-630.520) * (-630.768) [-630.688] (-631.364) (-630.390) -- 0:00:42
      309500 -- (-630.548) (-634.678) [-631.937] (-631.063) * (-630.694) (-629.314) (-630.338) [-632.730] -- 0:00:42
      310000 -- (-630.435) (-631.767) (-632.774) [-630.732] * (-632.777) (-628.567) [-632.970] (-635.267) -- 0:00:42

      Average standard deviation of split frequencies: 0.006784

      310500 -- (-630.639) (-632.592) (-629.324) [-630.430] * [-629.633] (-630.575) (-630.407) (-634.133) -- 0:00:42
      311000 -- (-634.202) (-636.059) [-629.981] (-630.007) * (-629.273) [-631.926] (-631.337) (-631.259) -- 0:00:42
      311500 -- (-637.191) (-634.025) [-632.075] (-630.064) * [-630.327] (-632.007) (-632.967) (-629.772) -- 0:00:41
      312000 -- (-636.439) (-631.476) [-630.281] (-629.294) * (-630.477) [-629.837] (-630.667) (-631.147) -- 0:00:41
      312500 -- (-635.639) [-630.879] (-629.755) (-628.943) * (-629.557) (-629.565) [-631.136] (-630.329) -- 0:00:41
      313000 -- (-630.401) (-629.632) (-631.783) [-628.835] * [-629.275] (-633.052) (-630.578) (-631.188) -- 0:00:41
      313500 -- [-629.741] (-629.398) (-632.368) (-629.160) * (-630.268) [-629.389] (-631.863) (-632.701) -- 0:00:41
      314000 -- [-629.777] (-629.094) (-629.926) (-631.615) * (-630.470) (-631.084) (-629.356) [-630.841] -- 0:00:41
      314500 -- (-631.097) [-629.200] (-632.654) (-629.763) * (-633.037) (-633.972) [-628.976] (-633.054) -- 0:00:41
      315000 -- (-629.955) (-629.086) (-630.341) [-630.160] * [-631.373] (-630.868) (-633.038) (-629.464) -- 0:00:41

      Average standard deviation of split frequencies: 0.006669

      315500 -- [-630.465] (-628.810) (-632.255) (-630.261) * (-630.901) (-632.568) [-630.987] (-632.925) -- 0:00:41
      316000 -- [-629.043] (-630.739) (-629.883) (-629.138) * [-631.049] (-630.470) (-630.483) (-630.277) -- 0:00:41
      316500 -- [-629.354] (-632.545) (-636.230) (-629.619) * (-631.295) [-630.984] (-630.312) (-628.796) -- 0:00:41
      317000 -- (-633.210) (-632.493) [-631.316] (-632.265) * (-629.525) [-630.957] (-633.041) (-633.279) -- 0:00:40
      317500 -- (-630.308) (-631.279) (-629.326) [-630.882] * (-630.055) (-636.154) [-630.556] (-629.401) -- 0:00:40
      318000 -- (-629.291) (-633.296) (-629.704) [-630.774] * (-632.865) [-633.453] (-630.150) (-631.140) -- 0:00:40
      318500 -- [-630.801] (-629.874) (-630.719) (-629.980) * (-631.993) (-630.818) (-636.854) [-633.591] -- 0:00:40
      319000 -- (-632.185) [-629.812] (-632.338) (-630.402) * (-632.631) (-629.547) (-630.422) [-632.690] -- 0:00:40
      319500 -- (-630.509) [-631.523] (-630.361) (-632.444) * [-631.240] (-632.790) (-631.865) (-630.862) -- 0:00:40
      320000 -- (-629.812) (-630.384) [-631.313] (-628.776) * (-631.421) (-632.299) [-630.801] (-634.280) -- 0:00:42

      Average standard deviation of split frequencies: 0.006156

      320500 -- (-630.372) [-631.372] (-632.646) (-628.504) * [-631.735] (-631.089) (-633.345) (-629.336) -- 0:00:42
      321000 -- (-630.791) (-632.179) (-631.621) [-632.868] * [-630.156] (-629.362) (-631.316) (-630.353) -- 0:00:42
      321500 -- (-631.771) [-630.437] (-629.709) (-630.446) * (-628.708) (-631.135) (-630.380) [-631.387] -- 0:00:42
      322000 -- (-630.183) (-631.531) (-629.797) [-629.010] * (-629.021) [-631.407] (-636.800) (-630.998) -- 0:00:42
      322500 -- [-630.971] (-632.325) (-633.410) (-632.103) * (-630.816) (-631.824) (-632.463) [-633.013] -- 0:00:42
      323000 -- (-629.266) (-630.236) (-632.133) [-628.616] * (-630.006) (-630.818) [-629.158] (-630.221) -- 0:00:41
      323500 -- (-629.559) (-629.313) (-632.484) [-630.451] * [-629.024] (-630.474) (-630.541) (-630.397) -- 0:00:41
      324000 -- [-629.628] (-629.273) (-631.835) (-628.661) * (-628.761) (-631.563) [-629.719] (-631.430) -- 0:00:41
      324500 -- (-630.193) (-631.520) (-633.966) [-629.809] * (-629.604) [-630.500] (-634.465) (-631.845) -- 0:00:41
      325000 -- (-629.176) [-628.803] (-630.103) (-632.729) * (-628.633) (-630.212) [-634.184] (-632.463) -- 0:00:41

      Average standard deviation of split frequencies: 0.006465

      325500 -- (-631.052) [-631.507] (-628.730) (-630.756) * [-630.127] (-629.428) (-630.679) (-632.266) -- 0:00:41
      326000 -- (-629.590) (-631.769) (-629.231) [-632.170] * (-630.295) (-630.689) (-629.347) [-631.298] -- 0:00:41
      326500 -- (-628.530) [-637.002] (-628.691) (-631.169) * (-629.661) (-632.010) (-629.562) [-631.487] -- 0:00:41
      327000 -- (-632.715) (-632.299) (-629.594) [-632.741] * (-628.909) [-631.761] (-629.161) (-629.648) -- 0:00:41
      327500 -- [-630.941] (-632.199) (-629.562) (-629.359) * (-631.632) (-632.223) [-629.633] (-631.634) -- 0:00:41
      328000 -- [-630.721] (-630.984) (-629.568) (-629.725) * (-632.532) [-630.002] (-629.938) (-631.125) -- 0:00:40
      328500 -- [-628.597] (-631.586) (-631.618) (-629.211) * (-631.966) (-629.992) (-630.843) [-630.799] -- 0:00:40
      329000 -- (-628.741) (-630.976) [-631.342] (-630.637) * (-631.054) (-630.781) [-630.952] (-632.062) -- 0:00:40
      329500 -- (-633.579) [-630.832] (-631.532) (-631.233) * (-630.386) (-630.287) [-629.365] (-631.132) -- 0:00:40
      330000 -- (-630.324) (-629.988) [-631.780] (-630.034) * (-628.755) [-629.691] (-630.798) (-629.809) -- 0:00:40

      Average standard deviation of split frequencies: 0.006653

      330500 -- (-629.812) [-628.906] (-634.034) (-631.123) * (-630.452) (-629.734) [-630.081] (-630.079) -- 0:00:40
      331000 -- (-637.422) (-629.588) [-632.382] (-628.592) * [-631.479] (-632.440) (-630.477) (-632.042) -- 0:00:40
      331500 -- (-631.832) (-631.324) (-629.490) [-634.791] * [-630.740] (-631.424) (-634.336) (-631.420) -- 0:00:40
      332000 -- (-632.204) [-630.264] (-635.807) (-629.971) * (-631.241) (-633.551) (-631.221) [-630.258] -- 0:00:40
      332500 -- (-633.005) (-630.289) [-633.083] (-633.726) * (-631.618) (-633.442) (-632.116) [-631.064] -- 0:00:40
      333000 -- (-630.046) (-630.767) (-632.136) [-631.606] * (-629.563) [-631.136] (-632.928) (-629.257) -- 0:00:40
      333500 -- [-629.659] (-631.116) (-634.764) (-631.733) * [-630.983] (-629.470) (-632.142) (-633.801) -- 0:00:39
      334000 -- (-628.658) [-629.700] (-633.878) (-629.333) * (-629.679) (-629.372) (-630.307) [-637.958] -- 0:00:39
      334500 -- [-630.709] (-631.475) (-630.528) (-631.797) * (-632.506) [-629.936] (-628.976) (-632.549) -- 0:00:39
      335000 -- (-631.865) [-631.280] (-635.095) (-636.213) * [-631.277] (-631.313) (-635.239) (-630.966) -- 0:00:39

      Average standard deviation of split frequencies: 0.007510

      335500 -- (-631.861) [-632.950] (-630.582) (-630.374) * [-632.916] (-631.924) (-630.526) (-629.237) -- 0:00:39
      336000 -- [-629.132] (-636.664) (-634.445) (-628.861) * (-630.260) (-630.148) [-631.704] (-631.287) -- 0:00:39
      336500 -- (-630.139) (-631.564) (-629.151) [-631.180] * (-633.681) (-633.797) [-628.914] (-630.264) -- 0:00:39
      337000 -- [-631.251] (-628.831) (-633.264) (-629.345) * (-633.400) (-630.408) (-630.822) [-630.615] -- 0:00:41
      337500 -- (-632.155) [-629.810] (-630.084) (-634.329) * [-630.163] (-629.367) (-631.088) (-632.378) -- 0:00:41
      338000 -- (-631.626) [-632.160] (-634.175) (-633.208) * (-632.549) [-629.934] (-630.258) (-633.827) -- 0:00:41
      338500 -- [-631.242] (-629.403) (-629.810) (-634.372) * (-635.134) (-629.934) (-629.670) [-632.728] -- 0:00:41
      339000 -- (-630.325) (-632.250) [-631.051] (-631.152) * [-631.142] (-628.770) (-634.581) (-633.497) -- 0:00:40
      339500 -- (-629.589) (-631.103) (-632.315) [-628.640] * (-629.958) (-630.519) (-631.118) [-631.828] -- 0:00:40
      340000 -- [-629.699] (-632.320) (-629.621) (-631.246) * (-632.480) [-631.851] (-633.474) (-629.640) -- 0:00:40

      Average standard deviation of split frequencies: 0.007733

      340500 -- (-631.256) (-630.221) [-629.281] (-628.511) * (-630.845) (-629.430) (-635.371) [-629.525] -- 0:00:40
      341000 -- (-630.363) [-631.339] (-629.674) (-632.984) * (-632.396) (-630.136) (-630.683) [-630.180] -- 0:00:40
      341500 -- (-630.653) (-633.017) (-634.091) [-631.017] * (-632.942) (-629.888) [-631.826] (-632.249) -- 0:00:40
      342000 -- (-630.707) [-631.791] (-632.107) (-630.026) * (-635.880) (-630.424) [-634.358] (-632.607) -- 0:00:40
      342500 -- (-633.005) [-630.303] (-630.029) (-630.479) * (-632.389) [-630.364] (-634.284) (-630.073) -- 0:00:40
      343000 -- [-630.367] (-631.025) (-633.057) (-629.986) * (-634.535) (-630.466) (-634.515) [-634.114] -- 0:00:40
      343500 -- (-634.694) (-632.373) (-629.843) [-631.255] * (-632.198) [-629.901] (-633.873) (-630.912) -- 0:00:40
      344000 -- [-633.087] (-630.354) (-630.589) (-628.766) * (-633.863) [-634.689] (-632.484) (-632.887) -- 0:00:40
      344500 -- [-634.018] (-630.775) (-632.811) (-628.714) * (-630.849) (-631.333) (-631.461) [-629.096] -- 0:00:39
      345000 -- (-629.317) (-632.154) (-632.232) [-629.465] * (-630.185) (-631.517) [-629.383] (-629.100) -- 0:00:39

      Average standard deviation of split frequencies: 0.007720

      345500 -- (-630.092) (-628.938) [-631.574] (-630.841) * [-632.858] (-633.859) (-631.303) (-634.554) -- 0:00:39
      346000 -- (-628.588) [-629.710] (-632.194) (-635.371) * (-633.264) [-631.998] (-632.783) (-630.954) -- 0:00:39
      346500 -- [-629.951] (-629.858) (-630.020) (-633.511) * (-635.337) [-632.258] (-630.231) (-629.382) -- 0:00:39
      347000 -- (-631.405) [-629.820] (-630.299) (-634.923) * (-631.040) (-633.643) [-631.838] (-631.814) -- 0:00:39
      347500 -- (-637.087) (-629.084) [-630.678] (-629.788) * [-632.715] (-630.425) (-629.758) (-629.586) -- 0:00:39
      348000 -- [-631.253] (-629.604) (-629.898) (-630.683) * (-632.949) [-630.561] (-630.882) (-633.995) -- 0:00:39
      348500 -- (-635.572) [-631.065] (-632.151) (-628.860) * (-632.077) [-629.659] (-629.036) (-632.230) -- 0:00:39
      349000 -- (-629.364) (-630.824) [-630.312] (-630.125) * (-630.349) (-629.708) (-629.836) [-631.037] -- 0:00:39
      349500 -- (-630.042) [-631.847] (-630.727) (-631.130) * (-630.479) (-631.782) (-629.342) [-629.398] -- 0:00:39
      350000 -- (-633.642) [-630.365] (-632.699) (-629.582) * (-635.668) (-630.046) (-632.295) [-631.608] -- 0:00:39

      Average standard deviation of split frequencies: 0.008663

      350500 -- (-634.701) (-636.073) [-631.827] (-629.956) * (-629.433) (-631.932) [-629.760] (-635.130) -- 0:00:38
      351000 -- (-632.911) (-634.032) (-630.281) [-630.829] * (-631.683) (-633.502) (-629.974) [-629.201] -- 0:00:38
      351500 -- (-629.154) (-629.035) [-630.755] (-630.319) * (-629.054) [-629.373] (-629.913) (-632.212) -- 0:00:38
      352000 -- (-631.199) (-632.361) [-630.436] (-637.733) * (-631.774) (-632.456) [-629.764] (-628.869) -- 0:00:38
      352500 -- [-629.654] (-631.184) (-630.030) (-637.209) * (-636.815) [-629.584] (-629.694) (-630.051) -- 0:00:38
      353000 -- (-634.731) (-630.104) (-632.505) [-633.256] * (-631.321) (-629.157) [-629.070] (-630.432) -- 0:00:38
      353500 -- (-634.048) (-632.166) (-631.088) [-630.498] * [-630.168] (-632.401) (-630.683) (-630.289) -- 0:00:38
      354000 -- (-629.730) [-630.959] (-633.507) (-632.632) * (-630.594) (-628.855) [-629.454] (-630.743) -- 0:00:40
      354500 -- (-629.809) (-630.345) [-632.558] (-631.864) * [-632.249] (-629.066) (-629.393) (-630.315) -- 0:00:40
      355000 -- [-630.476] (-631.413) (-630.088) (-630.401) * (-630.905) (-630.399) [-631.773] (-629.744) -- 0:00:39

      Average standard deviation of split frequencies: 0.007945

      355500 -- (-629.936) [-630.539] (-630.262) (-631.705) * (-636.011) (-629.921) [-631.161] (-631.520) -- 0:00:39
      356000 -- (-636.341) (-629.938) (-635.130) [-631.054] * (-633.718) (-631.049) (-630.056) [-631.717] -- 0:00:39
      356500 -- (-633.211) [-633.681] (-635.256) (-631.109) * (-628.738) [-630.875] (-631.075) (-631.121) -- 0:00:39
      357000 -- (-631.266) (-635.807) (-630.661) [-629.634] * (-632.052) [-630.759] (-629.464) (-629.372) -- 0:00:39
      357500 -- [-634.153] (-630.830) (-631.263) (-630.213) * (-629.807) (-635.050) [-629.419] (-629.611) -- 0:00:39
      358000 -- (-631.410) [-630.378] (-639.432) (-629.339) * (-632.755) (-630.264) (-634.518) [-631.329] -- 0:00:39
      358500 -- [-630.996] (-629.734) (-633.574) (-629.489) * (-634.562) [-630.148] (-629.520) (-629.789) -- 0:00:39
      359000 -- (-630.449) [-630.672] (-629.659) (-630.365) * (-634.562) [-633.678] (-630.393) (-629.330) -- 0:00:39
      359500 -- (-637.951) (-631.307) (-632.025) [-631.069] * (-633.270) (-633.273) [-635.144] (-629.716) -- 0:00:39
      360000 -- (-632.903) (-633.302) (-631.698) [-630.431] * [-630.374] (-630.741) (-632.990) (-630.165) -- 0:00:39

      Average standard deviation of split frequencies: 0.008332

      360500 -- (-630.968) (-631.974) [-633.778] (-630.159) * (-632.895) (-629.098) (-635.528) [-630.700] -- 0:00:39
      361000 -- (-633.170) (-630.266) [-632.521] (-630.271) * (-632.242) [-630.784] (-630.851) (-632.509) -- 0:00:38
      361500 -- [-630.926] (-634.888) (-632.711) (-629.533) * (-632.074) [-630.538] (-629.787) (-629.041) -- 0:00:38
      362000 -- (-630.483) [-629.551] (-629.823) (-630.373) * (-635.567) [-630.694] (-630.153) (-629.100) -- 0:00:38
      362500 -- [-629.463] (-638.389) (-633.017) (-634.409) * (-631.262) (-629.517) [-630.466] (-629.100) -- 0:00:38
      363000 -- (-630.721) (-630.792) (-631.718) [-631.745] * (-628.743) (-633.204) [-632.468] (-632.206) -- 0:00:38
      363500 -- (-630.960) [-629.264] (-631.737) (-629.122) * (-628.803) (-629.714) [-629.610] (-635.356) -- 0:00:38
      364000 -- [-629.835] (-630.070) (-629.990) (-631.718) * (-630.322) (-630.993) (-629.612) [-633.535] -- 0:00:38
      364500 -- (-630.692) (-631.908) [-629.256] (-631.985) * (-632.133) (-630.717) (-631.138) [-630.380] -- 0:00:38
      365000 -- (-631.423) [-629.708] (-631.059) (-633.708) * (-633.258) (-629.450) [-632.230] (-631.918) -- 0:00:38

      Average standard deviation of split frequencies: 0.008935

      365500 -- (-630.171) (-632.798) (-631.198) [-632.041] * (-630.310) [-632.743] (-634.598) (-640.034) -- 0:00:38
      366000 -- (-633.528) (-631.125) [-630.878] (-633.037) * [-631.373] (-631.795) (-629.824) (-632.535) -- 0:00:38
      366500 -- (-629.247) (-631.631) (-631.931) [-633.505] * (-632.881) (-630.574) [-630.227] (-635.042) -- 0:00:38
      367000 -- [-629.863] (-629.384) (-631.787) (-630.311) * (-630.352) [-629.461] (-632.187) (-629.899) -- 0:00:37
      367500 -- (-630.873) (-632.744) [-631.481] (-629.951) * (-630.059) [-630.691] (-630.257) (-629.879) -- 0:00:37
      368000 -- (-631.616) (-629.961) [-633.504] (-629.745) * [-629.874] (-630.646) (-636.142) (-629.069) -- 0:00:37
      368500 -- (-629.263) (-631.031) (-630.332) [-628.659] * (-629.874) (-630.038) [-629.668] (-630.320) -- 0:00:37
      369000 -- (-631.168) (-629.659) [-632.167] (-628.940) * [-629.657] (-629.630) (-633.463) (-634.044) -- 0:00:37
      369500 -- (-631.320) [-631.321] (-633.290) (-630.147) * (-630.989) (-636.770) (-634.269) [-631.123] -- 0:00:37
      370000 -- (-633.547) (-631.493) (-636.004) [-632.332] * (-630.426) [-630.394] (-630.119) (-629.334) -- 0:00:37

      Average standard deviation of split frequencies: 0.007790

      370500 -- [-630.233] (-631.643) (-632.636) (-630.597) * [-630.359] (-629.188) (-629.318) (-631.070) -- 0:00:37
      371000 -- (-631.786) [-629.417] (-632.688) (-629.664) * [-630.554] (-631.671) (-634.078) (-636.143) -- 0:00:37
      371500 -- (-630.798) (-636.695) (-630.254) [-630.612] * (-630.662) (-630.482) (-630.295) [-633.091] -- 0:00:38
      372000 -- [-631.152] (-630.978) (-630.276) (-633.296) * [-630.429] (-634.309) (-631.151) (-629.828) -- 0:00:38
      372500 -- (-630.968) (-632.051) (-631.235) [-633.445] * [-632.028] (-634.572) (-630.608) (-631.027) -- 0:00:38
      373000 -- (-629.359) (-630.573) (-629.073) [-629.359] * (-630.511) (-631.149) [-630.127] (-633.682) -- 0:00:38
      373500 -- [-628.796] (-629.916) (-629.718) (-635.024) * (-631.681) [-632.125] (-630.842) (-630.874) -- 0:00:38
      374000 -- (-629.350) (-635.752) [-632.842] (-630.040) * (-631.704) (-630.421) [-633.136] (-634.403) -- 0:00:38
      374500 -- [-630.328] (-631.408) (-631.200) (-629.514) * (-631.727) (-632.042) [-634.701] (-630.178) -- 0:00:38
      375000 -- (-632.418) (-629.411) [-631.114] (-638.524) * (-630.585) [-631.470] (-635.122) (-629.955) -- 0:00:38

      Average standard deviation of split frequencies: 0.007444

      375500 -- (-633.517) (-629.148) [-629.276] (-633.540) * (-629.705) [-632.881] (-630.210) (-633.876) -- 0:00:38
      376000 -- (-630.245) (-629.942) (-631.650) [-629.682] * (-629.670) (-629.874) [-631.624] (-630.524) -- 0:00:38
      376500 -- [-630.848] (-633.979) (-630.538) (-631.919) * [-630.611] (-628.509) (-629.185) (-633.516) -- 0:00:38
      377000 -- (-631.747) [-628.710] (-630.644) (-630.035) * (-629.719) (-628.509) [-628.873] (-630.231) -- 0:00:38
      377500 -- (-630.497) [-629.457] (-632.127) (-632.054) * (-629.895) [-628.563] (-629.545) (-629.635) -- 0:00:37
      378000 -- (-629.729) (-632.857) [-635.446] (-630.966) * (-631.368) [-632.138] (-630.141) (-632.734) -- 0:00:37
      378500 -- (-629.584) (-632.862) (-631.883) [-630.601] * (-630.904) (-632.282) (-630.403) [-629.861] -- 0:00:37
      379000 -- (-630.041) (-632.864) (-631.792) [-630.556] * (-632.032) (-630.723) (-631.658) [-629.507] -- 0:00:37
      379500 -- (-628.574) [-629.745] (-629.684) (-631.143) * [-631.666] (-630.873) (-632.011) (-633.872) -- 0:00:37
      380000 -- [-629.687] (-633.879) (-630.469) (-629.064) * (-631.178) [-630.186] (-631.284) (-633.125) -- 0:00:37

      Average standard deviation of split frequencies: 0.007043

      380500 -- (-632.575) (-632.329) [-631.686] (-633.977) * (-634.956) (-631.283) [-630.194] (-632.920) -- 0:00:37
      381000 -- (-632.660) (-630.223) [-631.866] (-633.412) * (-636.262) (-630.683) (-631.984) [-630.414] -- 0:00:37
      381500 -- (-631.926) (-630.095) [-630.097] (-633.172) * (-637.678) [-633.195] (-630.009) (-633.910) -- 0:00:37
      382000 -- (-630.786) (-629.215) [-630.432] (-631.835) * (-632.748) (-630.762) (-631.563) [-629.355] -- 0:00:37
      382500 -- [-631.332] (-630.448) (-632.870) (-632.253) * (-630.017) (-631.265) (-630.881) [-630.146] -- 0:00:37
      383000 -- (-633.233) (-629.953) (-631.837) [-629.865] * (-629.511) (-630.949) (-632.336) [-631.366] -- 0:00:37
      383500 -- (-631.301) [-629.874] (-632.014) (-629.707) * (-632.443) (-632.152) [-629.315] (-631.578) -- 0:00:36
      384000 -- (-631.055) (-629.949) [-631.945] (-630.567) * (-638.104) (-632.539) [-631.091] (-631.061) -- 0:00:36
      384500 -- (-631.966) (-633.460) (-629.542) [-629.550] * (-635.961) [-631.460] (-629.040) (-634.369) -- 0:00:36
      385000 -- [-629.536] (-630.143) (-631.485) (-631.518) * [-629.545] (-629.499) (-630.518) (-632.014) -- 0:00:36

      Average standard deviation of split frequencies: 0.006946

      385500 -- (-631.108) [-630.067] (-629.817) (-631.097) * (-630.338) [-629.342] (-630.718) (-631.028) -- 0:00:36
      386000 -- (-629.324) [-629.654] (-630.772) (-637.096) * (-630.786) [-632.863] (-630.703) (-633.010) -- 0:00:36
      386500 -- [-630.203] (-629.128) (-631.069) (-635.080) * [-631.761] (-632.915) (-631.465) (-634.897) -- 0:00:36
      387000 -- [-631.882] (-631.093) (-632.396) (-633.140) * [-633.771] (-631.286) (-629.224) (-631.322) -- 0:00:36
      387500 -- (-631.103) [-630.045] (-631.301) (-632.506) * (-635.889) (-629.464) [-629.394] (-630.773) -- 0:00:36
      388000 -- (-632.014) [-631.324] (-629.889) (-634.807) * (-633.904) [-630.681] (-632.630) (-630.033) -- 0:00:36
      388500 -- (-629.572) (-632.393) [-630.603] (-629.592) * (-631.415) [-628.760] (-632.175) (-630.561) -- 0:00:37
      389000 -- (-628.860) (-631.807) [-633.454] (-629.691) * (-630.909) (-630.055) (-631.277) [-630.734] -- 0:00:37
      389500 -- [-629.533] (-630.672) (-631.370) (-631.655) * (-629.353) [-629.776] (-629.250) (-633.765) -- 0:00:37
      390000 -- (-631.109) (-628.667) [-632.219] (-630.448) * (-629.928) [-629.542] (-633.812) (-634.598) -- 0:00:37

      Average standard deviation of split frequencies: 0.007240

      390500 -- [-629.798] (-628.786) (-630.332) (-629.103) * (-632.555) [-635.632] (-636.418) (-632.156) -- 0:00:37
      391000 -- [-631.306] (-629.960) (-631.540) (-631.659) * (-633.550) (-631.097) (-631.605) [-632.033] -- 0:00:37
      391500 -- (-630.927) (-631.157) [-631.630] (-631.639) * (-632.898) [-629.621] (-629.772) (-632.685) -- 0:00:37
      392000 -- [-632.763] (-631.335) (-630.307) (-630.567) * [-631.082] (-632.015) (-630.071) (-630.817) -- 0:00:37
      392500 -- [-630.425] (-629.411) (-630.788) (-632.974) * [-631.110] (-634.480) (-631.405) (-629.547) -- 0:00:37
      393000 -- (-630.357) [-630.039] (-633.189) (-631.286) * [-633.665] (-631.056) (-631.298) (-630.049) -- 0:00:37
      393500 -- (-634.900) (-629.898) [-633.205] (-629.390) * [-632.871] (-632.120) (-632.316) (-628.450) -- 0:00:36
      394000 -- (-629.821) [-631.297] (-629.256) (-631.045) * (-630.523) [-629.520] (-637.958) (-630.122) -- 0:00:36
      394500 -- (-629.333) [-633.682] (-629.794) (-631.112) * (-632.828) [-631.901] (-632.722) (-632.331) -- 0:00:36
      395000 -- [-632.454] (-630.334) (-633.324) (-629.399) * (-632.431) (-631.450) (-630.690) [-629.823] -- 0:00:36

      Average standard deviation of split frequencies: 0.007283

      395500 -- (-629.952) (-630.765) (-631.051) [-629.516] * (-632.522) (-628.840) (-630.039) [-629.295] -- 0:00:36
      396000 -- (-629.537) [-631.337] (-630.067) (-631.545) * (-629.218) [-631.950] (-633.476) (-630.778) -- 0:00:36
      396500 -- (-630.616) (-629.212) (-630.961) [-629.363] * (-628.515) (-629.445) (-633.670) [-629.363] -- 0:00:36
      397000 -- (-631.096) [-629.060] (-630.597) (-628.967) * [-629.197] (-631.550) (-632.127) (-634.902) -- 0:00:36
      397500 -- (-629.841) (-628.793) (-630.588) [-630.436] * (-629.904) (-632.776) [-630.116] (-632.687) -- 0:00:36
      398000 -- (-629.761) [-628.881] (-631.005) (-629.185) * (-631.553) (-630.927) [-629.073] (-630.613) -- 0:00:36
      398500 -- [-628.984] (-631.397) (-629.680) (-629.282) * [-629.782] (-630.868) (-628.978) (-632.561) -- 0:00:36
      399000 -- (-630.905) (-634.589) [-629.191] (-630.041) * (-628.995) (-629.229) [-629.479] (-631.529) -- 0:00:36
      399500 -- [-631.007] (-630.851) (-630.210) (-628.556) * [-629.742] (-631.918) (-629.255) (-633.049) -- 0:00:36
      400000 -- (-630.741) (-630.310) [-634.757] (-629.636) * (-633.132) (-634.791) (-629.211) [-629.591] -- 0:00:36

      Average standard deviation of split frequencies: 0.006713

      400500 -- [-630.766] (-630.927) (-636.353) (-631.799) * (-629.628) (-631.565) (-634.339) [-630.766] -- 0:00:35
      401000 -- (-630.359) (-631.567) [-635.708] (-631.094) * (-632.991) (-630.559) (-630.952) [-631.743] -- 0:00:35
      401500 -- (-630.567) (-631.871) (-629.998) [-632.434] * (-629.660) (-629.146) (-632.938) [-631.257] -- 0:00:35
      402000 -- (-630.274) (-630.353) [-631.162] (-629.955) * (-630.804) [-629.668] (-631.657) (-633.421) -- 0:00:35
      402500 -- [-631.111] (-631.953) (-631.111) (-629.736) * (-629.633) (-631.361) [-629.568] (-633.132) -- 0:00:35
      403000 -- (-633.237) [-632.355] (-632.683) (-631.293) * (-629.169) [-631.692] (-632.833) (-632.719) -- 0:00:35
      403500 -- (-631.618) [-631.644] (-630.756) (-631.600) * [-630.502] (-631.733) (-630.317) (-629.943) -- 0:00:35
      404000 -- [-632.719] (-633.825) (-628.777) (-632.880) * (-629.680) (-629.930) [-630.984] (-633.565) -- 0:00:35
      404500 -- (-631.007) [-630.702] (-630.321) (-630.405) * (-630.373) (-629.666) (-630.941) [-630.088] -- 0:00:35
      405000 -- (-629.809) (-635.497) [-630.450] (-630.855) * (-630.016) (-629.154) [-630.571] (-630.470) -- 0:00:35

      Average standard deviation of split frequencies: 0.007445

      405500 -- (-631.985) (-633.528) (-631.654) [-631.640] * (-629.846) (-631.019) (-631.402) [-629.917] -- 0:00:36
      406000 -- (-629.276) (-636.519) (-631.205) [-629.791] * (-629.149) (-630.963) (-630.954) [-629.535] -- 0:00:36
      406500 -- [-633.069] (-630.227) (-631.169) (-631.727) * [-630.870] (-631.948) (-632.666) (-634.260) -- 0:00:36
      407000 -- (-635.039) (-629.751) [-630.542] (-628.699) * (-632.993) (-633.127) [-630.966] (-634.583) -- 0:00:36
      407500 -- (-635.696) [-631.963] (-630.350) (-631.263) * [-629.303] (-633.423) (-630.663) (-632.499) -- 0:00:36
      408000 -- (-633.296) (-628.888) [-629.683] (-630.600) * (-631.057) [-631.186] (-631.308) (-635.981) -- 0:00:36
      408500 -- (-630.994) [-629.627] (-628.804) (-632.078) * (-629.852) [-633.199] (-631.664) (-632.003) -- 0:00:36
      409000 -- (-630.800) (-631.248) [-629.086] (-629.229) * (-630.273) (-630.400) [-629.696] (-630.146) -- 0:00:36
      409500 -- (-630.830) (-634.720) (-631.226) [-629.228] * (-632.722) [-629.544] (-629.360) (-631.863) -- 0:00:36
      410000 -- (-631.224) (-636.937) (-630.946) [-630.013] * (-634.209) (-632.789) (-630.451) [-635.240] -- 0:00:35

      Average standard deviation of split frequencies: 0.007293

      410500 -- (-629.068) [-631.709] (-631.970) (-631.297) * (-632.117) (-634.265) [-629.665] (-632.421) -- 0:00:35
      411000 -- (-629.730) (-634.224) (-632.545) [-632.065] * (-632.125) (-635.016) (-629.497) [-630.866] -- 0:00:35
      411500 -- (-633.117) (-633.851) (-629.840) [-628.883] * (-635.872) (-633.172) (-631.418) [-632.560] -- 0:00:35
      412000 -- [-632.296] (-633.255) (-630.562) (-630.261) * (-634.529) (-633.164) [-630.248] (-628.971) -- 0:00:35
      412500 -- [-629.656] (-629.467) (-634.432) (-630.090) * (-629.140) (-632.498) [-635.226] (-628.992) -- 0:00:35
      413000 -- (-630.343) (-629.642) [-629.836] (-630.277) * (-630.858) (-635.210) (-631.153) [-630.789] -- 0:00:35
      413500 -- (-633.392) (-628.894) [-631.763] (-630.260) * (-632.141) (-631.648) (-634.183) [-629.988] -- 0:00:35
      414000 -- (-632.268) [-629.111] (-636.322) (-630.590) * (-629.913) [-630.270] (-629.723) (-630.180) -- 0:00:35
      414500 -- (-630.504) [-628.880] (-630.719) (-629.407) * [-629.323] (-630.858) (-629.683) (-634.279) -- 0:00:35
      415000 -- [-634.625] (-629.234) (-630.359) (-630.822) * (-633.908) [-629.915] (-629.389) (-629.604) -- 0:00:35

      Average standard deviation of split frequencies: 0.007999

      415500 -- (-632.499) (-629.306) [-631.243] (-630.289) * (-630.882) (-629.904) [-634.146] (-629.114) -- 0:00:35
      416000 -- (-632.766) (-630.064) [-633.454] (-634.285) * (-632.085) [-630.676] (-629.647) (-629.353) -- 0:00:35
      416500 -- (-633.265) (-630.143) [-630.338] (-631.865) * [-630.291] (-636.145) (-629.536) (-629.108) -- 0:00:35
      417000 -- (-631.946) (-631.366) [-630.927] (-633.402) * (-631.823) (-635.441) [-630.057] (-632.524) -- 0:00:34
      417500 -- [-629.399] (-631.128) (-632.622) (-629.061) * [-631.647] (-637.943) (-633.049) (-630.123) -- 0:00:34
      418000 -- (-634.179) (-632.070) (-633.790) [-629.792] * (-630.491) [-633.493] (-636.599) (-629.526) -- 0:00:34
      418500 -- (-631.771) (-633.147) [-633.822] (-629.938) * (-628.950) (-633.438) (-629.940) [-630.707] -- 0:00:34
      419000 -- [-630.946] (-632.959) (-633.074) (-629.756) * [-630.936] (-631.388) (-632.267) (-630.222) -- 0:00:34
      419500 -- (-634.185) (-631.307) [-633.300] (-630.289) * (-631.530) [-629.020] (-629.635) (-630.491) -- 0:00:34
      420000 -- (-629.292) (-629.097) [-630.244] (-631.172) * (-633.956) (-629.735) (-631.396) [-631.898] -- 0:00:34

      Average standard deviation of split frequencies: 0.007910

      420500 -- (-629.831) (-631.062) [-629.482] (-631.755) * (-633.284) (-633.416) [-632.392] (-634.046) -- 0:00:34
      421000 -- (-630.587) (-629.510) (-628.720) [-629.241] * [-632.225] (-630.166) (-635.483) (-631.629) -- 0:00:34
      421500 -- (-633.821) (-630.082) (-629.171) [-629.882] * (-632.330) (-631.221) [-635.064] (-628.547) -- 0:00:34
      422000 -- [-630.598] (-630.886) (-631.278) (-630.363) * (-631.520) [-631.349] (-630.950) (-629.441) -- 0:00:34
      422500 -- (-629.336) [-632.297] (-633.550) (-638.436) * (-631.628) (-631.282) (-633.010) [-631.142] -- 0:00:35
      423000 -- (-629.922) (-631.062) (-632.718) [-632.257] * (-630.665) [-629.690] (-635.192) (-631.466) -- 0:00:35
      423500 -- (-630.246) (-630.501) (-632.157) [-629.912] * (-629.934) [-630.039] (-631.988) (-630.560) -- 0:00:35
      424000 -- (-629.289) [-630.682] (-631.004) (-630.860) * (-629.550) (-629.593) [-630.974] (-630.168) -- 0:00:35
      424500 -- (-631.060) (-631.271) [-630.526] (-630.238) * (-629.993) [-629.688] (-630.379) (-631.747) -- 0:00:35
      425000 -- (-630.772) (-630.855) [-629.504] (-629.971) * (-632.486) (-631.760) (-632.365) [-630.747] -- 0:00:35

      Average standard deviation of split frequencies: 0.008722

      425500 -- (-632.906) [-629.612] (-630.494) (-629.097) * (-632.595) (-630.531) [-628.600] (-634.359) -- 0:00:35
      426000 -- (-631.635) (-629.718) (-632.840) [-629.097] * [-631.081] (-631.024) (-628.491) (-629.238) -- 0:00:35
      426500 -- (-630.415) (-630.822) [-629.313] (-630.528) * (-629.991) [-630.763] (-628.905) (-631.518) -- 0:00:34
      427000 -- (-630.548) (-632.147) (-629.518) [-631.679] * (-632.163) [-629.269] (-631.398) (-630.053) -- 0:00:34
      427500 -- (-630.960) (-629.858) (-629.901) [-630.536] * (-631.237) (-631.492) (-629.663) [-630.612] -- 0:00:34
      428000 -- [-633.538] (-633.815) (-630.653) (-630.404) * [-632.273] (-629.962) (-630.832) (-631.399) -- 0:00:34
      428500 -- (-629.151) [-628.956] (-630.900) (-638.415) * [-631.807] (-631.473) (-628.592) (-630.856) -- 0:00:34
      429000 -- (-630.933) (-633.793) [-633.344] (-633.731) * (-635.298) [-630.926] (-628.592) (-632.135) -- 0:00:34
      429500 -- (-629.360) (-632.579) [-632.480] (-634.065) * [-631.976] (-630.082) (-629.824) (-633.166) -- 0:00:34
      430000 -- (-634.961) (-632.332) (-631.381) [-633.150] * (-632.018) (-632.530) (-634.295) [-630.161] -- 0:00:34

      Average standard deviation of split frequencies: 0.008821

      430500 -- [-632.067] (-635.769) (-631.443) (-631.954) * [-630.130] (-634.508) (-636.025) (-632.537) -- 0:00:34
      431000 -- (-631.747) (-631.390) [-629.414] (-632.248) * (-631.476) (-631.479) (-633.222) [-632.038] -- 0:00:34
      431500 -- (-631.434) [-629.401] (-631.341) (-630.062) * (-630.908) (-630.434) [-631.756] (-631.059) -- 0:00:34
      432000 -- [-631.340] (-630.772) (-636.410) (-632.744) * (-630.346) (-628.724) [-629.429] (-631.326) -- 0:00:34
      432500 -- [-630.904] (-632.937) (-633.006) (-629.964) * [-630.140] (-629.894) (-631.962) (-635.442) -- 0:00:34
      433000 -- (-631.305) (-629.892) (-630.141) [-629.667] * (-629.408) [-631.216] (-632.022) (-634.352) -- 0:00:34
      433500 -- [-630.796] (-630.621) (-632.892) (-630.322) * [-633.922] (-630.894) (-632.495) (-631.531) -- 0:00:33
      434000 -- [-630.304] (-632.854) (-634.211) (-631.149) * (-638.323) (-632.611) [-630.311] (-631.393) -- 0:00:33
      434500 -- (-630.485) (-629.919) (-632.254) [-632.459] * (-632.904) [-633.714] (-628.832) (-632.506) -- 0:00:33
      435000 -- [-630.234] (-631.029) (-631.060) (-630.613) * [-630.110] (-629.077) (-630.216) (-629.968) -- 0:00:33

      Average standard deviation of split frequencies: 0.008586

      435500 -- (-630.326) (-632.400) [-629.741] (-630.600) * (-629.040) (-630.338) (-630.025) [-631.360] -- 0:00:33
      436000 -- (-631.765) (-630.151) [-633.111] (-632.112) * (-631.066) (-633.348) (-629.978) [-630.932] -- 0:00:33
      436500 -- (-631.661) (-630.830) (-629.144) [-633.295] * (-630.430) [-631.060] (-633.823) (-635.476) -- 0:00:33
      437000 -- [-633.864] (-629.298) (-633.183) (-629.637) * [-632.350] (-633.420) (-631.975) (-633.420) -- 0:00:33
      437500 -- (-630.419) [-631.053] (-629.591) (-630.711) * [-630.447] (-632.545) (-631.263) (-631.763) -- 0:00:33
      438000 -- [-630.471] (-631.858) (-629.594) (-630.679) * (-631.113) (-630.288) [-630.248] (-634.099) -- 0:00:33
      438500 -- [-628.756] (-633.261) (-631.467) (-631.009) * (-629.318) (-630.799) (-634.077) [-632.418] -- 0:00:33
      439000 -- (-629.046) (-632.691) [-629.889] (-630.284) * (-629.490) (-632.109) (-633.924) [-630.652] -- 0:00:33
      439500 -- [-631.261] (-634.244) (-628.837) (-631.404) * (-629.618) (-630.408) [-635.124] (-630.544) -- 0:00:34
      440000 -- (-629.690) (-629.987) (-629.562) [-628.756] * (-628.949) [-632.343] (-630.628) (-629.913) -- 0:00:34

      Average standard deviation of split frequencies: 0.008369

      440500 -- [-631.619] (-630.978) (-628.454) (-632.769) * [-628.762] (-630.341) (-630.011) (-630.266) -- 0:00:34
      441000 -- [-630.410] (-629.237) (-632.109) (-631.836) * [-630.425] (-633.214) (-630.469) (-632.326) -- 0:00:34
      441500 -- (-629.907) (-639.512) (-630.592) [-630.008] * (-631.587) [-630.730] (-630.338) (-635.638) -- 0:00:34
      442000 -- (-630.718) (-637.889) (-629.023) [-631.983] * (-632.095) [-632.125] (-637.339) (-630.055) -- 0:00:34
      442500 -- (-630.145) (-630.939) (-634.221) [-633.478] * [-633.084] (-631.426) (-629.534) (-631.844) -- 0:00:34
      443000 -- [-629.416] (-629.819) (-636.349) (-633.033) * (-632.277) (-628.736) [-630.125] (-632.050) -- 0:00:33
      443500 -- (-632.715) [-629.686] (-629.473) (-631.621) * [-629.750] (-630.932) (-630.980) (-629.441) -- 0:00:33
      444000 -- (-635.681) (-629.058) [-629.194] (-631.508) * (-628.899) (-629.228) [-631.324] (-629.683) -- 0:00:33
      444500 -- (-631.807) (-628.713) (-630.941) [-630.752] * (-630.331) (-631.267) [-629.469] (-633.550) -- 0:00:33
      445000 -- [-631.182] (-633.482) (-633.119) (-630.428) * (-630.714) (-628.949) (-634.360) [-629.586] -- 0:00:33

      Average standard deviation of split frequencies: 0.008749

      445500 -- (-631.056) [-631.407] (-632.679) (-633.079) * (-630.292) (-629.788) (-629.606) [-632.739] -- 0:00:33
      446000 -- [-630.533] (-632.296) (-630.593) (-634.511) * (-630.378) (-630.155) [-630.811] (-630.726) -- 0:00:33
      446500 -- [-629.514] (-632.091) (-629.136) (-633.971) * (-630.005) [-634.804] (-630.233) (-630.854) -- 0:00:33
      447000 -- (-630.603) [-630.070] (-632.226) (-629.571) * [-629.259] (-631.803) (-630.806) (-630.123) -- 0:00:33
      447500 -- (-634.104) (-629.371) (-631.493) [-631.525] * (-629.460) (-633.846) (-629.823) [-629.459] -- 0:00:33
      448000 -- [-629.617] (-629.934) (-629.848) (-632.707) * (-631.952) (-634.001) [-630.002] (-631.453) -- 0:00:33
      448500 -- (-632.755) [-628.960] (-629.228) (-630.064) * [-629.182] (-630.013) (-629.727) (-634.030) -- 0:00:33
      449000 -- (-629.568) (-632.668) [-629.789] (-632.424) * [-629.114] (-634.599) (-630.094) (-629.524) -- 0:00:33
      449500 -- [-630.255] (-630.538) (-630.082) (-630.570) * (-628.923) (-637.148) (-630.501) [-633.449] -- 0:00:33
      450000 -- (-631.193) [-628.928] (-629.559) (-630.934) * (-631.184) (-630.732) (-630.639) [-631.225] -- 0:00:33

      Average standard deviation of split frequencies: 0.008891

      450500 -- [-630.606] (-630.207) (-631.093) (-634.118) * (-631.261) (-628.609) [-631.608] (-633.546) -- 0:00:32
      451000 -- [-629.024] (-630.471) (-632.101) (-630.692) * [-634.831] (-628.615) (-629.090) (-629.936) -- 0:00:32
      451500 -- [-637.310] (-629.945) (-634.884) (-629.825) * [-631.641] (-628.470) (-633.053) (-629.922) -- 0:00:32
      452000 -- (-630.812) [-632.919] (-634.971) (-631.026) * (-630.825) [-628.582] (-634.062) (-629.055) -- 0:00:32
      452500 -- [-632.285] (-630.944) (-631.371) (-632.270) * (-632.632) (-631.786) (-633.509) [-630.093] -- 0:00:32
      453000 -- (-629.951) [-629.177] (-633.442) (-629.381) * (-632.045) [-631.992] (-634.701) (-630.264) -- 0:00:32
      453500 -- [-630.509] (-629.006) (-629.438) (-631.565) * (-630.361) [-629.184] (-630.838) (-629.345) -- 0:00:32
      454000 -- (-630.497) [-629.956] (-630.865) (-631.032) * (-634.063) (-629.070) (-629.911) [-629.217] -- 0:00:32
      454500 -- [-630.052] (-630.720) (-632.967) (-628.941) * (-634.303) (-629.256) (-630.818) [-631.092] -- 0:00:32
      455000 -- [-630.434] (-630.503) (-634.570) (-632.109) * (-628.945) [-629.229] (-630.193) (-634.597) -- 0:00:32

      Average standard deviation of split frequencies: 0.008959

      455500 -- (-634.328) (-628.798) [-633.747] (-633.477) * (-631.498) [-629.435] (-629.968) (-630.334) -- 0:00:32
      456000 -- (-630.410) [-628.941] (-633.139) (-631.472) * (-631.035) [-629.000] (-630.611) (-630.880) -- 0:00:32
      456500 -- [-629.753] (-630.404) (-635.434) (-631.473) * (-629.327) [-632.529] (-629.341) (-630.760) -- 0:00:33
      457000 -- (-630.005) [-628.700] (-631.891) (-630.479) * [-629.987] (-628.933) (-635.419) (-631.193) -- 0:00:33
      457500 -- (-630.981) (-632.033) [-630.600] (-629.805) * (-629.085) (-629.313) [-632.357] (-634.155) -- 0:00:33
      458000 -- (-631.951) (-628.775) [-629.285] (-631.870) * (-629.902) (-633.444) (-629.675) [-631.387] -- 0:00:33
      458500 -- (-629.851) (-630.102) [-629.359] (-631.261) * (-636.920) [-633.534] (-628.987) (-631.575) -- 0:00:33
      459000 -- (-630.082) (-630.256) [-629.398] (-640.221) * (-637.383) (-631.736) (-630.200) [-631.175] -- 0:00:33
      459500 -- [-629.341] (-634.120) (-630.307) (-633.381) * (-629.675) (-629.434) (-631.480) [-630.977] -- 0:00:32
      460000 -- [-632.470] (-629.750) (-634.458) (-631.779) * (-629.510) [-629.741] (-638.671) (-631.595) -- 0:00:32

      Average standard deviation of split frequencies: 0.009029

      460500 -- [-629.384] (-630.102) (-629.584) (-631.828) * (-631.887) (-628.995) (-629.855) [-632.441] -- 0:00:32
      461000 -- (-629.353) [-631.349] (-631.623) (-639.817) * (-631.909) (-629.512) (-629.771) [-633.472] -- 0:00:32
      461500 -- (-631.719) [-629.353] (-631.108) (-636.162) * [-632.196] (-631.194) (-632.284) (-630.334) -- 0:00:32
      462000 -- (-632.583) [-629.957] (-629.851) (-635.724) * (-633.060) (-629.001) [-630.357] (-630.258) -- 0:00:32
      462500 -- (-630.070) [-629.591] (-629.017) (-634.573) * [-632.389] (-630.190) (-631.851) (-629.692) -- 0:00:32
      463000 -- [-631.982] (-629.731) (-629.536) (-632.316) * (-630.168) (-633.014) [-630.320] (-629.344) -- 0:00:32
      463500 -- (-630.847) [-628.968] (-629.288) (-631.287) * (-631.377) (-631.507) (-630.955) [-631.185] -- 0:00:32
      464000 -- [-633.485] (-629.734) (-630.614) (-629.573) * [-629.478] (-631.945) (-632.021) (-631.126) -- 0:00:32
      464500 -- [-630.347] (-632.828) (-630.827) (-631.336) * (-629.749) (-630.775) (-632.306) [-631.828] -- 0:00:32
      465000 -- [-631.682] (-631.497) (-629.801) (-631.937) * (-631.145) [-630.998] (-630.321) (-632.980) -- 0:00:32

      Average standard deviation of split frequencies: 0.009385

      465500 -- (-632.521) (-634.666) (-632.279) [-632.363] * (-630.093) (-632.283) [-630.563] (-633.734) -- 0:00:32
      466000 -- (-630.524) (-630.547) [-632.042] (-634.309) * (-632.457) (-629.023) (-631.056) [-633.395] -- 0:00:32
      466500 -- [-629.457] (-632.082) (-629.495) (-630.137) * (-631.616) (-630.711) (-631.413) [-630.220] -- 0:00:32
      467000 -- (-630.460) [-630.095] (-630.920) (-631.400) * [-628.945] (-631.717) (-631.122) (-633.251) -- 0:00:31
      467500 -- [-633.460] (-630.814) (-631.710) (-629.673) * (-630.064) (-630.552) [-630.586] (-631.815) -- 0:00:31
      468000 -- (-630.464) (-631.576) [-631.098] (-628.814) * (-632.703) (-629.605) [-630.301] (-632.468) -- 0:00:31
      468500 -- (-629.181) (-635.727) (-630.346) [-629.131] * (-630.352) [-629.405] (-629.805) (-632.608) -- 0:00:31
      469000 -- (-631.245) [-633.058] (-630.211) (-628.864) * [-628.920] (-629.070) (-630.061) (-633.702) -- 0:00:31
      469500 -- (-630.021) (-630.031) (-631.342) [-628.874] * (-632.032) (-629.629) [-628.850] (-632.343) -- 0:00:31
      470000 -- (-629.167) (-631.240) (-633.188) [-629.640] * [-631.747] (-631.575) (-630.245) (-632.356) -- 0:00:31

      Average standard deviation of split frequencies: 0.009191

      470500 -- (-629.548) [-630.678] (-632.381) (-629.812) * (-631.142) (-632.535) [-630.203] (-635.767) -- 0:00:31
      471000 -- (-630.140) (-630.160) (-631.313) [-630.042] * (-632.801) (-632.860) (-630.211) [-629.940] -- 0:00:31
      471500 -- (-629.569) (-630.025) (-630.780) [-628.719] * (-632.538) [-632.303] (-630.839) (-632.510) -- 0:00:31
      472000 -- (-630.958) [-631.049] (-633.688) (-629.513) * (-633.997) (-629.473) (-633.465) [-629.547] -- 0:00:31
      472500 -- [-630.347] (-634.239) (-630.750) (-630.461) * [-630.806] (-629.113) (-632.067) (-630.044) -- 0:00:31
      473000 -- (-632.865) (-632.379) [-630.899] (-629.386) * [-629.675] (-633.569) (-629.741) (-630.211) -- 0:00:32
      473500 -- (-629.289) [-629.203] (-633.145) (-632.695) * [-630.362] (-629.712) (-632.278) (-633.717) -- 0:00:32
      474000 -- (-630.690) [-629.319] (-632.007) (-632.667) * (-632.699) [-629.251] (-629.645) (-631.428) -- 0:00:32
      474500 -- (-629.851) (-629.153) [-629.152] (-630.782) * (-631.802) (-633.900) (-630.008) [-630.799] -- 0:00:32
      475000 -- [-630.701] (-631.052) (-631.340) (-631.278) * [-630.193] (-633.155) (-632.464) (-630.783) -- 0:00:32

      Average standard deviation of split frequencies: 0.009146

      475500 -- (-630.632) [-631.054] (-633.707) (-631.166) * (-630.903) (-632.301) (-630.457) [-630.013] -- 0:00:31
      476000 -- (-629.187) (-629.138) (-633.289) [-629.364] * (-631.600) (-631.069) [-629.378] (-631.080) -- 0:00:31
      476500 -- [-630.085] (-632.675) (-630.404) (-632.165) * (-631.159) (-629.819) [-629.845] (-631.233) -- 0:00:31
      477000 -- (-630.651) (-630.664) (-629.920) [-629.945] * (-630.456) [-632.304] (-629.440) (-634.178) -- 0:00:31
      477500 -- (-632.636) (-629.902) [-629.642] (-633.307) * (-631.747) (-632.651) [-633.210] (-630.053) -- 0:00:31
      478000 -- [-631.411] (-629.720) (-631.283) (-637.937) * (-630.822) [-630.102] (-631.452) (-629.199) -- 0:00:31
      478500 -- [-630.475] (-631.308) (-632.695) (-629.602) * [-630.353] (-632.042) (-630.130) (-630.468) -- 0:00:31
      479000 -- (-629.753) (-628.694) [-629.547] (-630.814) * (-632.658) (-630.065) [-634.593] (-632.155) -- 0:00:31
      479500 -- (-630.749) [-628.874] (-631.271) (-632.829) * (-629.179) [-631.635] (-632.271) (-630.780) -- 0:00:31
      480000 -- [-632.454] (-630.853) (-632.111) (-629.860) * [-629.334] (-629.943) (-631.446) (-632.065) -- 0:00:31

      Average standard deviation of split frequencies: 0.009230

      480500 -- [-630.201] (-629.413) (-630.586) (-630.257) * (-630.222) (-629.667) [-631.863] (-630.700) -- 0:00:31
      481000 -- (-630.125) (-629.578) (-631.107) [-631.169] * (-633.610) [-629.216] (-629.052) (-631.002) -- 0:00:31
      481500 -- [-629.297] (-630.657) (-632.947) (-629.309) * (-635.701) [-631.463] (-629.267) (-631.453) -- 0:00:31
      482000 -- (-629.041) (-631.564) (-633.248) [-632.083] * (-635.100) (-633.397) [-628.809] (-632.622) -- 0:00:31
      482500 -- (-630.724) (-629.951) [-630.824] (-630.987) * (-631.998) [-628.985] (-628.939) (-633.194) -- 0:00:31
      483000 -- (-637.038) (-631.545) [-628.938] (-632.790) * (-631.314) (-629.022) (-628.621) [-630.311] -- 0:00:31
      483500 -- (-633.019) (-630.115) [-630.081] (-631.813) * (-629.795) [-630.192] (-630.829) (-630.444) -- 0:00:30
      484000 -- (-629.158) (-634.488) (-635.676) [-630.330] * (-630.527) (-629.319) [-633.242] (-630.657) -- 0:00:30
      484500 -- (-629.183) (-636.178) (-629.580) [-629.717] * (-630.897) [-631.592] (-630.042) (-629.468) -- 0:00:30
      485000 -- [-629.147] (-630.447) (-631.355) (-630.993) * (-629.528) (-630.594) (-632.734) [-630.776] -- 0:00:30

      Average standard deviation of split frequencies: 0.009357

      485500 -- (-629.612) [-630.528] (-629.636) (-632.726) * [-632.212] (-633.867) (-629.979) (-629.810) -- 0:00:30
      486000 -- (-632.757) [-630.172] (-635.540) (-632.624) * [-631.790] (-631.789) (-631.786) (-633.905) -- 0:00:30
      486500 -- (-634.640) (-631.291) [-629.703] (-629.781) * (-630.037) (-630.359) (-630.514) [-629.555] -- 0:00:30
      487000 -- (-630.786) (-629.226) (-632.961) [-629.641] * (-629.121) [-629.568] (-632.050) (-632.655) -- 0:00:30
      487500 -- [-630.948] (-629.576) (-629.628) (-629.092) * (-629.179) (-633.168) [-630.532] (-632.232) -- 0:00:30
      488000 -- (-630.411) [-629.032] (-629.929) (-628.614) * (-631.505) [-632.627] (-629.203) (-633.485) -- 0:00:30
      488500 -- [-631.514] (-632.204) (-633.906) (-629.084) * (-634.498) [-630.422] (-630.318) (-631.258) -- 0:00:30
      489000 -- (-632.761) (-631.866) [-630.587] (-629.314) * (-629.374) (-631.434) [-630.935] (-628.802) -- 0:00:30
      489500 -- (-631.852) (-633.119) [-631.235] (-631.696) * (-633.465) (-628.727) [-629.496] (-629.874) -- 0:00:30
      490000 -- (-631.753) (-633.329) [-633.894] (-631.840) * (-634.425) (-631.939) (-632.768) [-631.003] -- 0:00:31

      Average standard deviation of split frequencies: 0.009551

      490500 -- [-631.535] (-634.826) (-633.750) (-631.237) * (-630.841) (-635.933) (-633.343) [-629.505] -- 0:00:31
      491000 -- (-629.827) [-629.256] (-631.218) (-631.264) * (-630.894) [-631.024] (-637.512) (-629.526) -- 0:00:31
      491500 -- (-630.081) (-630.215) [-634.144] (-631.846) * (-632.652) (-631.183) [-629.642] (-629.336) -- 0:00:31
      492000 -- (-632.248) [-629.045] (-629.020) (-632.285) * (-635.069) [-632.712] (-629.289) (-632.743) -- 0:00:30
      492500 -- [-631.033] (-628.751) (-631.388) (-634.040) * (-630.635) (-632.442) [-630.682] (-629.069) -- 0:00:30
      493000 -- (-628.868) [-632.293] (-630.560) (-630.035) * [-628.950] (-630.562) (-630.033) (-630.273) -- 0:00:30
      493500 -- (-631.007) [-631.005] (-629.165) (-631.910) * [-630.824] (-633.467) (-631.875) (-631.963) -- 0:00:30
      494000 -- (-631.337) (-631.400) [-630.702] (-631.132) * [-630.878] (-629.938) (-629.639) (-632.392) -- 0:00:30
      494500 -- [-631.310] (-632.730) (-629.470) (-629.107) * (-631.318) (-629.781) [-630.968] (-632.337) -- 0:00:30
      495000 -- (-630.995) (-632.515) [-630.378] (-631.094) * (-630.270) (-630.128) (-633.122) [-629.240] -- 0:00:30

      Average standard deviation of split frequencies: 0.010734

      495500 -- [-631.545] (-629.596) (-630.347) (-630.608) * (-635.695) (-630.837) [-631.150] (-630.713) -- 0:00:30
      496000 -- (-631.838) (-630.176) [-633.923] (-629.235) * (-630.728) (-633.965) (-630.508) [-630.383] -- 0:00:30
      496500 -- (-632.602) (-630.004) [-630.742] (-632.340) * (-631.012) (-630.810) (-630.509) [-632.069] -- 0:00:30
      497000 -- (-633.416) (-630.445) (-630.204) [-630.289] * (-631.469) (-629.442) (-628.836) [-632.794] -- 0:00:30
      497500 -- (-630.560) (-628.825) (-631.362) [-629.622] * (-632.256) (-632.506) [-628.918] (-630.427) -- 0:00:30
      498000 -- (-630.116) (-628.733) [-630.840] (-629.722) * (-635.935) (-634.147) (-628.829) [-630.553] -- 0:00:30
      498500 -- (-632.524) (-629.454) [-631.744] (-629.731) * (-633.528) [-636.240] (-630.605) (-630.306) -- 0:00:30
      499000 -- (-631.307) (-629.504) [-631.622] (-630.962) * [-632.963] (-636.201) (-633.138) (-630.655) -- 0:00:30
      499500 -- (-632.165) [-630.543] (-629.569) (-633.858) * (-636.255) (-632.718) (-630.921) [-631.491] -- 0:00:30
      500000 -- [-629.405] (-634.027) (-630.268) (-634.618) * (-630.833) (-629.892) (-629.382) [-629.230] -- 0:00:30

      Average standard deviation of split frequencies: 0.009769

      500500 -- (-631.063) [-629.373] (-631.810) (-632.258) * (-631.643) [-629.430] (-629.181) (-630.978) -- 0:00:29
      501000 -- (-628.995) [-629.158] (-628.881) (-632.082) * [-629.221] (-633.372) (-630.693) (-632.501) -- 0:00:29
      501500 -- (-631.411) (-629.566) (-631.359) [-630.023] * [-631.956] (-629.763) (-633.078) (-630.448) -- 0:00:29
      502000 -- (-634.270) (-631.142) (-630.694) [-633.237] * (-629.599) (-629.753) (-630.168) [-631.895] -- 0:00:29
      502500 -- (-629.735) (-630.539) [-630.845] (-634.014) * (-631.673) [-629.682] (-629.723) (-632.288) -- 0:00:29
      503000 -- [-630.021] (-632.657) (-629.441) (-633.439) * [-631.043] (-631.720) (-629.672) (-631.262) -- 0:00:29
      503500 -- (-632.817) (-632.513) (-631.683) [-629.919] * (-629.256) (-632.141) [-633.107] (-634.090) -- 0:00:29
      504000 -- (-634.097) [-629.692] (-632.308) (-632.372) * (-629.489) [-634.078] (-630.862) (-630.461) -- 0:00:29
      504500 -- (-630.168) (-629.143) (-631.356) [-629.564] * (-628.990) (-631.410) (-632.283) [-629.339] -- 0:00:29
      505000 -- (-629.240) [-630.052] (-633.246) (-631.965) * (-629.725) (-630.272) (-629.680) [-630.557] -- 0:00:29

      Average standard deviation of split frequencies: 0.010303

      505500 -- [-630.234] (-630.090) (-628.981) (-629.352) * [-629.101] (-630.096) (-630.570) (-630.675) -- 0:00:29
      506000 -- (-629.392) (-631.081) [-631.654] (-635.627) * (-628.818) [-631.584] (-632.969) (-629.190) -- 0:00:29
      506500 -- [-632.096] (-634.023) (-629.497) (-633.174) * [-630.096] (-631.289) (-635.306) (-630.415) -- 0:00:29
      507000 -- (-631.892) [-628.746] (-629.070) (-632.940) * (-629.266) [-631.367] (-631.273) (-630.770) -- 0:00:30
      507500 -- (-631.833) [-630.779] (-630.604) (-630.698) * (-634.451) [-632.810] (-630.157) (-633.814) -- 0:00:30
      508000 -- [-629.250] (-629.006) (-630.961) (-631.639) * [-633.868] (-630.248) (-634.612) (-630.256) -- 0:00:30
      508500 -- (-631.082) (-632.462) (-629.597) [-631.343] * (-630.988) [-630.267] (-631.210) (-632.529) -- 0:00:29
      509000 -- (-631.553) [-632.717] (-629.422) (-629.092) * (-630.991) [-635.667] (-632.789) (-634.161) -- 0:00:29
      509500 -- (-629.693) (-631.602) (-628.530) [-631.349] * [-632.030] (-635.195) (-632.688) (-630.022) -- 0:00:29
      510000 -- (-631.306) [-632.788] (-631.212) (-633.927) * [-629.342] (-635.330) (-629.412) (-629.923) -- 0:00:29

      Average standard deviation of split frequencies: 0.010317

      510500 -- (-631.264) (-630.486) (-631.594) [-630.631] * (-628.836) [-632.488] (-633.970) (-632.700) -- 0:00:29
      511000 -- (-630.485) (-629.608) (-632.253) [-630.770] * (-631.152) (-632.044) [-631.329] (-630.191) -- 0:00:29
      511500 -- (-629.385) (-630.014) (-630.605) [-631.844] * (-630.293) [-631.574] (-630.529) (-631.645) -- 0:00:29
      512000 -- (-633.419) [-630.232] (-631.004) (-629.663) * [-631.507] (-633.515) (-630.196) (-633.508) -- 0:00:29
      512500 -- (-632.201) [-630.804] (-630.837) (-629.894) * (-631.102) (-630.790) (-639.335) [-631.839] -- 0:00:29
      513000 -- (-633.536) [-631.759] (-635.228) (-631.718) * [-631.247] (-630.990) (-631.027) (-632.821) -- 0:00:29
      513500 -- (-629.808) [-629.898] (-631.534) (-628.683) * (-630.319) (-631.494) (-629.137) [-631.766] -- 0:00:29
      514000 -- (-631.548) [-629.876] (-631.536) (-631.875) * (-629.712) (-629.895) (-630.153) [-629.944] -- 0:00:29
      514500 -- (-633.951) [-631.915] (-631.236) (-628.526) * [-631.031] (-633.799) (-632.127) (-632.644) -- 0:00:29
      515000 -- (-635.138) [-630.157] (-631.522) (-629.338) * [-632.157] (-630.792) (-629.973) (-630.552) -- 0:00:29

      Average standard deviation of split frequencies: 0.010802

      515500 -- (-631.849) [-633.743] (-629.001) (-632.179) * (-630.392) (-629.248) [-629.987] (-634.329) -- 0:00:29
      516000 -- (-629.843) (-628.937) [-629.810] (-629.322) * [-630.641] (-631.686) (-632.475) (-629.759) -- 0:00:29
      516500 -- [-628.694] (-628.973) (-630.540) (-629.970) * (-634.162) (-630.033) (-633.156) [-630.097] -- 0:00:29
      517000 -- (-629.954) [-629.116] (-628.633) (-629.992) * (-633.607) (-630.204) (-630.366) [-631.967] -- 0:00:28
      517500 -- (-631.242) (-629.681) [-635.282] (-630.144) * (-634.105) (-631.067) (-630.115) [-631.095] -- 0:00:28
      518000 -- (-629.799) [-629.902] (-629.165) (-629.655) * (-631.663) [-630.244] (-630.201) (-632.115) -- 0:00:28
      518500 -- [-629.744] (-630.259) (-630.083) (-630.484) * [-633.515] (-630.304) (-629.550) (-630.733) -- 0:00:28
      519000 -- (-632.054) (-629.861) [-629.514] (-632.410) * (-631.039) (-631.502) [-629.295] (-631.248) -- 0:00:28
      519500 -- [-630.569] (-631.056) (-629.930) (-631.674) * (-632.437) (-632.536) [-628.759] (-630.174) -- 0:00:28
      520000 -- (-634.251) (-630.663) [-628.762] (-630.019) * [-632.115] (-632.061) (-630.645) (-631.164) -- 0:00:28

      Average standard deviation of split frequencies: 0.010332

      520500 -- [-629.786] (-630.588) (-630.263) (-630.988) * (-632.494) (-631.448) [-630.763] (-631.939) -- 0:00:28
      521000 -- (-637.275) [-630.668] (-630.486) (-630.343) * (-631.367) [-631.819] (-629.933) (-634.053) -- 0:00:28
      521500 -- (-631.990) (-632.092) (-633.993) [-631.025] * (-631.121) [-629.209] (-630.313) (-632.349) -- 0:00:28
      522000 -- (-632.100) (-631.660) (-630.966) [-631.809] * [-630.085] (-629.393) (-630.227) (-630.275) -- 0:00:28
      522500 -- [-634.367] (-635.078) (-631.017) (-629.527) * (-633.162) [-629.697] (-630.035) (-630.098) -- 0:00:28
      523000 -- (-632.302) (-629.611) (-631.063) [-629.631] * (-630.124) (-628.885) [-630.061] (-630.098) -- 0:00:28
      523500 -- [-631.531] (-633.041) (-631.379) (-630.221) * (-630.240) [-628.887] (-632.044) (-632.745) -- 0:00:29
      524000 -- (-631.969) (-631.383) [-630.518] (-629.207) * (-629.788) (-629.040) [-629.531] (-633.536) -- 0:00:29
      524500 -- [-629.992] (-630.104) (-632.152) (-628.805) * (-631.694) (-629.027) (-630.549) [-635.839] -- 0:00:29
      525000 -- [-629.812] (-629.832) (-630.897) (-633.142) * (-632.678) (-633.717) (-631.401) [-629.931] -- 0:00:28

      Average standard deviation of split frequencies: 0.010754

      525500 -- (-630.356) (-628.822) [-629.528] (-630.336) * (-630.758) (-633.427) (-632.644) [-630.112] -- 0:00:28
      526000 -- (-628.706) (-629.501) (-628.889) [-631.093] * (-629.440) [-628.920] (-634.460) (-630.779) -- 0:00:28
      526500 -- (-629.433) (-629.146) (-630.803) [-638.466] * (-631.288) (-630.078) (-635.029) [-629.343] -- 0:00:28
      527000 -- (-631.773) [-630.441] (-631.542) (-633.597) * (-630.865) (-629.733) [-631.269] (-630.448) -- 0:00:28
      527500 -- [-630.647] (-629.568) (-632.899) (-631.065) * (-630.557) (-634.810) [-629.858] (-630.625) -- 0:00:28
      528000 -- (-629.672) (-630.181) (-631.586) [-629.624] * (-632.625) (-632.561) [-630.241] (-629.831) -- 0:00:28
      528500 -- [-629.783] (-629.618) (-629.559) (-637.253) * (-633.555) [-633.770] (-628.853) (-631.875) -- 0:00:28
      529000 -- (-631.579) [-630.273] (-631.811) (-629.535) * [-635.409] (-632.421) (-632.441) (-639.409) -- 0:00:28
      529500 -- (-629.535) [-629.859] (-630.550) (-629.520) * (-630.658) (-632.533) (-629.179) [-632.272] -- 0:00:28
      530000 -- (-630.160) [-628.724] (-629.666) (-629.431) * (-631.303) (-631.371) [-629.058] (-631.553) -- 0:00:28

      Average standard deviation of split frequencies: 0.010817

      530500 -- [-630.558] (-630.523) (-630.693) (-632.427) * (-630.816) [-629.913] (-628.776) (-629.884) -- 0:00:28
      531000 -- (-631.737) (-631.257) [-629.994] (-632.422) * (-631.778) (-629.089) (-629.386) [-631.287] -- 0:00:28
      531500 -- (-632.386) (-631.002) [-630.094] (-629.383) * (-631.412) (-631.333) (-632.681) [-631.833] -- 0:00:28
      532000 -- (-635.637) [-632.324] (-630.577) (-630.012) * (-631.230) (-632.945) (-629.611) [-631.996] -- 0:00:28
      532500 -- (-631.444) [-629.562] (-632.571) (-629.307) * (-630.797) (-632.924) [-629.624] (-631.852) -- 0:00:28
      533000 -- (-629.227) (-631.756) (-632.342) [-630.794] * [-629.640] (-630.260) (-628.870) (-632.931) -- 0:00:28
      533500 -- [-633.568] (-630.095) (-635.992) (-629.699) * (-628.995) [-633.398] (-629.522) (-633.051) -- 0:00:27
      534000 -- (-631.840) (-631.596) [-628.883] (-629.876) * (-629.805) (-633.085) (-629.397) [-632.876] -- 0:00:27
      534500 -- (-634.192) (-633.533) [-630.521] (-629.364) * (-628.598) (-633.560) [-629.195] (-632.835) -- 0:00:27
      535000 -- (-629.850) (-634.291) (-631.562) [-629.218] * (-630.457) (-631.648) (-631.105) [-631.172] -- 0:00:27

      Average standard deviation of split frequencies: 0.010813

      535500 -- (-631.639) [-632.178] (-631.343) (-630.651) * [-631.092] (-631.644) (-631.693) (-631.284) -- 0:00:27
      536000 -- (-631.129) (-632.114) (-630.637) [-630.857] * (-632.389) [-632.326] (-631.024) (-635.046) -- 0:00:27
      536500 -- (-630.281) (-633.367) [-630.038] (-629.383) * [-630.761] (-629.008) (-634.009) (-632.839) -- 0:00:27
      537000 -- (-630.029) (-629.417) (-629.398) [-632.727] * [-630.589] (-636.829) (-630.711) (-630.472) -- 0:00:27
      537500 -- (-630.599) [-630.094] (-632.151) (-630.960) * (-629.747) (-630.486) [-632.040] (-631.986) -- 0:00:27
      538000 -- [-629.771] (-629.905) (-628.681) (-630.585) * [-629.527] (-630.089) (-629.485) (-635.047) -- 0:00:27
      538500 -- (-630.027) (-630.825) [-628.851] (-629.579) * (-633.272) [-629.736] (-632.820) (-629.832) -- 0:00:27
      539000 -- [-630.361] (-631.224) (-629.399) (-635.163) * (-634.480) [-629.734] (-632.584) (-633.467) -- 0:00:27
      539500 -- (-630.582) [-631.683] (-630.468) (-631.373) * (-632.041) [-629.420] (-632.261) (-633.888) -- 0:00:27
      540000 -- [-629.264] (-630.653) (-630.463) (-629.959) * (-630.242) [-631.786] (-629.138) (-629.754) -- 0:00:27

      Average standard deviation of split frequencies: 0.010617

      540500 -- (-629.407) (-632.070) [-628.772] (-628.951) * (-630.997) (-630.619) [-629.441] (-632.494) -- 0:00:28
      541000 -- (-630.685) [-632.134] (-629.729) (-629.752) * (-630.313) (-631.758) (-633.162) [-629.615] -- 0:00:27
      541500 -- (-631.538) [-631.641] (-629.727) (-630.239) * (-629.595) (-632.839) [-630.283] (-629.551) -- 0:00:27
      542000 -- (-633.319) (-632.195) (-630.551) [-630.713] * (-631.166) (-630.191) (-632.718) [-628.496] -- 0:00:27
      542500 -- (-628.834) [-632.701] (-634.988) (-632.119) * (-630.467) (-630.619) (-630.047) [-628.891] -- 0:00:27
      543000 -- (-628.767) [-629.856] (-630.286) (-632.691) * (-632.922) [-628.599] (-631.331) (-629.574) -- 0:00:27
      543500 -- [-629.799] (-630.492) (-630.531) (-631.316) * [-633.658] (-631.860) (-631.878) (-633.380) -- 0:00:27
      544000 -- (-630.854) [-629.643] (-630.269) (-630.228) * (-630.603) [-632.031] (-630.067) (-636.110) -- 0:00:27
      544500 -- (-630.720) (-630.707) [-635.715] (-632.827) * (-629.678) (-630.430) [-630.717] (-633.229) -- 0:00:27
      545000 -- (-630.738) (-631.116) (-641.446) [-630.213] * (-628.911) (-633.029) [-629.703] (-631.003) -- 0:00:27

      Average standard deviation of split frequencies: 0.009954

      545500 -- [-630.620] (-630.837) (-631.156) (-630.405) * (-632.439) [-629.504] (-629.500) (-631.656) -- 0:00:27
      546000 -- (-635.283) (-630.409) (-631.557) [-629.742] * (-632.511) [-630.530] (-631.111) (-631.458) -- 0:00:27
      546500 -- [-629.732] (-631.968) (-632.699) (-629.642) * (-629.828) (-633.201) [-629.196] (-628.728) -- 0:00:27
      547000 -- (-630.591) (-629.856) [-634.720] (-630.986) * (-635.733) (-632.213) (-633.296) [-629.221] -- 0:00:27
      547500 -- (-630.363) (-629.496) (-631.801) [-632.007] * [-630.963] (-629.245) (-631.853) (-630.384) -- 0:00:27
      548000 -- [-632.829] (-630.140) (-630.308) (-631.442) * (-633.404) (-630.182) (-630.545) [-632.269] -- 0:00:27
      548500 -- (-629.668) (-630.561) [-629.801] (-629.587) * (-635.483) (-629.693) (-630.278) [-634.028] -- 0:00:27
      549000 -- (-631.554) [-630.355] (-628.939) (-630.299) * (-630.590) (-629.449) (-632.910) [-633.444] -- 0:00:27
      549500 -- [-630.329] (-629.918) (-630.253) (-629.771) * (-630.360) (-632.719) [-629.122] (-631.605) -- 0:00:27
      550000 -- [-630.851] (-631.192) (-630.023) (-633.995) * (-630.276) [-630.151] (-630.481) (-632.597) -- 0:00:27

      Average standard deviation of split frequencies: 0.009203

      550500 -- (-633.087) [-635.036] (-632.906) (-632.764) * (-631.105) [-631.266] (-634.487) (-632.220) -- 0:00:26
      551000 -- (-633.379) (-630.662) [-631.532] (-631.017) * (-634.148) [-632.210] (-632.688) (-628.583) -- 0:00:26
      551500 -- (-630.595) (-628.742) [-629.179] (-632.014) * (-631.814) [-629.590] (-631.089) (-632.759) -- 0:00:26
      552000 -- [-632.213] (-630.442) (-632.641) (-629.682) * (-633.085) (-632.042) [-628.622] (-632.527) -- 0:00:26
      552500 -- (-629.758) [-629.470] (-629.485) (-630.312) * (-629.248) [-630.814] (-629.906) (-630.866) -- 0:00:26
      553000 -- (-632.020) [-629.309] (-635.014) (-629.489) * [-629.615] (-630.594) (-633.521) (-633.750) -- 0:00:26
      553500 -- (-630.210) (-629.869) [-632.182] (-628.798) * (-632.629) (-630.099) (-629.070) [-630.469] -- 0:00:26
      554000 -- (-631.155) [-630.854] (-631.161) (-630.585) * (-632.922) (-629.802) [-633.052] (-634.355) -- 0:00:26
      554500 -- [-631.564] (-631.051) (-631.414) (-633.484) * (-631.590) (-631.050) [-631.628] (-629.649) -- 0:00:26
      555000 -- (-629.284) [-630.714] (-632.026) (-633.413) * (-632.126) (-632.633) [-631.793] (-631.092) -- 0:00:26

      Average standard deviation of split frequencies: 0.009432

      555500 -- (-632.840) (-631.037) (-629.232) [-630.106] * [-631.295] (-629.923) (-629.547) (-631.269) -- 0:00:26
      556000 -- (-632.632) [-629.236] (-629.203) (-637.839) * [-629.837] (-629.872) (-629.219) (-632.428) -- 0:00:26
      556500 -- [-632.619] (-629.774) (-632.543) (-637.900) * [-628.963] (-628.828) (-633.153) (-636.559) -- 0:00:26
      557000 -- (-629.664) (-631.246) [-630.152] (-633.522) * (-630.133) [-629.835] (-632.724) (-630.506) -- 0:00:26
      557500 -- (-629.274) (-629.379) (-630.609) [-631.236] * (-631.644) (-629.740) [-633.606] (-630.587) -- 0:00:26
      558000 -- [-629.289] (-630.302) (-631.030) (-636.599) * (-629.610) (-629.500) (-631.726) [-632.969] -- 0:00:26
      558500 -- (-630.468) [-630.042] (-631.466) (-632.467) * [-630.692] (-629.955) (-632.011) (-632.440) -- 0:00:26
      559000 -- (-629.794) (-629.867) (-631.736) [-631.066] * [-630.265] (-630.152) (-629.996) (-632.313) -- 0:00:26
      559500 -- [-631.011] (-631.493) (-629.997) (-631.379) * (-630.676) [-634.687] (-630.695) (-629.635) -- 0:00:26
      560000 -- (-636.828) [-630.478] (-629.931) (-630.985) * (-632.290) (-628.673) (-633.356) [-629.742] -- 0:00:26

      Average standard deviation of split frequencies: 0.008632

      560500 -- [-633.985] (-630.827) (-629.700) (-628.720) * [-631.305] (-629.351) (-629.608) (-637.130) -- 0:00:26
      561000 -- (-632.943) [-629.132] (-629.504) (-628.781) * (-631.506) (-631.328) [-630.754] (-629.124) -- 0:00:26
      561500 -- (-631.695) (-628.761) (-630.317) [-629.320] * (-630.873) [-630.483] (-631.254) (-629.079) -- 0:00:26
      562000 -- (-629.732) [-629.829] (-629.341) (-630.996) * (-631.238) [-629.300] (-632.071) (-631.899) -- 0:00:26
      562500 -- (-632.141) (-634.671) (-631.179) [-629.547] * (-630.681) (-631.695) [-630.721] (-630.655) -- 0:00:26
      563000 -- (-631.394) (-632.017) (-630.460) [-629.884] * (-630.055) (-631.904) [-629.823] (-631.391) -- 0:00:26
      563500 -- (-634.788) (-630.022) [-632.382] (-634.041) * (-631.149) (-631.222) (-628.843) [-632.629] -- 0:00:26
      564000 -- (-631.741) (-632.529) [-630.177] (-631.439) * [-630.186] (-630.423) (-630.157) (-631.156) -- 0:00:26
      564500 -- (-633.402) [-628.998] (-630.046) (-633.535) * [-631.886] (-628.507) (-630.554) (-630.394) -- 0:00:26
      565000 -- (-630.171) (-629.447) (-630.179) [-629.379] * (-630.484) [-629.599] (-630.035) (-631.431) -- 0:00:26

      Average standard deviation of split frequencies: 0.009110

      565500 -- (-630.984) [-633.538] (-630.086) (-633.183) * (-631.319) (-632.699) (-628.961) [-629.133] -- 0:00:26
      566000 -- (-635.903) (-632.443) [-632.661] (-630.142) * (-639.478) (-629.786) (-629.356) [-633.548] -- 0:00:26
      566500 -- [-631.043] (-633.331) (-635.511) (-630.653) * (-629.998) (-633.197) [-631.083] (-634.102) -- 0:00:26
      567000 -- (-632.690) (-632.710) (-632.877) [-631.212] * (-629.818) (-634.366) [-632.054] (-631.075) -- 0:00:25
      567500 -- (-630.544) (-629.778) [-629.839] (-631.706) * [-632.191] (-634.766) (-633.880) (-630.440) -- 0:00:25
      568000 -- [-632.384] (-629.986) (-630.541) (-630.998) * (-630.755) [-629.073] (-632.346) (-632.636) -- 0:00:25
      568500 -- (-635.006) [-630.478] (-631.042) (-630.416) * [-630.595] (-629.959) (-632.891) (-630.901) -- 0:00:25
      569000 -- (-632.507) (-631.186) [-632.030] (-630.570) * (-632.852) (-631.260) [-630.879] (-629.986) -- 0:00:25
      569500 -- (-631.679) (-631.620) [-629.699] (-631.344) * (-632.737) (-628.916) (-630.488) [-631.549] -- 0:00:25
      570000 -- (-632.574) (-633.066) [-633.455] (-630.450) * [-632.703] (-628.962) (-630.018) (-631.022) -- 0:00:25

      Average standard deviation of split frequencies: 0.008570

      570500 -- (-630.765) [-633.122] (-630.709) (-630.999) * (-630.598) [-632.111] (-637.856) (-632.040) -- 0:00:25
      571000 -- (-629.395) [-633.508] (-632.020) (-629.918) * (-630.465) (-633.229) [-629.946] (-631.980) -- 0:00:25
      571500 -- (-630.272) [-634.030] (-632.936) (-631.556) * (-629.382) (-633.397) (-632.579) [-633.298] -- 0:00:25
      572000 -- (-632.132) (-632.981) (-630.351) [-632.739] * [-629.083] (-631.886) (-633.487) (-634.976) -- 0:00:25
      572500 -- [-630.104] (-631.181) (-630.677) (-632.355) * [-629.456] (-634.323) (-629.443) (-632.689) -- 0:00:25
      573000 -- (-630.067) (-631.291) (-630.043) [-628.999] * [-629.409] (-630.651) (-630.065) (-629.603) -- 0:00:25
      573500 -- (-630.809) (-636.528) (-631.062) [-629.206] * (-631.947) (-629.303) [-630.302] (-630.906) -- 0:00:25
      574000 -- (-637.303) (-632.442) (-630.821) [-630.307] * [-633.556] (-631.298) (-630.446) (-630.511) -- 0:00:25
      574500 -- (-629.464) [-631.078] (-630.974) (-629.475) * (-633.163) (-630.148) (-629.950) [-629.703] -- 0:00:25
      575000 -- (-631.844) [-631.346] (-634.591) (-630.491) * (-630.220) (-630.705) (-629.141) [-630.678] -- 0:00:25

      Average standard deviation of split frequencies: 0.008082

      575500 -- [-631.861] (-629.028) (-631.393) (-631.610) * (-629.085) [-629.152] (-633.384) (-631.218) -- 0:00:25
      576000 -- (-630.487) (-629.773) [-632.288] (-629.430) * [-629.619] (-631.599) (-631.960) (-630.190) -- 0:00:25
      576500 -- (-631.365) (-629.655) (-629.975) [-631.246] * (-630.436) (-633.293) (-629.087) [-628.996] -- 0:00:25
      577000 -- [-633.806] (-631.312) (-630.290) (-629.222) * (-630.190) (-631.542) [-633.301] (-629.230) -- 0:00:25
      577500 -- (-633.952) [-629.762] (-628.458) (-629.195) * [-630.435] (-634.408) (-631.927) (-631.115) -- 0:00:25
      578000 -- [-635.600] (-630.725) (-633.117) (-630.369) * (-634.153) [-631.575] (-631.480) (-631.005) -- 0:00:25
      578500 -- (-634.053) (-631.692) (-632.985) [-631.963] * [-631.698] (-629.934) (-635.363) (-631.341) -- 0:00:25
      579000 -- (-632.777) (-629.212) [-633.942] (-633.827) * (-632.714) [-628.806] (-632.021) (-631.837) -- 0:00:25
      579500 -- [-629.161] (-629.506) (-631.959) (-630.109) * (-629.542) (-634.662) (-631.070) [-632.373] -- 0:00:25
      580000 -- [-630.932] (-633.062) (-631.621) (-629.498) * (-632.244) [-629.430] (-630.087) (-629.618) -- 0:00:25

      Average standard deviation of split frequencies: 0.007361

      580500 -- (-631.014) [-633.075] (-631.706) (-630.591) * (-629.699) (-635.747) [-632.666] (-633.760) -- 0:00:25
      581000 -- (-631.513) (-629.887) [-633.123] (-631.472) * (-629.065) (-631.349) (-631.039) [-630.310] -- 0:00:25
      581500 -- (-631.650) (-630.570) (-630.535) [-633.414] * (-629.811) [-629.544] (-631.682) (-632.438) -- 0:00:25
      582000 -- [-631.333] (-631.339) (-629.932) (-632.646) * (-629.334) (-630.471) (-631.776) [-629.764] -- 0:00:25
      582500 -- (-632.695) (-629.506) (-633.161) [-631.325] * [-629.333] (-631.968) (-630.613) (-629.139) -- 0:00:25
      583000 -- (-631.235) (-630.905) [-632.916] (-631.308) * (-628.808) (-631.141) (-630.487) [-629.570] -- 0:00:25
      583500 -- (-630.042) (-632.324) [-630.022] (-631.537) * (-632.376) [-629.886] (-631.276) (-630.919) -- 0:00:24
      584000 -- [-629.171] (-630.401) (-629.235) (-629.630) * (-632.582) (-632.427) (-628.970) [-630.066] -- 0:00:24
      584500 -- [-632.036] (-632.586) (-630.662) (-631.294) * (-630.795) (-635.217) (-630.490) [-631.074] -- 0:00:24
      585000 -- (-631.751) (-632.085) [-630.669] (-629.197) * (-629.391) (-632.118) (-631.336) [-630.132] -- 0:00:24

      Average standard deviation of split frequencies: 0.007133

      585500 -- (-630.948) (-634.792) [-630.685] (-630.923) * (-630.790) (-631.338) [-629.506] (-637.602) -- 0:00:24
      586000 -- (-629.534) (-630.342) [-629.995] (-629.124) * (-631.629) (-631.905) (-631.865) [-631.946] -- 0:00:24
      586500 -- (-630.661) (-632.014) (-629.714) [-628.907] * (-629.653) [-631.650] (-633.106) (-634.346) -- 0:00:24
      587000 -- (-631.080) (-630.137) [-629.417] (-628.908) * [-629.481] (-628.905) (-632.546) (-631.527) -- 0:00:24
      587500 -- (-632.559) (-631.993) [-630.237] (-631.120) * (-630.289) [-630.001] (-631.554) (-631.392) -- 0:00:24
      588000 -- [-629.640] (-630.101) (-630.218) (-632.272) * (-630.795) [-632.122] (-629.999) (-633.264) -- 0:00:24
      588500 -- (-629.546) [-630.236] (-630.850) (-629.575) * (-633.138) [-629.882] (-630.435) (-632.776) -- 0:00:24
      589000 -- (-630.040) [-630.889] (-630.728) (-629.575) * (-629.902) (-629.251) (-630.317) [-630.474] -- 0:00:24
      589500 -- (-630.209) [-630.290] (-631.332) (-630.493) * [-632.053] (-629.043) (-629.816) (-629.985) -- 0:00:24
      590000 -- (-630.612) [-629.090] (-631.361) (-631.329) * (-633.928) [-628.777] (-630.896) (-638.695) -- 0:00:24

      Average standard deviation of split frequencies: 0.007396

      590500 -- (-630.797) [-635.256] (-633.439) (-631.711) * [-630.870] (-629.863) (-631.222) (-632.639) -- 0:00:24
      591000 -- [-630.406] (-633.642) (-635.101) (-633.004) * (-635.456) [-630.089] (-632.911) (-630.386) -- 0:00:24
      591500 -- (-630.746) (-638.429) [-630.909] (-629.477) * (-630.558) [-630.069] (-632.613) (-630.651) -- 0:00:24
      592000 -- (-631.829) (-631.796) (-631.159) [-629.317] * (-630.585) [-630.285] (-634.499) (-631.573) -- 0:00:24
      592500 -- (-630.123) [-632.512] (-629.239) (-629.715) * (-630.912) (-629.082) [-629.715] (-630.834) -- 0:00:24
      593000 -- (-631.048) [-634.182] (-630.101) (-630.290) * (-629.009) (-628.785) [-628.694] (-630.197) -- 0:00:24
      593500 -- [-635.005] (-629.523) (-629.846) (-633.292) * [-630.612] (-631.272) (-630.283) (-632.950) -- 0:00:24
      594000 -- (-631.609) [-630.001] (-630.326) (-633.060) * (-631.970) (-630.746) (-631.385) [-630.022] -- 0:00:24
      594500 -- (-631.270) (-632.995) [-629.495] (-630.660) * (-630.376) (-631.883) [-631.537] (-629.085) -- 0:00:24
      595000 -- (-631.141) (-631.535) [-633.771] (-629.725) * (-630.875) [-630.805] (-629.390) (-631.696) -- 0:00:24

      Average standard deviation of split frequencies: 0.006591

      595500 -- [-630.065] (-628.914) (-630.739) (-630.230) * (-630.382) (-629.858) (-633.931) [-632.977] -- 0:00:24
      596000 -- (-634.931) (-629.102) [-630.124] (-629.338) * [-629.307] (-631.250) (-631.442) (-634.982) -- 0:00:24
      596500 -- (-632.147) (-631.884) (-631.336) [-632.116] * [-631.694] (-630.866) (-630.088) (-631.350) -- 0:00:24
      597000 -- (-634.018) [-631.640] (-633.629) (-631.194) * (-631.059) [-629.091] (-631.902) (-629.433) -- 0:00:24
      597500 -- (-631.955) [-630.729] (-629.188) (-633.445) * (-631.639) [-629.080] (-634.631) (-630.605) -- 0:00:24
      598000 -- [-629.840] (-630.037) (-630.841) (-632.265) * [-631.347] (-630.052) (-629.677) (-631.838) -- 0:00:24
      598500 -- (-633.514) [-631.296] (-631.698) (-630.977) * (-629.972) (-629.977) (-635.216) [-630.002] -- 0:00:24
      599000 -- (-633.408) (-632.193) (-630.488) [-629.374] * [-630.290] (-630.166) (-634.801) (-629.717) -- 0:00:24
      599500 -- (-629.346) (-629.383) (-632.038) [-629.385] * (-632.491) (-633.962) (-630.562) [-630.122] -- 0:00:24
      600000 -- [-631.207] (-631.411) (-631.478) (-629.939) * (-632.315) (-630.038) (-629.765) [-629.795] -- 0:00:24

      Average standard deviation of split frequencies: 0.007482

      600500 -- (-629.376) (-632.373) [-631.710] (-631.046) * (-632.496) [-629.597] (-635.043) (-634.657) -- 0:00:23
      601000 -- (-629.796) (-631.045) (-629.335) [-630.420] * (-629.606) [-629.810] (-629.899) (-636.918) -- 0:00:23
      601500 -- (-632.741) (-634.379) [-629.254] (-630.091) * (-630.538) (-629.239) (-635.911) [-630.644] -- 0:00:23
      602000 -- (-632.136) [-630.980] (-629.762) (-631.828) * (-632.605) (-631.253) (-633.251) [-629.794] -- 0:00:23
      602500 -- (-633.884) [-636.757] (-629.866) (-633.655) * (-638.387) (-630.193) (-629.629) [-630.585] -- 0:00:23
      603000 -- (-630.084) (-630.126) [-631.372] (-631.951) * (-631.983) [-630.686] (-629.294) (-636.721) -- 0:00:23
      603500 -- [-631.687] (-630.563) (-637.443) (-629.064) * (-633.505) (-630.194) [-630.652] (-631.795) -- 0:00:23
      604000 -- (-631.730) (-630.645) (-629.159) [-629.070] * [-634.566] (-630.345) (-629.223) (-631.415) -- 0:00:23
      604500 -- (-630.022) (-630.949) (-629.445) [-629.773] * (-631.458) (-629.339) (-632.128) [-629.913] -- 0:00:23
      605000 -- (-632.719) [-631.111] (-629.856) (-629.571) * (-632.704) (-628.802) [-632.780] (-630.788) -- 0:00:23

      Average standard deviation of split frequencies: 0.007053

      605500 -- (-631.902) (-633.196) (-630.009) [-629.473] * [-629.789] (-628.865) (-630.870) (-631.391) -- 0:00:23
      606000 -- (-630.419) [-633.434] (-631.469) (-632.221) * (-629.472) (-629.943) [-631.422] (-628.934) -- 0:00:23
      606500 -- [-631.133] (-633.689) (-629.801) (-629.144) * (-630.491) (-630.768) (-634.473) [-630.677] -- 0:00:23
      607000 -- (-631.208) (-632.413) [-629.369] (-630.398) * [-630.577] (-630.785) (-635.122) (-630.740) -- 0:00:23
      607500 -- [-631.255] (-631.908) (-629.186) (-635.520) * (-629.069) (-629.754) (-630.968) [-629.631] -- 0:00:23
      608000 -- [-631.708] (-631.892) (-630.167) (-631.486) * (-632.162) (-630.341) [-628.954] (-628.954) -- 0:00:23
      608500 -- (-629.332) (-633.043) [-632.742] (-633.068) * (-631.846) (-629.066) (-630.972) [-629.138] -- 0:00:23
      609000 -- (-630.459) (-630.828) [-631.652] (-629.454) * (-631.290) (-635.218) (-630.320) [-630.805] -- 0:00:23
      609500 -- (-638.265) (-629.492) [-630.695] (-629.819) * (-635.893) [-630.715] (-631.050) (-629.207) -- 0:00:23
      610000 -- (-635.169) (-629.412) (-637.839) [-629.913] * [-630.129] (-631.435) (-631.713) (-631.157) -- 0:00:23

      Average standard deviation of split frequencies: 0.006896

      610500 -- (-632.546) (-628.856) (-632.545) [-630.704] * (-630.310) (-632.103) [-629.012] (-630.277) -- 0:00:23
      611000 -- [-631.717] (-631.428) (-631.860) (-632.312) * (-631.323) [-629.810] (-628.583) (-629.978) -- 0:00:23
      611500 -- (-630.703) [-630.200] (-632.573) (-630.950) * (-631.450) (-630.429) [-629.666] (-632.930) -- 0:00:23
      612000 -- (-629.282) (-630.211) (-635.256) [-630.421] * (-632.421) [-629.135] (-629.186) (-631.008) -- 0:00:23
      612500 -- (-632.006) (-631.554) (-629.857) [-634.312] * (-629.120) (-629.530) (-632.011) [-630.580] -- 0:00:23
      613000 -- [-631.794] (-633.716) (-629.605) (-631.730) * (-628.536) (-631.918) [-632.770] (-633.562) -- 0:00:23
      613500 -- (-630.048) (-635.145) [-633.124] (-629.008) * (-629.307) (-630.543) (-632.423) [-634.675] -- 0:00:23
      614000 -- (-635.292) (-629.610) [-633.039] (-628.876) * (-631.223) (-631.516) (-635.469) [-631.559] -- 0:00:23
      614500 -- [-629.997] (-629.626) (-631.822) (-631.191) * (-630.743) (-629.268) [-631.767] (-632.570) -- 0:00:23
      615000 -- (-631.905) (-629.376) (-630.436) [-633.201] * (-632.975) [-629.256] (-631.983) (-631.909) -- 0:00:23

      Average standard deviation of split frequencies: 0.007194

      615500 -- (-629.762) (-631.423) (-629.012) [-630.644] * (-632.960) (-629.034) [-630.743] (-629.176) -- 0:00:23
      616000 -- (-630.981) [-631.247] (-630.101) (-630.771) * (-631.446) (-629.031) [-629.672] (-629.063) -- 0:00:23
      616500 -- [-628.546] (-630.836) (-629.350) (-630.288) * (-630.479) (-631.452) [-630.611] (-629.235) -- 0:00:23
      617000 -- (-629.656) [-629.306] (-633.843) (-631.165) * (-631.004) [-631.149] (-633.879) (-630.593) -- 0:00:22
      617500 -- [-630.402] (-632.313) (-632.262) (-631.008) * (-630.793) (-630.846) (-640.133) [-630.102] -- 0:00:22
      618000 -- (-630.212) [-630.158] (-634.060) (-637.163) * (-632.952) [-629.659] (-630.566) (-633.227) -- 0:00:22
      618500 -- (-634.273) [-630.875] (-631.637) (-637.600) * (-630.785) [-631.414] (-630.846) (-631.294) -- 0:00:22
      619000 -- (-630.748) (-629.670) (-631.857) [-631.761] * (-632.356) (-631.742) [-628.641] (-633.415) -- 0:00:22
      619500 -- (-629.729) [-630.893] (-629.846) (-629.351) * (-633.163) (-631.336) (-632.348) [-630.401] -- 0:00:22
      620000 -- (-630.349) (-630.316) [-629.871] (-630.374) * (-631.087) (-630.091) (-631.069) [-630.448] -- 0:00:22

      Average standard deviation of split frequencies: 0.007190

      620500 -- (-631.071) [-631.815] (-631.163) (-631.063) * (-630.060) [-628.791] (-628.794) (-632.678) -- 0:00:22
      621000 -- [-632.540] (-630.210) (-630.997) (-630.868) * (-629.576) [-628.948] (-629.414) (-632.037) -- 0:00:22
      621500 -- (-632.308) (-628.921) [-631.549] (-630.187) * (-632.470) (-628.868) (-629.129) [-630.710] -- 0:00:22
      622000 -- (-632.415) (-630.978) [-629.226] (-629.628) * (-629.469) (-629.416) [-632.537] (-634.486) -- 0:00:22
      622500 -- (-631.862) (-632.900) (-630.386) [-629.110] * [-629.226] (-632.556) (-632.353) (-632.387) -- 0:00:22
      623000 -- [-629.325] (-632.269) (-630.371) (-629.063) * (-631.334) [-631.981] (-629.772) (-632.600) -- 0:00:22
      623500 -- [-630.932] (-631.070) (-630.308) (-629.514) * (-631.012) (-632.568) [-629.342] (-630.320) -- 0:00:22
      624000 -- (-631.776) (-629.803) [-628.599] (-630.436) * [-631.166] (-631.220) (-631.201) (-630.137) -- 0:00:22
      624500 -- (-633.450) [-629.226] (-629.933) (-631.502) * (-633.112) [-632.163] (-630.086) (-629.543) -- 0:00:22
      625000 -- (-634.355) [-628.898] (-632.641) (-632.329) * (-632.763) (-629.682) [-629.786] (-631.703) -- 0:00:22

      Average standard deviation of split frequencies: 0.007229

      625500 -- (-628.814) (-628.770) (-629.570) [-629.353] * (-630.564) (-632.548) [-630.326] (-628.944) -- 0:00:22
      626000 -- [-630.337] (-632.357) (-633.138) (-633.546) * (-631.428) (-630.228) [-634.310] (-630.734) -- 0:00:22
      626500 -- (-634.004) (-635.231) (-630.867) [-630.050] * (-631.109) (-631.424) (-630.365) [-632.884] -- 0:00:22
      627000 -- (-629.655) (-629.727) [-633.641] (-631.262) * (-630.869) [-629.217] (-630.517) (-630.885) -- 0:00:22
      627500 -- [-631.175] (-632.159) (-631.126) (-630.916) * (-634.285) [-630.625] (-629.314) (-629.641) -- 0:00:22
      628000 -- (-630.043) [-629.423] (-630.675) (-630.998) * (-631.025) (-636.732) [-629.715] (-631.268) -- 0:00:22
      628500 -- (-632.040) [-629.423] (-632.597) (-633.082) * [-631.143] (-630.070) (-633.535) (-636.954) -- 0:00:22
      629000 -- (-634.872) (-639.055) [-629.466] (-635.692) * (-629.687) (-629.542) (-636.837) [-631.336] -- 0:00:22
      629500 -- (-633.398) [-635.382] (-632.746) (-631.701) * [-629.190] (-636.378) (-632.139) (-630.893) -- 0:00:22
      630000 -- (-638.223) (-634.816) [-633.958] (-630.112) * (-629.375) (-629.715) (-629.579) [-630.397] -- 0:00:22

      Average standard deviation of split frequencies: 0.006279

      630500 -- (-636.905) [-630.743] (-630.825) (-630.251) * [-629.885] (-629.696) (-629.058) (-630.481) -- 0:00:22
      631000 -- (-635.037) (-630.732) (-632.635) [-634.015] * [-630.746] (-630.483) (-632.655) (-634.644) -- 0:00:22
      631500 -- (-629.190) (-631.539) [-629.142] (-631.768) * (-629.963) (-633.441) [-631.730] (-629.698) -- 0:00:22
      632000 -- (-632.697) (-631.133) [-629.691] (-629.039) * [-629.881] (-629.765) (-630.799) (-633.311) -- 0:00:22
      632500 -- (-635.140) [-629.470] (-631.235) (-632.236) * (-628.748) (-638.795) [-631.117] (-633.768) -- 0:00:22
      633000 -- [-631.204] (-631.520) (-633.199) (-630.879) * (-630.894) [-630.837] (-630.087) (-631.931) -- 0:00:22
      633500 -- (-630.056) (-632.194) [-630.363] (-631.279) * (-629.647) (-630.663) (-630.829) [-629.499] -- 0:00:21
      634000 -- (-633.320) (-629.158) (-629.990) [-631.022] * (-634.873) (-630.905) (-634.666) [-629.068] -- 0:00:21
      634500 -- [-630.226] (-630.188) (-632.323) (-634.108) * (-630.188) [-633.202] (-631.607) (-629.123) -- 0:00:21
      635000 -- (-630.898) (-631.206) (-633.050) [-630.221] * (-630.082) (-630.938) (-633.857) [-633.739] -- 0:00:21

      Average standard deviation of split frequencies: 0.006078

      635500 -- (-629.081) (-631.736) (-630.767) [-631.176] * (-633.053) (-629.808) (-631.147) [-631.864] -- 0:00:21
      636000 -- (-630.637) [-630.585] (-638.888) (-633.026) * (-629.837) [-629.096] (-630.468) (-630.738) -- 0:00:21
      636500 -- (-630.797) (-632.607) (-629.964) [-630.946] * (-630.183) [-632.649] (-630.893) (-629.576) -- 0:00:21
      637000 -- [-630.588] (-630.681) (-631.925) (-631.406) * (-630.103) (-632.187) [-628.813] (-630.142) -- 0:00:21
      637500 -- (-629.864) (-633.201) (-634.060) [-631.213] * (-630.486) (-631.325) (-631.528) [-630.684] -- 0:00:21
      638000 -- (-630.805) (-630.274) [-633.240] (-630.959) * (-631.361) (-629.762) [-630.793] (-629.226) -- 0:00:21
      638500 -- (-632.426) (-630.979) (-633.982) [-629.278] * [-633.281] (-629.678) (-630.161) (-630.790) -- 0:00:21
      639000 -- [-630.086] (-629.833) (-632.627) (-630.372) * (-630.916) (-631.803) [-633.089] (-630.770) -- 0:00:21
      639500 -- (-633.251) [-631.684] (-632.166) (-629.302) * (-630.931) [-633.996] (-637.904) (-629.840) -- 0:00:21
      640000 -- (-631.949) (-632.669) [-630.676] (-630.902) * [-635.275] (-632.576) (-640.192) (-629.007) -- 0:00:21

      Average standard deviation of split frequencies: 0.005886

      640500 -- (-629.909) (-631.549) [-630.291] (-631.481) * (-633.243) (-632.274) [-631.907] (-629.614) -- 0:00:21
      641000 -- (-629.807) (-632.535) [-630.875] (-629.625) * (-631.878) [-629.623] (-633.394) (-630.786) -- 0:00:21
      641500 -- (-632.235) (-633.658) (-629.454) [-629.831] * (-631.299) [-630.179] (-630.771) (-635.423) -- 0:00:21
      642000 -- (-630.175) [-629.748] (-632.216) (-629.363) * (-628.997) (-631.160) (-629.403) [-631.605] -- 0:00:21
      642500 -- (-633.346) [-630.733] (-631.972) (-632.037) * [-629.923] (-632.793) (-630.722) (-630.078) -- 0:00:21
      643000 -- (-631.998) (-629.365) (-629.645) [-630.534] * (-630.568) (-635.104) (-630.246) [-631.189] -- 0:00:21
      643500 -- (-633.231) [-630.544] (-629.193) (-632.380) * (-630.437) (-631.467) (-631.187) [-631.957] -- 0:00:21
      644000 -- (-629.973) (-630.480) [-629.191] (-632.037) * [-629.054] (-632.670) (-633.881) (-632.160) -- 0:00:21
      644500 -- (-631.095) (-633.752) [-630.326] (-633.363) * (-629.766) (-632.025) [-635.169] (-632.905) -- 0:00:21
      645000 -- (-631.078) (-630.296) (-633.881) [-631.341] * (-630.822) (-631.868) [-630.106] (-630.903) -- 0:00:21

      Average standard deviation of split frequencies: 0.005935

      645500 -- (-633.909) (-634.183) [-633.766] (-632.518) * (-629.690) (-633.070) [-634.433] (-632.539) -- 0:00:21
      646000 -- (-629.944) [-630.372] (-630.253) (-630.199) * (-629.875) (-629.325) (-630.952) [-629.889] -- 0:00:21
      646500 -- (-631.094) (-632.599) (-632.197) [-630.161] * (-633.764) [-631.197] (-632.209) (-631.642) -- 0:00:21
      647000 -- (-629.817) (-632.914) (-631.405) [-631.082] * [-631.511] (-634.013) (-628.883) (-630.815) -- 0:00:21
      647500 -- (-629.270) (-630.617) (-632.422) [-630.293] * (-632.241) [-630.247] (-629.751) (-632.202) -- 0:00:21
      648000 -- [-629.923] (-632.184) (-629.936) (-630.454) * (-631.744) (-628.505) [-629.706] (-633.121) -- 0:00:21
      648500 -- [-632.229] (-630.672) (-630.978) (-630.245) * (-631.117) (-629.242) (-633.084) [-630.516] -- 0:00:21
      649000 -- (-635.535) (-630.593) [-629.701] (-629.237) * (-631.269) (-629.015) [-630.275] (-634.275) -- 0:00:21
      649500 -- [-630.477] (-632.886) (-630.192) (-633.489) * (-632.034) (-630.250) [-629.510] (-632.490) -- 0:00:21
      650000 -- (-630.353) (-632.634) (-631.215) [-634.145] * (-632.005) (-630.183) [-630.474] (-638.830) -- 0:00:21

      Average standard deviation of split frequencies: 0.005603

      650500 -- (-630.834) (-633.272) [-630.007] (-631.124) * (-633.796) (-629.044) (-630.251) [-633.142] -- 0:00:20
      651000 -- (-630.002) (-631.032) [-629.449] (-632.648) * (-631.091) [-629.155] (-628.815) (-633.173) -- 0:00:20
      651500 -- (-629.128) [-632.497] (-629.824) (-630.570) * [-630.598] (-629.006) (-630.505) (-630.382) -- 0:00:20
      652000 -- (-629.568) (-631.326) (-630.313) [-631.145] * (-629.606) (-629.585) [-630.394] (-629.944) -- 0:00:20
      652500 -- [-629.568] (-633.751) (-631.506) (-633.269) * [-629.497] (-631.805) (-633.138) (-630.231) -- 0:00:20
      653000 -- (-628.727) (-633.385) (-631.153) [-633.417] * (-631.935) (-631.152) (-630.008) [-631.112] -- 0:00:20
      653500 -- (-630.350) (-633.103) (-633.418) [-628.956] * [-629.429] (-632.333) (-630.071) (-631.916) -- 0:00:20
      654000 -- [-629.143] (-631.240) (-632.183) (-633.566) * (-628.512) [-630.919] (-633.000) (-632.479) -- 0:00:20
      654500 -- (-632.550) (-631.451) (-631.710) [-632.904] * [-631.120] (-632.943) (-631.821) (-631.750) -- 0:00:20
      655000 -- [-632.847] (-632.658) (-632.525) (-633.686) * (-631.770) (-632.542) (-630.485) [-629.855] -- 0:00:20

      Average standard deviation of split frequencies: 0.005893

      655500 -- (-629.132) (-632.981) [-630.833] (-632.223) * (-631.000) [-631.050] (-631.033) (-630.360) -- 0:00:20
      656000 -- (-629.238) (-631.820) [-629.843] (-630.569) * (-629.466) [-630.061] (-630.624) (-629.543) -- 0:00:20
      656500 -- (-629.012) (-631.811) (-630.185) [-631.818] * (-633.402) (-628.536) [-629.693] (-630.171) -- 0:00:20
      657000 -- (-629.980) (-630.011) (-631.649) [-629.634] * (-631.436) [-628.589] (-633.654) (-629.923) -- 0:00:20
      657500 -- (-629.407) [-630.799] (-634.265) (-629.933) * (-629.965) (-631.013) (-630.157) [-631.168] -- 0:00:20
      658000 -- (-629.451) [-630.459] (-630.631) (-630.116) * [-636.163] (-635.496) (-629.341) (-631.629) -- 0:00:20
      658500 -- (-630.982) (-630.179) (-630.930) [-630.927] * (-631.150) (-631.035) [-636.038] (-629.345) -- 0:00:20
      659000 -- (-630.186) [-630.168] (-632.097) (-630.260) * (-629.956) (-632.989) [-636.821] (-631.199) -- 0:00:20
      659500 -- (-631.941) [-630.507] (-630.981) (-629.346) * (-630.769) (-630.000) [-633.655] (-629.182) -- 0:00:20
      660000 -- (-630.160) [-631.526] (-630.457) (-630.554) * (-630.661) (-630.746) (-631.463) [-631.772] -- 0:00:20

      Average standard deviation of split frequencies: 0.005613

      660500 -- (-628.582) [-632.224] (-630.517) (-633.688) * (-634.633) [-631.999] (-629.287) (-632.521) -- 0:00:20
      661000 -- (-632.750) (-630.481) (-629.930) [-629.953] * [-630.638] (-632.244) (-631.273) (-629.069) -- 0:00:20
      661500 -- (-635.103) (-630.695) [-629.485] (-629.177) * (-631.173) (-632.207) [-631.569] (-629.638) -- 0:00:20
      662000 -- [-632.564] (-630.082) (-632.431) (-631.529) * [-636.030] (-629.602) (-633.405) (-634.903) -- 0:00:20
      662500 -- (-633.276) (-631.422) [-630.058] (-631.508) * (-629.969) (-632.335) (-630.290) [-630.066] -- 0:00:20
      663000 -- (-630.413) (-631.870) [-629.408] (-630.223) * [-629.448] (-630.888) (-629.545) (-631.505) -- 0:00:20
      663500 -- (-632.532) [-633.801] (-630.878) (-635.171) * [-630.424] (-633.609) (-630.911) (-630.956) -- 0:00:20
      664000 -- (-631.593) (-631.262) [-629.740] (-632.658) * (-629.016) (-630.388) [-631.761] (-629.700) -- 0:00:20
      664500 -- (-632.637) (-630.319) (-631.560) [-630.026] * (-631.363) (-633.732) [-629.849] (-629.523) -- 0:00:20
      665000 -- (-634.998) (-629.698) [-633.357] (-633.431) * (-630.257) [-631.088] (-630.505) (-631.661) -- 0:00:20

      Average standard deviation of split frequencies: 0.005521

      665500 -- (-630.963) [-631.452] (-629.497) (-630.805) * [-633.374] (-631.761) (-631.224) (-630.459) -- 0:00:20
      666000 -- (-632.709) [-632.292] (-630.459) (-631.977) * [-630.962] (-628.813) (-631.085) (-629.072) -- 0:00:20
      666500 -- (-630.554) (-630.998) (-629.668) [-629.373] * [-629.359] (-631.233) (-630.271) (-629.690) -- 0:00:20
      667000 -- [-629.315] (-629.470) (-638.913) (-632.151) * (-630.445) [-629.063] (-630.107) (-629.842) -- 0:00:19
      667500 -- (-629.909) [-629.794] (-633.344) (-632.470) * (-632.312) [-629.288] (-631.327) (-630.135) -- 0:00:19
      668000 -- [-632.892] (-629.720) (-633.309) (-631.386) * [-629.955] (-632.455) (-631.158) (-631.058) -- 0:00:19
      668500 -- (-632.618) (-630.338) [-630.803] (-630.400) * (-634.384) [-632.758] (-630.024) (-631.293) -- 0:00:19
      669000 -- (-632.674) (-628.989) [-635.432] (-632.184) * (-634.423) [-629.986] (-634.661) (-631.244) -- 0:00:19
      669500 -- (-630.236) [-629.656] (-633.347) (-630.618) * (-631.816) (-631.403) (-631.569) [-629.638] -- 0:00:19
      670000 -- [-629.929] (-638.291) (-634.975) (-631.166) * [-635.336] (-631.619) (-629.489) (-629.579) -- 0:00:19

      Average standard deviation of split frequencies: 0.005951

      670500 -- (-629.133) (-633.878) (-632.084) [-631.247] * (-630.591) (-629.781) (-630.956) [-629.461] -- 0:00:19
      671000 -- (-630.117) [-632.362] (-630.676) (-631.815) * [-632.847] (-630.545) (-629.873) (-630.202) -- 0:00:19
      671500 -- (-633.488) (-632.059) (-630.781) [-632.005] * (-632.133) (-632.405) [-628.879] (-637.533) -- 0:00:19
      672000 -- (-631.196) (-631.398) (-631.330) [-630.805] * (-630.842) (-634.949) (-629.745) [-631.235] -- 0:00:19
      672500 -- [-630.220] (-634.210) (-633.764) (-631.461) * [-629.713] (-633.626) (-630.207) (-629.524) -- 0:00:19
      673000 -- (-629.787) [-632.306] (-633.422) (-630.199) * (-629.624) (-635.390) (-629.445) [-634.513] -- 0:00:19
      673500 -- (-629.907) [-632.752] (-632.954) (-629.952) * (-631.116) (-631.157) [-629.220] (-638.979) -- 0:00:19
      674000 -- (-630.792) (-632.484) [-632.679] (-630.346) * [-631.107] (-629.623) (-629.146) (-637.022) -- 0:00:19
      674500 -- (-632.514) [-630.233] (-630.217) (-629.403) * [-630.318] (-630.113) (-631.794) (-629.319) -- 0:00:19
      675000 -- (-632.489) (-630.782) (-632.182) [-629.574] * [-629.001] (-629.273) (-631.545) (-630.706) -- 0:00:19

      Average standard deviation of split frequencies: 0.005951

      675500 -- (-633.053) (-630.049) (-631.474) [-630.846] * (-630.344) (-630.144) [-634.133] (-634.441) -- 0:00:19
      676000 -- (-635.019) (-630.171) [-635.713] (-631.969) * (-629.252) (-630.994) (-630.928) [-631.975] -- 0:00:19
      676500 -- [-632.032] (-630.906) (-635.789) (-630.898) * [-633.680] (-632.513) (-630.567) (-631.074) -- 0:00:19
      677000 -- (-634.874) (-629.587) [-629.310] (-637.437) * (-631.860) (-629.421) (-629.412) [-632.401] -- 0:00:19
      677500 -- (-633.315) (-635.762) [-630.712] (-631.756) * (-629.462) [-632.498] (-628.653) (-630.346) -- 0:00:19
      678000 -- (-631.026) [-632.227] (-632.357) (-631.604) * [-630.349] (-628.674) (-630.601) (-630.155) -- 0:00:19
      678500 -- (-632.839) (-631.693) (-632.982) [-632.201] * (-629.855) [-629.795] (-634.776) (-631.340) -- 0:00:19
      679000 -- (-637.904) (-631.374) [-630.317] (-636.203) * (-629.884) [-628.803] (-629.708) (-632.711) -- 0:00:19
      679500 -- [-630.706] (-630.953) (-631.593) (-630.708) * (-630.558) (-634.079) [-629.626] (-630.008) -- 0:00:19
      680000 -- (-633.220) (-630.698) [-631.402] (-629.971) * [-633.064] (-631.779) (-629.449) (-632.008) -- 0:00:19

      Average standard deviation of split frequencies: 0.005633

      680500 -- [-630.678] (-629.225) (-630.549) (-631.674) * (-632.776) (-633.744) (-630.312) [-631.106] -- 0:00:19
      681000 -- [-630.998] (-629.229) (-630.606) (-630.369) * (-631.735) [-631.514] (-628.933) (-629.940) -- 0:00:19
      681500 -- [-629.371] (-628.854) (-629.636) (-634.551) * (-630.227) (-629.827) [-631.226] (-630.383) -- 0:00:19
      682000 -- (-631.486) (-631.228) [-631.239] (-630.407) * [-629.382] (-630.069) (-628.849) (-629.788) -- 0:00:19
      682500 -- (-630.463) (-631.332) [-635.354] (-631.527) * (-630.695) [-631.511] (-630.162) (-630.795) -- 0:00:19
      683000 -- (-631.079) (-631.262) (-633.062) [-632.241] * (-631.654) (-629.796) [-630.611] (-629.827) -- 0:00:19
      683500 -- (-631.791) [-630.723] (-635.663) (-634.623) * (-630.427) (-630.405) (-630.992) [-629.500] -- 0:00:18
      684000 -- [-629.468] (-638.068) (-633.127) (-631.276) * (-630.864) (-628.861) [-629.484] (-631.229) -- 0:00:18
      684500 -- [-631.688] (-633.181) (-628.926) (-628.600) * [-630.456] (-629.177) (-631.628) (-630.274) -- 0:00:18
      685000 -- (-632.280) (-631.015) [-631.584] (-630.370) * (-630.498) [-630.748] (-636.052) (-629.892) -- 0:00:18

      Average standard deviation of split frequencies: 0.005772

      685500 -- (-629.899) (-629.753) (-631.815) [-629.138] * (-635.968) (-629.252) (-631.797) [-632.469] -- 0:00:18
      686000 -- [-629.639] (-634.653) (-631.218) (-635.176) * (-637.971) [-629.882] (-631.588) (-630.872) -- 0:00:18
      686500 -- [-631.391] (-630.260) (-630.792) (-634.106) * (-633.605) (-629.771) [-629.430] (-629.596) -- 0:00:18
      687000 -- (-634.609) (-628.702) [-630.393] (-632.619) * (-633.095) (-629.554) [-632.137] (-635.554) -- 0:00:18
      687500 -- (-633.825) (-632.238) [-629.180] (-630.445) * (-632.963) [-629.132] (-629.755) (-629.757) -- 0:00:18
      688000 -- (-630.956) (-632.281) [-629.189] (-629.647) * [-631.537] (-628.746) (-631.640) (-631.424) -- 0:00:18
      688500 -- (-635.963) (-631.753) (-630.166) [-630.166] * (-630.077) (-629.268) [-630.088] (-630.007) -- 0:00:18
      689000 -- (-634.405) (-633.325) [-630.870] (-630.736) * (-630.958) [-631.104] (-632.348) (-632.975) -- 0:00:18
      689500 -- (-633.448) (-629.727) (-634.012) [-628.829] * [-630.273] (-631.373) (-631.757) (-630.556) -- 0:00:18
      690000 -- (-629.836) [-629.685] (-632.027) (-628.902) * (-632.098) (-629.385) (-631.188) [-630.876] -- 0:00:18

      Average standard deviation of split frequencies: 0.005870

      690500 -- (-631.350) [-632.701] (-632.044) (-630.682) * (-629.820) (-629.688) [-630.533] (-628.943) -- 0:00:18
      691000 -- [-633.635] (-635.721) (-631.693) (-629.210) * (-630.380) (-629.629) (-630.064) [-631.100] -- 0:00:18
      691500 -- (-630.073) [-632.334] (-628.847) (-630.793) * (-630.236) (-630.428) (-632.452) [-632.512] -- 0:00:18
      692000 -- (-628.999) (-632.302) [-632.685] (-629.878) * (-630.947) [-629.200] (-632.310) (-631.681) -- 0:00:18
      692500 -- (-631.567) (-633.886) [-632.386] (-630.940) * (-630.536) (-629.939) (-630.287) [-630.763] -- 0:00:18
      693000 -- (-632.546) (-629.788) (-630.929) [-630.272] * [-629.830] (-629.742) (-630.257) (-632.127) -- 0:00:18
      693500 -- (-633.376) (-628.840) [-633.692] (-629.844) * [-631.024] (-632.720) (-633.472) (-633.433) -- 0:00:18
      694000 -- (-629.083) [-632.752] (-630.851) (-631.209) * [-630.449] (-630.420) (-630.204) (-631.607) -- 0:00:18
      694500 -- (-631.142) [-629.821] (-630.311) (-630.255) * (-632.132) (-629.001) (-629.092) [-628.937] -- 0:00:18
      695000 -- (-633.411) (-629.693) [-630.281] (-630.240) * (-629.330) (-628.801) (-629.742) [-632.014] -- 0:00:18

      Average standard deviation of split frequencies: 0.005735

      695500 -- (-632.747) (-630.163) (-630.952) [-631.862] * (-637.981) [-629.631] (-632.447) (-636.798) -- 0:00:18
      696000 -- (-634.792) (-631.076) [-631.443] (-631.337) * [-630.751] (-633.034) (-633.851) (-633.327) -- 0:00:18
      696500 -- (-633.359) (-630.102) (-629.375) [-630.867] * (-629.248) (-635.159) [-630.418] (-630.030) -- 0:00:18
      697000 -- (-632.607) [-631.267] (-633.645) (-632.747) * [-628.787] (-630.458) (-632.565) (-633.433) -- 0:00:18
      697500 -- (-631.453) [-629.676] (-630.942) (-636.045) * [-629.679] (-630.027) (-630.806) (-632.884) -- 0:00:18
      698000 -- (-630.843) [-629.696] (-631.125) (-631.194) * (-629.885) [-631.041] (-632.594) (-630.722) -- 0:00:18
      698500 -- (-630.832) (-631.222) (-629.632) [-630.101] * (-629.229) [-632.004] (-631.774) (-631.509) -- 0:00:18
      699000 -- (-633.987) (-632.115) (-629.983) [-631.199] * (-629.508) (-629.078) [-632.769] (-629.188) -- 0:00:18
      699500 -- (-629.343) (-631.409) [-630.615] (-631.521) * (-630.330) [-630.075] (-630.925) (-629.581) -- 0:00:18
      700000 -- (-631.597) [-630.880] (-635.450) (-632.556) * (-633.254) (-628.539) [-633.156] (-631.131) -- 0:00:18

      Average standard deviation of split frequencies: 0.005921

      700500 -- (-633.004) (-631.183) (-630.417) [-634.268] * [-632.142] (-629.086) (-631.643) (-630.798) -- 0:00:17
      701000 -- (-633.690) (-629.780) (-631.589) [-633.091] * (-631.962) [-630.977] (-631.496) (-629.889) -- 0:00:17
      701500 -- (-630.180) (-635.608) (-629.511) [-634.944] * (-632.386) (-629.257) (-633.426) [-628.571] -- 0:00:17
      702000 -- (-629.261) (-629.325) [-634.846] (-630.880) * [-633.746] (-632.348) (-630.252) (-628.490) -- 0:00:17
      702500 -- [-630.081] (-630.421) (-636.212) (-632.161) * [-635.335] (-630.959) (-629.541) (-628.543) -- 0:00:17
      703000 -- (-631.004) [-631.159] (-636.483) (-634.077) * (-632.508) (-632.033) (-630.284) [-630.274] -- 0:00:17
      703500 -- [-629.742] (-631.193) (-633.195) (-631.790) * (-632.418) [-630.658] (-630.857) (-632.141) -- 0:00:17
      704000 -- (-631.709) [-629.738] (-633.862) (-631.772) * (-629.902) [-631.568] (-629.565) (-629.675) -- 0:00:17
      704500 -- [-629.762] (-629.565) (-629.042) (-633.567) * (-630.399) (-632.071) (-628.751) [-629.192] -- 0:00:17
      705000 -- (-629.724) [-631.987] (-631.215) (-633.670) * (-629.872) (-635.880) [-630.124] (-629.173) -- 0:00:17

      Average standard deviation of split frequencies: 0.006009

      705500 -- (-629.842) (-631.179) (-631.572) [-629.907] * [-631.082] (-630.185) (-631.538) (-629.754) -- 0:00:17
      706000 -- [-629.310] (-630.851) (-632.517) (-631.273) * (-632.208) (-629.401) (-630.259) [-629.384] -- 0:00:17
      706500 -- (-639.984) [-630.565] (-629.166) (-631.823) * [-630.680] (-633.038) (-631.808) (-630.617) -- 0:00:17
      707000 -- (-634.731) (-630.709) [-631.050] (-632.820) * [-630.087] (-630.784) (-630.756) (-630.861) -- 0:00:17
      707500 -- (-633.887) (-630.333) (-631.128) [-631.965] * (-630.995) [-630.636] (-634.636) (-629.230) -- 0:00:17
      708000 -- (-628.557) (-629.476) (-630.719) [-630.181] * (-632.075) [-628.985] (-631.000) (-630.947) -- 0:00:17
      708500 -- (-629.802) (-629.502) [-630.390] (-629.992) * (-631.620) [-628.613] (-634.905) (-634.435) -- 0:00:17
      709000 -- (-628.975) [-631.366] (-629.040) (-628.863) * [-631.148] (-631.146) (-634.433) (-631.304) -- 0:00:17
      709500 -- (-630.033) [-630.124] (-630.985) (-632.853) * [-633.135] (-631.311) (-630.005) (-631.381) -- 0:00:17
      710000 -- (-629.947) (-629.602) (-629.847) [-632.447] * (-630.465) [-629.212] (-629.951) (-631.907) -- 0:00:17

      Average standard deviation of split frequencies: 0.006279

      710500 -- (-629.637) [-631.485] (-632.318) (-632.217) * (-633.085) (-630.017) [-631.378] (-631.157) -- 0:00:17
      711000 -- (-630.852) (-633.687) [-632.959] (-636.096) * (-630.483) (-633.801) [-631.663] (-631.153) -- 0:00:17
      711500 -- [-630.209] (-632.759) (-631.359) (-630.146) * (-631.596) (-633.206) [-635.616] (-632.315) -- 0:00:17
      712000 -- (-631.894) (-630.774) [-631.150] (-631.809) * (-630.297) (-630.909) [-631.254] (-632.124) -- 0:00:17
      712500 -- [-634.182] (-631.162) (-630.033) (-631.435) * (-630.575) [-629.457] (-631.125) (-630.072) -- 0:00:17
      713000 -- (-630.820) (-629.564) [-632.574] (-632.683) * [-630.667] (-632.725) (-632.352) (-630.185) -- 0:00:17
      713500 -- (-633.957) [-632.377] (-631.246) (-629.792) * (-631.150) (-629.827) (-631.086) [-629.132] -- 0:00:17
      714000 -- (-628.636) (-634.687) [-629.535] (-630.827) * [-629.786] (-629.263) (-632.315) (-629.699) -- 0:00:17
      714500 -- (-629.408) [-633.363] (-632.159) (-630.867) * (-632.390) [-630.900] (-629.904) (-633.777) -- 0:00:17
      715000 -- [-630.809] (-634.061) (-632.588) (-631.269) * (-630.445) (-630.354) (-632.667) [-631.952] -- 0:00:17

      Average standard deviation of split frequencies: 0.006496

      715500 -- [-633.244] (-631.357) (-636.140) (-635.271) * (-633.397) [-629.946] (-637.928) (-632.227) -- 0:00:17
      716000 -- [-631.173] (-632.249) (-632.228) (-629.057) * [-633.121] (-633.071) (-634.487) (-634.092) -- 0:00:17
      716500 -- [-630.261] (-631.654) (-632.253) (-635.684) * (-630.994) [-632.964] (-630.922) (-630.428) -- 0:00:17
      717000 -- (-630.403) (-630.446) (-630.521) [-632.318] * [-632.779] (-635.046) (-630.641) (-631.712) -- 0:00:16
      717500 -- [-631.706] (-633.748) (-629.556) (-630.142) * (-629.755) [-631.075] (-629.435) (-629.380) -- 0:00:16
      718000 -- [-631.266] (-632.852) (-630.687) (-629.452) * (-630.728) (-629.496) [-630.270] (-629.264) -- 0:00:16
      718500 -- (-631.280) (-631.479) (-630.464) [-630.270] * (-629.775) (-630.594) (-630.014) [-632.128] -- 0:00:16
      719000 -- (-632.873) (-631.879) [-630.367] (-631.729) * (-631.332) (-629.804) [-628.885] (-633.474) -- 0:00:16
      719500 -- [-633.015] (-631.712) (-634.019) (-632.288) * (-629.897) (-630.703) [-632.231] (-634.196) -- 0:00:16
      720000 -- (-630.945) [-631.789] (-632.886) (-632.721) * (-628.710) (-631.338) (-629.476) [-632.997] -- 0:00:16

      Average standard deviation of split frequencies: 0.006323

      720500 -- (-630.305) (-633.050) (-630.081) [-631.400] * [-629.926] (-629.007) (-629.179) (-629.690) -- 0:00:16
      721000 -- (-629.734) [-628.797] (-634.896) (-634.453) * (-630.662) (-628.725) (-633.480) [-631.910] -- 0:00:16
      721500 -- (-629.291) [-629.141] (-631.046) (-630.419) * [-628.679] (-629.799) (-630.741) (-631.845) -- 0:00:16
      722000 -- (-637.911) (-633.452) [-629.653] (-634.666) * [-631.600] (-630.788) (-629.432) (-628.780) -- 0:00:16
      722500 -- (-633.540) (-633.013) (-631.285) [-631.950] * (-628.488) (-635.482) [-630.189] (-634.298) -- 0:00:16
      723000 -- (-630.316) (-629.623) (-630.003) [-629.996] * [-632.538] (-631.190) (-630.018) (-633.431) -- 0:00:16
      723500 -- (-631.697) (-629.172) (-631.732) [-629.530] * [-631.968] (-631.770) (-631.571) (-634.673) -- 0:00:16
      724000 -- [-631.578] (-630.498) (-630.563) (-634.095) * (-634.456) (-632.332) [-631.601] (-629.931) -- 0:00:16
      724500 -- (-635.106) [-631.268] (-631.515) (-633.268) * (-631.998) (-634.102) [-630.474] (-635.369) -- 0:00:16
      725000 -- (-630.425) (-630.826) (-629.398) [-631.810] * (-631.746) [-631.852] (-629.903) (-633.399) -- 0:00:16

      Average standard deviation of split frequencies: 0.006363

      725500 -- (-632.953) [-631.180] (-632.457) (-628.864) * (-630.964) (-635.145) [-630.283] (-628.804) -- 0:00:16
      726000 -- [-629.749] (-633.878) (-634.174) (-630.922) * [-631.284] (-630.319) (-629.346) (-630.270) -- 0:00:16
      726500 -- (-630.886) [-629.940] (-630.694) (-634.574) * (-629.795) [-629.240] (-631.555) (-632.092) -- 0:00:16
      727000 -- (-629.640) [-630.258] (-629.591) (-629.062) * (-631.754) (-628.952) [-629.030] (-631.841) -- 0:00:16
      727500 -- [-631.603] (-631.630) (-628.986) (-631.021) * (-629.405) (-633.332) (-628.608) [-630.089] -- 0:00:16
      728000 -- (-629.941) (-630.707) (-632.997) [-630.549] * (-630.301) (-631.126) [-630.959] (-628.990) -- 0:00:16
      728500 -- [-630.090] (-633.734) (-631.865) (-630.476) * (-633.456) (-631.081) (-632.343) [-630.292] -- 0:00:16
      729000 -- (-630.575) (-633.683) (-631.020) [-629.770] * (-633.314) (-632.110) [-629.567] (-629.603) -- 0:00:16
      729500 -- [-632.241] (-629.836) (-632.032) (-631.650) * (-630.202) (-630.695) (-631.070) [-630.589] -- 0:00:16
      730000 -- (-632.947) (-629.624) (-632.842) [-630.500] * (-630.581) (-630.251) (-630.720) [-630.748] -- 0:00:16

      Average standard deviation of split frequencies: 0.007011

      730500 -- [-631.922] (-631.103) (-630.490) (-630.249) * (-632.355) [-630.722] (-631.264) (-631.401) -- 0:00:16
      731000 -- (-633.117) (-630.077) (-630.947) [-629.732] * (-632.708) (-630.551) (-631.313) [-630.743] -- 0:00:16
      731500 -- [-633.488] (-632.197) (-632.061) (-631.839) * (-631.600) [-629.471] (-634.542) (-628.981) -- 0:00:16
      732000 -- (-631.925) (-631.561) [-629.772] (-628.971) * (-634.424) (-630.206) (-631.997) [-630.382] -- 0:00:16
      732500 -- (-630.068) [-629.423] (-630.899) (-628.901) * [-637.603] (-630.077) (-631.963) (-631.586) -- 0:00:16
      733000 -- [-631.040] (-631.143) (-634.905) (-630.437) * [-630.201] (-632.199) (-634.249) (-632.840) -- 0:00:16
      733500 -- (-631.237) [-630.814] (-637.656) (-639.320) * (-630.968) [-629.476] (-631.620) (-631.333) -- 0:00:15
      734000 -- [-634.538] (-634.487) (-632.842) (-634.033) * (-629.139) (-632.245) [-630.098] (-631.085) -- 0:00:15
      734500 -- [-631.871] (-632.801) (-633.208) (-635.118) * (-632.627) [-637.695] (-630.221) (-631.128) -- 0:00:15
      735000 -- (-630.745) (-630.179) [-632.256] (-633.867) * [-632.277] (-631.342) (-630.561) (-631.486) -- 0:00:15

      Average standard deviation of split frequencies: 0.006960

      735500 -- [-629.632] (-631.559) (-631.883) (-635.075) * (-631.166) (-633.508) [-630.781] (-632.686) -- 0:00:15
      736000 -- [-632.201] (-631.616) (-631.397) (-633.976) * (-637.539) (-630.080) (-631.124) [-630.673] -- 0:00:15
      736500 -- [-628.968] (-631.604) (-633.196) (-631.437) * (-631.762) [-629.267] (-630.809) (-630.120) -- 0:00:15
      737000 -- (-630.382) [-630.284] (-633.524) (-631.519) * (-634.818) [-630.517] (-629.327) (-631.610) -- 0:00:15
      737500 -- (-630.300) [-629.118] (-630.820) (-631.008) * (-631.706) (-632.619) [-630.638] (-630.856) -- 0:00:15
      738000 -- (-632.327) [-630.264] (-632.655) (-630.872) * (-632.877) (-630.237) [-630.368] (-632.316) -- 0:00:15
      738500 -- (-631.398) (-631.163) (-633.816) [-630.123] * (-630.529) (-629.637) [-631.215] (-632.585) -- 0:00:15
      739000 -- [-629.533] (-631.752) (-630.122) (-631.113) * (-631.718) [-630.893] (-629.140) (-633.711) -- 0:00:15
      739500 -- (-629.359) (-633.851) [-630.022] (-632.502) * [-630.838] (-629.400) (-630.116) (-632.207) -- 0:00:15
      740000 -- (-634.154) (-634.674) [-630.783] (-633.869) * (-629.208) (-630.077) (-629.702) [-630.668] -- 0:00:15

      Average standard deviation of split frequencies: 0.007553

      740500 -- (-629.478) (-629.629) (-634.422) [-631.755] * (-630.367) (-628.738) [-629.039] (-629.546) -- 0:00:15
      741000 -- (-629.364) (-633.203) (-630.958) [-630.011] * (-631.990) (-629.395) [-628.930] (-630.322) -- 0:00:15
      741500 -- (-631.843) [-631.025] (-632.330) (-628.507) * (-635.805) (-630.968) (-633.913) [-632.712] -- 0:00:15
      742000 -- (-631.211) [-631.497] (-629.053) (-631.970) * (-631.716) (-638.290) (-632.005) [-630.794] -- 0:00:15
      742500 -- (-630.424) (-630.128) [-629.347] (-632.580) * (-632.981) (-633.810) (-630.413) [-631.639] -- 0:00:15
      743000 -- [-630.237] (-631.347) (-630.929) (-633.340) * (-631.870) (-632.628) (-629.046) [-632.380] -- 0:00:15
      743500 -- (-628.944) [-630.925] (-629.824) (-631.357) * [-628.928] (-632.591) (-633.301) (-630.422) -- 0:00:15
      744000 -- [-630.485] (-631.874) (-637.632) (-629.657) * (-629.268) (-630.519) [-630.543] (-628.570) -- 0:00:15
      744500 -- (-634.994) [-629.850] (-629.504) (-629.851) * (-634.833) (-630.922) [-629.345] (-631.482) -- 0:00:15
      745000 -- (-634.395) (-632.429) [-629.998] (-630.186) * [-633.302] (-632.113) (-629.216) (-631.740) -- 0:00:15

      Average standard deviation of split frequencies: 0.007035

      745500 -- (-632.342) [-630.072] (-629.654) (-630.184) * (-629.645) (-629.806) [-630.666] (-632.835) -- 0:00:15
      746000 -- (-634.678) (-629.712) [-630.115] (-631.669) * (-632.376) [-629.457] (-630.678) (-629.074) -- 0:00:15
      746500 -- (-631.342) (-631.003) [-630.374] (-631.432) * (-630.132) (-629.865) [-634.740] (-629.530) -- 0:00:15
      747000 -- (-630.119) (-633.633) (-630.972) [-629.812] * (-628.884) (-630.194) [-630.447] (-634.652) -- 0:00:15
      747500 -- [-630.925] (-629.478) (-631.928) (-633.026) * (-630.887) (-632.689) (-632.382) [-629.782] -- 0:00:15
      748000 -- (-629.616) (-629.661) (-630.861) [-630.496] * (-630.812) (-630.272) (-630.924) [-629.899] -- 0:00:15
      748500 -- [-630.766] (-634.490) (-631.385) (-631.729) * [-631.079] (-630.423) (-632.415) (-628.819) -- 0:00:15
      749000 -- (-629.294) (-633.959) [-630.774] (-634.734) * (-630.385) (-629.522) (-629.814) [-629.950] -- 0:00:15
      749500 -- (-629.974) (-629.600) (-632.053) [-630.830] * [-630.802] (-632.683) (-628.908) (-631.462) -- 0:00:15
      750000 -- (-629.626) (-633.015) [-630.996] (-630.413) * (-631.826) (-630.971) (-629.687) [-631.214] -- 0:00:15

      Average standard deviation of split frequencies: 0.006698

      750500 -- (-628.900) (-629.850) (-633.408) [-629.574] * [-629.223] (-632.202) (-631.131) (-634.220) -- 0:00:14
      751000 -- (-629.049) (-632.017) [-631.638] (-630.574) * (-631.030) (-633.096) [-630.242] (-636.813) -- 0:00:14
      751500 -- [-628.626] (-629.673) (-630.391) (-635.971) * (-629.675) (-633.313) (-633.775) [-634.784] -- 0:00:14
      752000 -- (-628.737) [-628.717] (-630.379) (-631.559) * [-631.218] (-631.505) (-629.777) (-630.192) -- 0:00:14
      752500 -- [-632.058] (-633.437) (-630.863) (-635.657) * (-629.711) (-633.576) [-634.667] (-629.166) -- 0:00:14
      753000 -- (-633.048) (-629.925) [-630.603] (-630.354) * [-630.724] (-629.428) (-632.864) (-630.289) -- 0:00:14
      753500 -- (-631.296) [-629.536] (-631.489) (-630.095) * (-631.048) (-629.510) (-630.809) [-630.247] -- 0:00:14
      754000 -- (-629.375) (-631.135) [-629.426] (-629.091) * (-635.769) (-634.016) (-630.683) [-630.107] -- 0:00:14
      754500 -- [-629.311] (-635.143) (-629.521) (-631.996) * [-631.308] (-633.320) (-633.577) (-628.731) -- 0:00:14
      755000 -- [-629.334] (-634.744) (-629.975) (-630.102) * (-632.648) (-629.491) [-629.637] (-631.975) -- 0:00:14

      Average standard deviation of split frequencies: 0.007108

      755500 -- (-629.284) (-634.637) [-630.900] (-634.716) * [-629.736] (-631.992) (-639.269) (-632.810) -- 0:00:14
      756000 -- (-633.584) (-632.259) [-629.290] (-629.160) * (-633.977) (-631.712) (-633.204) [-629.324] -- 0:00:14
      756500 -- (-629.867) (-630.552) (-629.653) [-631.456] * (-629.038) (-635.041) [-632.945] (-630.056) -- 0:00:14
      757000 -- [-629.607] (-630.889) (-630.565) (-630.900) * (-630.237) (-630.083) [-630.230] (-630.910) -- 0:00:14
      757500 -- [-630.140] (-630.419) (-631.468) (-629.908) * [-630.907] (-630.450) (-629.870) (-629.422) -- 0:00:14
      758000 -- [-630.117] (-633.246) (-633.101) (-628.667) * (-630.992) [-629.490] (-630.960) (-631.492) -- 0:00:14
      758500 -- [-631.097] (-630.460) (-631.981) (-630.986) * (-633.519) (-630.465) (-632.797) [-629.907] -- 0:00:14
      759000 -- (-639.008) [-630.179] (-629.763) (-630.073) * (-630.681) [-631.095] (-632.529) (-633.074) -- 0:00:14
      759500 -- [-630.630] (-631.937) (-628.915) (-629.017) * (-632.318) (-628.689) (-631.267) [-628.980] -- 0:00:14
      760000 -- (-630.936) (-632.841) [-630.452] (-630.164) * (-631.297) (-631.512) (-631.570) [-632.808] -- 0:00:14

      Average standard deviation of split frequencies: 0.007395

      760500 -- (-632.754) (-631.051) [-628.667] (-630.809) * (-630.648) [-630.954] (-630.111) (-632.111) -- 0:00:14
      761000 -- [-630.821] (-630.176) (-633.366) (-629.383) * (-628.995) [-630.116] (-630.024) (-632.487) -- 0:00:14
      761500 -- (-629.940) [-633.285] (-634.367) (-631.643) * (-630.085) (-628.718) (-631.479) [-631.534] -- 0:00:14
      762000 -- (-629.235) [-630.420] (-631.668) (-629.573) * (-631.940) (-629.646) [-629.953] (-630.775) -- 0:00:14
      762500 -- (-631.343) (-633.146) [-628.955] (-630.123) * (-631.556) [-631.990] (-631.512) (-639.166) -- 0:00:14
      763000 -- (-634.425) (-632.065) (-631.960) [-631.538] * (-630.341) (-631.185) (-632.314) [-629.806] -- 0:00:14
      763500 -- (-634.301) (-630.450) [-632.937] (-632.010) * (-634.054) (-631.007) (-629.416) [-629.693] -- 0:00:14
      764000 -- (-632.718) (-630.673) [-631.819] (-630.139) * (-631.089) (-630.384) [-630.858] (-633.030) -- 0:00:14
      764500 -- (-632.229) (-635.175) [-629.581] (-630.264) * (-632.062) (-632.519) [-629.561] (-631.811) -- 0:00:14
      765000 -- (-629.689) (-632.337) (-630.152) [-629.709] * [-630.248] (-631.564) (-631.965) (-631.860) -- 0:00:14

      Average standard deviation of split frequencies: 0.008616

      765500 -- (-633.243) [-630.328] (-632.339) (-630.474) * (-635.433) (-632.898) (-630.146) [-630.952] -- 0:00:14
      766000 -- (-630.042) (-630.305) (-629.829) [-629.233] * (-629.759) (-634.295) (-629.252) [-632.483] -- 0:00:14
      766500 -- (-629.585) [-632.008] (-631.274) (-631.713) *