--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:16:14 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/sdhC/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -630.17 -632.94
2 -630.12 -632.87
--------------------------------------
TOTAL -630.15 -632.91
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895467 0.088758 0.341366 1.458674 0.865281 1371.67 1436.33 1.000
r(A<->C){all} 0.168815 0.019752 0.000048 0.439890 0.135987 92.72 211.62 1.002
r(A<->G){all} 0.167028 0.020190 0.000055 0.448200 0.131661 152.12 315.77 1.010
r(A<->T){all} 0.162905 0.018367 0.000034 0.425846 0.128373 267.07 337.72 1.001
r(C<->G){all} 0.173965 0.021164 0.000216 0.469932 0.136393 167.91 245.76 1.000
r(C<->T){all} 0.157300 0.018560 0.000003 0.431754 0.116613 134.70 200.52 1.006
r(G<->T){all} 0.169986 0.021863 0.000025 0.476445 0.128026 161.91 195.43 1.000
pi(A){all} 0.191936 0.000340 0.155658 0.227444 0.191417 1176.67 1332.13 1.000
pi(C){all} 0.296358 0.000458 0.254796 0.337559 0.295432 1206.21 1248.07 1.000
pi(G){all} 0.293977 0.000431 0.255530 0.336018 0.293590 1052.50 1153.57 1.000
pi(T){all} 0.217729 0.000372 0.180788 0.254163 0.217399 1113.18 1147.97 1.000
alpha{1,2} 0.411589 0.218317 0.000171 1.348548 0.238010 1238.73 1321.94 1.000
alpha{3} 0.460934 0.256817 0.000111 1.492665 0.297549 940.95 1119.12 1.000
pinvar{all} 0.996692 0.000014 0.989332 0.999996 0.997910 1138.48 1237.35 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -602.884864
Model 2: PositiveSelection -602.88487
Model 0: one-ratio -602.88487
Model 7: beta -602.88486
Model 8: beta&w>1 -602.88486
Model 0 vs 1 1.1999999969702912E-5
Model 2 vs 1 1.1999999969702912E-5
Model 8 vs 7 0.0
>C1
VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
HFR
>C2
VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
HFR
>C3
VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
HFR
>C4
VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
HFR
>C5
VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
HFR
>C6
VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
HFR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=153
C1 VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
C2 VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
C3 VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
C4 VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
C5 VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
C6 VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
**************************************************
C1 FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
C2 FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
C3 FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
C4 FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
C5 FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
C6 FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
**************************************************
C1 IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
C2 IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
C3 IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
C4 IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
C5 IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
C6 IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
**************************************************
C1 HFR
C2 HFR
C3 HFR
C4 HFR
C5 HFR
C6 HFR
***
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4590]--->[4590]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.457 Mb, Max= 30.677 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
C2 VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
C3 VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
C4 VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
C5 VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
C6 VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
**************************************************
C1 FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
C2 FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
C3 FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
C4 FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
C5 FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
C6 FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
**************************************************
C1 IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
C2 IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
C3 IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
C4 IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
C5 IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
C6 IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
**************************************************
C1 HFR
C2 HFR
C3 HFR
C4 HFR
C5 HFR
C6 HFR
***
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC
C2 GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC
C3 GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC
C4 GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC
C5 GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC
C6 GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC
**************************************************
C1 AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC
C2 AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC
C3 AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC
C4 AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC
C5 AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC
C6 AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC
**************************************************
C1 CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC
C2 CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC
C3 CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC
C4 CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC
C5 CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC
C6 CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC
**************************************************
C1 TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC
C2 TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC
C3 TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC
C4 TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC
C5 TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC
C6 TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC
**************************************************
C1 GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT
C2 GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT
C3 GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT
C4 GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT
C5 GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT
C6 GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT
**************************************************
C1 TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG
C2 TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG
C3 TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG
C4 TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG
C5 TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG
C6 TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG
**************************************************
C1 ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG
C2 ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG
C3 ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG
C4 ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG
C5 ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG
C6 ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG
**************************************************
C1 GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG
C2 GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG
C3 GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG
C4 GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG
C5 GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG
C6 GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG
**************************************************
C1 CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG
C2 CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG
C3 CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG
C4 CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG
C5 CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG
C6 CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG
**************************************************
C1 CACTTCCGA
C2 CACTTCCGA
C3 CACTTCCGA
C4 CACTTCCGA
C5 CACTTCCGA
C6 CACTTCCGA
*********
>C1
GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC
AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC
CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC
TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC
GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT
TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG
ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG
GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG
CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG
CACTTCCGA
>C2
GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC
AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC
CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC
TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC
GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT
TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG
ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG
GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG
CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG
CACTTCCGA
>C3
GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC
AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC
CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC
TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC
GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT
TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG
ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG
GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG
CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG
CACTTCCGA
>C4
GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC
AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC
CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC
TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC
GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT
TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG
ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG
GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG
CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG
CACTTCCGA
>C5
GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC
AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC
CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC
TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC
GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT
TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG
ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG
GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG
CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG
CACTTCCGA
>C6
GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC
AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC
CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC
TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC
GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT
TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG
ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG
GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG
CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG
CACTTCCGA
>C1
VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
HFR
>C2
VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
HFR
>C3
VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
HFR
>C4
VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
HFR
>C5
VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
HFR
>C6
VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
HFR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 459 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579788900
Setting output file names to "/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1129409138
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0673915379
Seed = 572579534
Swapseed = 1579788900
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1027.264005 -- -24.965149
Chain 2 -- -1027.264005 -- -24.965149
Chain 3 -- -1027.264005 -- -24.965149
Chain 4 -- -1027.264005 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1027.264005 -- -24.965149
Chain 2 -- -1027.263946 -- -24.965149
Chain 3 -- -1027.264005 -- -24.965149
Chain 4 -- -1027.264005 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1027.264] (-1027.264) (-1027.264) (-1027.264) * [-1027.264] (-1027.264) (-1027.264) (-1027.264)
500 -- (-647.107) (-646.589) (-637.176) [-641.467] * (-641.685) [-635.830] (-638.917) (-642.641) -- 0:00:00
1000 -- (-637.070) (-643.422) [-638.070] (-645.328) * (-636.335) (-635.287) [-637.524] (-643.290) -- 0:00:00
1500 -- (-642.232) (-642.927) [-638.129] (-640.496) * (-650.131) (-639.135) [-642.155] (-638.980) -- 0:00:00
2000 -- (-638.245) (-641.130) (-639.292) [-634.254] * (-641.787) (-640.755) [-642.976] (-643.421) -- 0:00:00
2500 -- (-636.240) [-639.744] (-641.729) (-641.282) * (-639.962) (-657.570) (-641.754) [-637.636] -- 0:00:00
3000 -- (-643.100) (-637.620) (-639.241) [-638.931] * (-640.167) (-648.255) [-639.381] (-642.113) -- 0:00:00
3500 -- (-647.785) (-638.378) [-641.504] (-637.705) * (-641.784) (-640.049) (-639.768) [-642.527] -- 0:00:00
4000 -- (-643.815) (-633.357) (-644.403) [-636.948] * (-639.243) [-633.115] (-641.283) (-637.961) -- 0:00:00
4500 -- (-646.008) (-642.132) [-644.455] (-639.316) * (-647.182) [-640.710] (-641.675) (-640.639) -- 0:00:00
5000 -- (-641.110) (-641.420) [-640.166] (-642.734) * (-638.980) (-642.958) [-634.061] (-639.275) -- 0:03:19
Average standard deviation of split frequencies: 0.078567
5500 -- (-646.517) (-637.432) (-638.016) [-642.568] * (-640.443) (-640.869) (-639.328) [-645.307] -- 0:03:00
6000 -- (-639.262) [-634.736] (-643.484) (-656.084) * (-640.555) [-638.389] (-642.693) (-641.109) -- 0:02:45
6500 -- [-637.410] (-640.624) (-652.523) (-646.398) * (-640.913) (-633.442) (-644.526) [-639.541] -- 0:02:32
7000 -- (-643.113) (-653.433) [-638.969] (-643.371) * (-646.739) (-637.766) (-644.070) [-637.828] -- 0:02:21
7500 -- (-634.514) (-647.982) (-638.312) [-644.956] * (-649.376) [-640.054] (-646.810) (-643.588) -- 0:02:12
8000 -- (-640.903) (-636.020) [-643.705] (-657.832) * (-645.155) [-633.692] (-643.131) (-640.462) -- 0:02:04
8500 -- (-639.759) [-635.134] (-643.339) (-630.219) * (-639.335) (-644.758) (-637.475) [-637.022] -- 0:01:56
9000 -- [-638.932] (-645.543) (-641.369) (-631.425) * (-638.375) [-636.943] (-641.955) (-637.123) -- 0:01:50
9500 -- (-641.773) (-638.393) (-644.364) [-629.724] * (-644.047) (-638.439) (-641.087) [-641.960] -- 0:01:44
10000 -- (-644.323) (-642.411) (-643.211) [-631.280] * (-643.868) (-636.907) (-642.532) [-639.323] -- 0:01:39
Average standard deviation of split frequencies: 0.069780
10500 -- (-639.589) (-639.693) (-630.985) [-631.704] * [-636.565] (-650.617) (-648.321) (-645.580) -- 0:01:34
11000 -- (-635.336) [-638.038] (-631.069) (-630.828) * (-642.478) (-640.385) [-635.899] (-643.751) -- 0:01:29
11500 -- (-635.137) (-642.563) [-631.209] (-629.259) * (-633.504) (-649.298) (-644.112) [-633.083] -- 0:01:25
12000 -- (-642.018) [-643.185] (-630.005) (-633.569) * [-641.188] (-641.798) (-643.570) (-635.915) -- 0:01:22
12500 -- (-640.883) (-646.110) [-631.256] (-629.684) * (-642.736) (-643.042) [-634.376] (-643.523) -- 0:01:19
13000 -- (-638.458) [-639.204] (-630.128) (-633.299) * [-640.199] (-650.826) (-645.147) (-642.679) -- 0:01:15
13500 -- [-639.265] (-639.264) (-633.481) (-633.395) * [-639.594] (-642.300) (-638.699) (-644.161) -- 0:01:13
14000 -- (-638.417) (-643.449) (-633.302) [-631.182] * (-643.674) (-641.617) [-643.519] (-645.934) -- 0:01:10
14500 -- [-643.261] (-639.390) (-631.103) (-629.362) * (-645.119) [-640.099] (-640.711) (-650.792) -- 0:01:07
15000 -- (-639.551) [-637.654] (-632.181) (-629.511) * (-640.543) (-637.078) [-639.253] (-644.028) -- 0:01:05
Average standard deviation of split frequencies: 0.052378
15500 -- [-632.490] (-637.678) (-632.835) (-631.413) * (-633.536) [-635.795] (-644.172) (-641.479) -- 0:01:03
16000 -- (-643.039) (-634.996) [-629.532] (-629.009) * [-636.245] (-640.444) (-648.387) (-638.236) -- 0:01:01
16500 -- (-643.367) [-638.864] (-631.290) (-629.092) * [-633.717] (-636.063) (-638.338) (-638.668) -- 0:00:59
17000 -- (-639.339) (-639.278) (-630.290) [-631.399] * [-639.218] (-640.645) (-642.560) (-639.444) -- 0:00:57
17500 -- (-639.095) [-638.016] (-631.344) (-631.502) * (-639.713) (-636.695) [-639.561] (-639.312) -- 0:00:56
18000 -- [-638.024] (-640.030) (-628.905) (-630.835) * (-638.732) (-641.135) [-637.237] (-653.024) -- 0:00:54
18500 -- (-645.003) [-645.274] (-631.536) (-631.168) * (-651.165) [-639.456] (-644.627) (-640.063) -- 0:00:53
19000 -- [-635.594] (-642.723) (-633.210) (-632.359) * [-640.209] (-641.085) (-652.342) (-641.442) -- 0:00:51
19500 -- (-643.947) (-642.451) (-632.155) [-633.939] * (-643.629) [-640.744] (-655.191) (-645.641) -- 0:00:50
20000 -- (-642.258) (-645.365) (-630.350) [-635.067] * (-638.729) (-645.648) (-639.811) [-636.381] -- 0:01:38
Average standard deviation of split frequencies: 0.059740
20500 -- [-639.195] (-642.281) (-630.384) (-631.326) * (-643.225) (-657.291) (-645.871) [-641.717] -- 0:01:35
21000 -- (-647.582) (-637.393) [-632.142] (-631.860) * (-633.543) (-645.041) (-644.747) [-637.681] -- 0:01:33
21500 -- [-639.484] (-640.208) (-632.977) (-630.935) * (-631.533) [-639.492] (-642.132) (-641.061) -- 0:01:31
22000 -- (-646.431) (-647.860) (-631.593) [-631.046] * (-629.779) (-637.694) (-643.394) [-636.704] -- 0:01:28
22500 -- (-637.704) [-648.451] (-628.716) (-633.785) * (-631.757) (-642.243) (-638.074) [-636.815] -- 0:01:26
23000 -- (-645.230) (-638.678) (-629.760) [-629.439] * [-631.814] (-632.809) (-641.138) (-638.332) -- 0:01:24
23500 -- [-635.436] (-648.629) (-631.062) (-631.156) * (-632.613) (-633.013) (-645.222) [-639.486] -- 0:01:23
24000 -- (-645.945) [-643.220] (-629.230) (-630.767) * (-633.129) [-632.696] (-640.722) (-644.578) -- 0:01:21
24500 -- (-633.812) [-645.840] (-631.168) (-632.404) * (-628.835) [-629.454] (-643.624) (-649.235) -- 0:01:19
25000 -- (-642.325) (-644.949) [-629.954] (-632.662) * (-629.449) [-629.506] (-638.883) (-640.301) -- 0:01:18
Average standard deviation of split frequencies: 0.057546
25500 -- (-639.675) (-638.720) [-630.264] (-632.435) * (-628.849) (-630.315) [-639.545] (-644.930) -- 0:01:16
26000 -- (-641.403) (-637.885) (-634.659) [-630.011] * [-633.238] (-628.890) (-639.513) (-636.731) -- 0:01:14
26500 -- (-636.667) (-641.126) [-631.569] (-630.253) * (-632.820) [-632.913] (-643.224) (-635.786) -- 0:01:13
27000 -- (-638.106) (-634.630) [-629.095] (-631.339) * [-630.194] (-632.227) (-654.305) (-640.481) -- 0:01:12
27500 -- (-642.303) [-636.191] (-634.582) (-631.698) * [-629.340] (-628.864) (-638.459) (-640.248) -- 0:01:10
28000 -- (-638.067) (-639.369) [-630.624] (-630.945) * (-629.419) (-629.093) (-630.839) [-639.419] -- 0:01:09
28500 -- (-639.883) (-633.730) (-632.049) [-631.111] * (-631.168) [-630.229] (-628.541) (-641.368) -- 0:01:08
29000 -- [-641.057] (-644.324) (-631.124) (-630.888) * (-637.109) (-630.120) (-631.455) [-636.260] -- 0:01:06
29500 -- (-641.520) (-639.113) [-631.622] (-631.384) * (-632.013) [-635.394] (-632.496) (-645.853) -- 0:01:05
30000 -- (-640.266) (-644.458) [-633.981] (-629.468) * (-633.855) [-631.348] (-634.428) (-643.530) -- 0:01:04
Average standard deviation of split frequencies: 0.051007
30500 -- [-640.345] (-644.145) (-638.113) (-632.228) * (-631.500) [-634.281] (-638.256) (-653.765) -- 0:01:03
31000 -- (-638.531) (-635.170) [-630.181] (-633.476) * [-629.515] (-629.514) (-629.884) (-642.376) -- 0:01:02
31500 -- (-632.049) (-631.683) [-631.772] (-630.440) * (-630.915) (-632.118) (-633.262) [-644.616] -- 0:01:01
32000 -- [-629.367] (-633.454) (-631.246) (-630.488) * (-630.798) [-629.875] (-633.804) (-639.636) -- 0:01:00
32500 -- (-629.034) [-630.274] (-631.015) (-631.103) * [-633.314] (-629.090) (-631.288) (-644.078) -- 0:00:59
33000 -- (-629.234) (-631.513) (-629.639) [-629.929] * (-629.370) [-632.397] (-629.235) (-643.370) -- 0:00:58
33500 -- [-629.319] (-630.893) (-630.192) (-629.819) * [-628.896] (-630.406) (-629.687) (-640.473) -- 0:00:57
34000 -- (-632.444) (-630.879) [-629.578] (-632.729) * (-629.591) (-629.621) [-629.575] (-634.139) -- 0:00:56
34500 -- [-630.729] (-631.423) (-630.476) (-630.941) * (-633.738) [-634.980] (-632.704) (-642.448) -- 0:00:55
35000 -- (-631.596) (-630.045) [-630.065] (-632.585) * (-629.460) [-628.646] (-636.984) (-635.912) -- 0:00:55
Average standard deviation of split frequencies: 0.051131
35500 -- (-632.342) (-630.071) (-629.299) [-631.981] * (-630.973) (-629.676) [-631.042] (-641.136) -- 0:01:21
36000 -- [-628.953] (-631.749) (-633.499) (-631.326) * (-630.251) (-632.516) (-633.163) [-640.447] -- 0:01:20
36500 -- (-629.762) (-629.159) (-631.485) [-630.603] * [-629.450] (-633.460) (-630.477) (-641.837) -- 0:01:19
37000 -- [-628.978] (-628.609) (-630.663) (-632.351) * (-629.515) (-630.228) [-631.088] (-641.915) -- 0:01:18
37500 -- [-630.604] (-630.322) (-629.498) (-630.083) * (-630.442) [-630.095] (-633.234) (-651.817) -- 0:01:17
38000 -- [-631.055] (-630.315) (-631.442) (-629.806) * (-635.274) [-630.048] (-630.263) (-638.683) -- 0:01:15
38500 -- (-629.973) [-629.253] (-630.946) (-632.725) * (-629.361) (-631.219) (-630.163) [-641.737] -- 0:01:14
39000 -- [-629.445] (-629.117) (-634.764) (-629.833) * (-628.745) (-631.362) [-629.258] (-643.578) -- 0:01:13
39500 -- [-629.991] (-632.231) (-630.580) (-629.588) * (-630.076) (-631.836) (-629.575) [-639.793] -- 0:01:12
40000 -- (-632.095) (-629.718) [-629.972] (-630.112) * (-629.713) (-633.479) (-629.093) [-638.726] -- 0:01:12
Average standard deviation of split frequencies: 0.049418
40500 -- (-629.593) (-635.341) (-631.138) [-629.135] * (-629.038) (-634.747) [-629.315] (-642.339) -- 0:01:11
41000 -- (-632.908) (-633.039) [-629.010] (-629.837) * (-631.845) [-631.337] (-629.748) (-635.181) -- 0:01:10
41500 -- (-630.305) (-630.533) (-628.481) [-629.305] * (-632.961) (-629.154) [-630.723] (-641.757) -- 0:01:09
42000 -- (-633.817) [-630.011] (-630.627) (-630.427) * (-629.477) (-632.383) (-629.641) [-642.091] -- 0:01:08
42500 -- [-633.884] (-634.333) (-630.434) (-630.722) * [-631.111] (-629.497) (-629.154) (-643.588) -- 0:01:07
43000 -- (-632.993) (-636.145) [-630.509] (-631.926) * (-631.596) (-631.125) [-631.228] (-665.009) -- 0:01:06
43500 -- (-630.772) (-631.059) [-632.277] (-630.700) * [-628.820] (-633.418) (-632.068) (-639.167) -- 0:01:05
44000 -- (-632.692) (-629.849) (-630.172) [-632.777] * [-628.592] (-629.451) (-629.970) (-632.433) -- 0:01:05
44500 -- (-631.787) (-629.818) [-632.332] (-631.685) * [-630.202] (-631.983) (-630.869) (-634.639) -- 0:01:04
45000 -- [-629.784] (-630.102) (-628.919) (-634.734) * [-629.080] (-631.848) (-629.877) (-632.503) -- 0:01:03
Average standard deviation of split frequencies: 0.040101
45500 -- (-632.097) (-630.321) [-630.013] (-630.798) * (-631.902) [-629.301] (-631.031) (-630.954) -- 0:01:02
46000 -- [-630.648] (-629.501) (-632.014) (-633.177) * (-632.860) (-630.909) [-632.532] (-635.458) -- 0:01:02
46500 -- (-631.636) (-631.250) (-633.135) [-629.991] * (-629.843) (-632.424) [-632.432] (-631.437) -- 0:01:01
47000 -- (-633.354) (-635.670) [-629.908] (-629.870) * (-629.892) (-632.576) (-630.837) [-630.020] -- 0:01:00
47500 -- [-631.107] (-630.316) (-630.571) (-629.972) * [-630.516] (-629.628) (-631.236) (-629.906) -- 0:01:00
48000 -- [-628.724] (-629.083) (-636.445) (-630.374) * (-630.112) (-630.740) (-631.661) [-629.896] -- 0:00:59
48500 -- (-628.755) (-630.144) (-631.598) [-632.722] * [-632.085] (-630.513) (-629.476) (-632.993) -- 0:00:58
49000 -- [-628.792] (-633.645) (-632.605) (-631.274) * (-630.773) [-630.175] (-633.656) (-629.842) -- 0:00:58
49500 -- (-629.287) (-629.381) [-630.223] (-634.127) * [-631.303] (-635.266) (-632.362) (-628.718) -- 0:00:57
50000 -- (-631.070) (-630.222) (-629.914) [-631.379] * (-632.442) (-633.352) (-630.846) [-630.287] -- 0:00:57
Average standard deviation of split frequencies: 0.044829
50500 -- [-630.286] (-631.038) (-631.395) (-633.019) * (-631.163) [-632.518] (-630.097) (-630.828) -- 0:01:15
51000 -- (-631.568) (-629.628) (-632.452) [-632.857] * (-629.298) [-632.102] (-631.974) (-633.305) -- 0:01:14
51500 -- (-638.950) [-629.224] (-629.489) (-634.819) * (-629.595) [-631.209] (-629.667) (-630.870) -- 0:01:13
52000 -- [-633.412] (-629.695) (-629.486) (-630.864) * (-631.303) [-634.119] (-630.970) (-631.201) -- 0:01:12
52500 -- (-631.121) (-633.191) [-630.084] (-629.914) * (-630.388) (-631.776) [-631.019] (-630.017) -- 0:01:12
53000 -- (-631.371) (-631.588) [-629.693] (-631.441) * (-631.173) (-631.061) [-631.495] (-629.807) -- 0:01:11
53500 -- (-635.576) (-633.526) (-629.030) [-630.566] * [-629.027] (-631.612) (-632.459) (-634.419) -- 0:01:10
54000 -- (-630.190) (-631.118) [-629.337] (-630.738) * [-629.726] (-630.621) (-634.677) (-631.869) -- 0:01:10
54500 -- (-631.740) [-633.613] (-631.296) (-629.562) * (-629.894) (-630.470) [-635.238] (-632.048) -- 0:01:09
55000 -- (-630.709) (-636.195) (-631.798) [-630.577] * (-634.246) (-631.339) [-632.667] (-632.159) -- 0:01:08
Average standard deviation of split frequencies: 0.042891
55500 -- (-630.766) (-641.039) [-632.585] (-630.061) * (-629.499) [-631.408] (-632.363) (-632.238) -- 0:01:08
56000 -- (-631.774) (-632.976) (-636.881) [-628.973] * [-629.993] (-629.901) (-632.927) (-632.742) -- 0:01:07
56500 -- (-632.501) (-630.260) [-630.132] (-631.788) * (-630.396) [-631.412] (-630.926) (-632.166) -- 0:01:06
57000 -- (-636.171) (-631.058) [-631.246] (-630.670) * (-629.599) (-632.763) [-633.032] (-631.018) -- 0:01:06
57500 -- (-631.629) (-631.469) [-630.877] (-632.793) * [-630.318] (-633.204) (-629.494) (-631.258) -- 0:01:05
58000 -- (-629.185) (-628.688) (-631.807) [-628.999] * (-630.449) (-631.252) (-630.330) [-633.828] -- 0:01:04
58500 -- [-629.796] (-630.174) (-631.503) (-629.584) * (-632.192) [-629.901] (-630.208) (-633.743) -- 0:01:04
59000 -- (-629.434) (-629.564) [-630.420] (-629.859) * (-631.461) (-629.468) [-629.826] (-631.273) -- 0:01:03
59500 -- [-630.424] (-630.888) (-630.076) (-632.207) * (-629.486) (-630.376) [-628.807] (-632.492) -- 0:01:03
60000 -- (-630.781) (-629.023) [-629.976] (-633.950) * (-628.832) (-632.904) [-628.818] (-632.301) -- 0:01:02
Average standard deviation of split frequencies: 0.044402
60500 -- (-634.328) (-630.331) (-631.808) [-629.716] * [-630.223] (-636.574) (-630.320) (-633.592) -- 0:01:02
61000 -- (-630.917) (-632.795) [-630.121] (-632.683) * [-631.538] (-635.290) (-631.202) (-632.401) -- 0:01:01
61500 -- (-631.363) [-630.333] (-629.496) (-634.401) * [-632.129] (-633.991) (-634.450) (-634.507) -- 0:01:01
62000 -- [-629.895] (-629.543) (-629.552) (-633.277) * (-630.543) (-631.509) [-633.394] (-630.173) -- 0:01:00
62500 -- [-632.832] (-630.986) (-628.956) (-629.428) * [-633.568] (-629.043) (-630.083) (-630.356) -- 0:01:00
63000 -- (-630.266) (-632.112) [-629.570] (-632.721) * [-632.914] (-631.445) (-628.879) (-631.810) -- 0:00:59
63500 -- (-630.193) (-629.601) (-628.677) [-631.110] * (-632.295) (-631.434) (-629.092) [-630.333] -- 0:00:58
64000 -- [-633.754] (-629.790) (-631.815) (-630.656) * (-630.331) (-638.588) [-630.553] (-629.746) -- 0:00:58
64500 -- (-631.287) (-630.892) [-633.873] (-631.399) * (-630.525) (-629.780) [-631.726] (-629.599) -- 0:00:58
65000 -- [-628.676] (-633.024) (-635.653) (-632.453) * (-631.707) (-631.196) (-631.738) [-631.399] -- 0:00:57
Average standard deviation of split frequencies: 0.043476
65500 -- (-633.891) (-630.740) [-631.324] (-629.768) * (-632.248) (-631.431) (-632.244) [-631.300] -- 0:01:11
66000 -- [-632.074] (-629.285) (-630.255) (-630.663) * [-629.233] (-633.122) (-632.543) (-631.359) -- 0:01:10
66500 -- (-635.743) [-631.964] (-635.911) (-629.890) * (-631.354) (-631.283) [-630.284] (-632.437) -- 0:01:10
67000 -- [-632.502] (-631.194) (-630.651) (-632.842) * (-633.424) (-630.380) [-631.486] (-630.223) -- 0:01:09
67500 -- (-630.325) (-630.812) (-631.569) [-629.110] * (-629.552) [-629.926] (-631.822) (-632.105) -- 0:01:09
68000 -- (-631.066) [-631.966] (-630.651) (-631.596) * [-631.778] (-632.846) (-631.408) (-630.744) -- 0:01:08
68500 -- (-629.771) (-629.588) (-630.989) [-633.478] * [-630.595] (-635.321) (-629.670) (-631.169) -- 0:01:07
69000 -- (-631.772) (-630.087) (-631.050) [-637.122] * (-632.214) (-630.464) (-632.654) [-629.255] -- 0:01:07
69500 -- [-633.532] (-630.940) (-630.722) (-633.493) * [-629.743] (-631.231) (-632.208) (-629.352) -- 0:01:06
70000 -- [-633.483] (-631.752) (-631.601) (-635.573) * [-630.024] (-631.205) (-633.737) (-630.216) -- 0:01:06
Average standard deviation of split frequencies: 0.046406
70500 -- (-629.314) (-632.935) [-629.583] (-632.460) * (-632.137) (-632.754) [-629.548] (-630.727) -- 0:01:05
71000 -- [-632.235] (-630.385) (-628.690) (-634.485) * (-629.706) [-632.331] (-630.266) (-628.943) -- 0:01:05
71500 -- (-629.948) (-631.202) [-630.667] (-632.805) * (-631.224) [-630.413] (-633.262) (-630.147) -- 0:01:04
72000 -- (-628.764) (-632.915) (-629.944) [-629.988] * [-631.880] (-628.618) (-636.661) (-631.762) -- 0:01:04
72500 -- [-629.037] (-631.450) (-632.991) (-631.322) * [-629.394] (-628.876) (-630.196) (-632.333) -- 0:01:03
73000 -- (-631.139) [-632.022] (-629.846) (-632.867) * (-628.784) [-628.997] (-631.074) (-633.516) -- 0:01:03
73500 -- (-632.903) [-630.507] (-630.276) (-631.865) * (-631.387) (-631.121) [-630.436] (-629.241) -- 0:01:03
74000 -- (-629.659) (-635.777) [-630.023] (-632.643) * (-631.266) (-630.223) [-630.514] (-629.254) -- 0:01:02
74500 -- (-630.598) (-634.764) (-630.531) [-631.211] * (-636.536) [-629.671] (-632.865) (-630.962) -- 0:01:02
75000 -- (-630.224) [-632.295] (-629.188) (-630.658) * (-629.443) [-631.248] (-636.267) (-632.049) -- 0:01:01
Average standard deviation of split frequencies: 0.042610
75500 -- (-629.710) [-632.865] (-632.278) (-629.354) * (-630.999) (-631.461) (-634.148) [-629.578] -- 0:01:01
76000 -- [-630.973] (-629.707) (-629.675) (-630.462) * (-633.336) [-629.340] (-636.015) (-630.103) -- 0:01:00
76500 -- [-629.619] (-629.365) (-632.273) (-631.470) * (-629.934) [-631.242] (-633.059) (-632.707) -- 0:01:00
77000 -- (-631.014) [-632.856] (-635.919) (-632.056) * (-631.107) [-629.720] (-632.565) (-630.384) -- 0:00:59
77500 -- (-628.901) [-635.592] (-634.565) (-631.720) * (-631.965) (-635.184) [-632.995] (-631.445) -- 0:00:59
78000 -- [-629.447] (-635.138) (-632.265) (-630.744) * (-631.117) (-631.772) [-632.995] (-630.164) -- 0:00:59
78500 -- (-630.588) (-635.135) (-636.628) [-630.247] * (-631.823) (-633.686) [-629.459] (-630.730) -- 0:00:58
79000 -- (-630.580) (-631.844) [-628.915] (-631.150) * (-632.287) [-631.866] (-633.199) (-631.962) -- 0:00:58
79500 -- [-630.720] (-632.086) (-628.710) (-631.830) * (-630.605) [-629.199] (-634.838) (-629.063) -- 0:00:57
80000 -- (-631.783) [-631.310] (-630.523) (-632.777) * [-630.214] (-628.974) (-632.327) (-632.922) -- 0:00:57
Average standard deviation of split frequencies: 0.040907
80500 -- [-631.164] (-633.411) (-628.792) (-629.115) * (-631.850) [-628.546] (-630.970) (-632.222) -- 0:00:57
81000 -- (-634.610) (-634.195) [-628.944] (-628.934) * [-630.653] (-630.878) (-629.568) (-630.935) -- 0:00:56
81500 -- (-637.899) [-630.328] (-629.216) (-630.446) * (-631.422) [-630.260] (-631.949) (-630.059) -- 0:00:56
82000 -- (-632.012) [-630.997] (-630.843) (-632.858) * (-631.006) (-630.867) [-632.838] (-630.803) -- 0:00:55
82500 -- (-630.583) (-631.215) (-629.154) [-631.356] * [-631.329] (-629.418) (-637.556) (-631.364) -- 0:00:55
83000 -- (-631.802) [-632.109] (-631.483) (-630.488) * (-631.006) (-631.290) (-634.770) [-633.797] -- 0:01:06
83500 -- (-630.612) (-631.440) (-629.756) [-630.340] * (-629.500) [-632.408] (-633.834) (-632.177) -- 0:01:05
84000 -- [-632.581] (-630.730) (-631.223) (-628.994) * [-630.908] (-632.873) (-629.216) (-631.075) -- 0:01:05
84500 -- [-632.468] (-634.666) (-637.309) (-629.869) * (-630.817) (-630.526) (-629.944) [-632.133] -- 0:01:05
85000 -- [-630.236] (-636.510) (-629.438) (-629.737) * (-633.147) [-628.860] (-630.309) (-631.145) -- 0:01:04
Average standard deviation of split frequencies: 0.038121
85500 -- [-629.262] (-632.776) (-630.025) (-629.222) * [-633.356] (-631.073) (-633.127) (-629.545) -- 0:01:04
86000 -- [-628.804] (-631.529) (-630.303) (-631.750) * [-631.354] (-634.280) (-629.809) (-634.189) -- 0:01:03
86500 -- [-633.642] (-630.587) (-632.705) (-632.086) * (-632.107) (-634.802) [-630.915] (-632.009) -- 0:01:03
87000 -- [-629.186] (-632.467) (-631.930) (-630.644) * (-631.569) [-629.168] (-632.240) (-632.398) -- 0:01:02
87500 -- (-632.729) (-631.831) [-631.948] (-630.289) * [-631.274] (-629.472) (-634.543) (-631.563) -- 0:01:02
88000 -- (-634.140) (-630.189) [-629.213] (-630.423) * (-629.335) [-631.336] (-631.659) (-631.297) -- 0:01:02
88500 -- (-631.519) [-631.158] (-630.320) (-634.283) * [-628.646] (-633.334) (-630.189) (-629.713) -- 0:01:01
89000 -- [-632.779] (-630.214) (-630.650) (-631.654) * (-629.842) (-630.975) (-629.559) [-629.337] -- 0:01:01
89500 -- (-630.790) (-629.711) (-630.628) [-631.092] * [-629.279] (-630.841) (-631.745) (-633.005) -- 0:01:01
90000 -- (-631.358) (-629.903) [-632.016] (-637.120) * (-632.651) (-629.303) [-634.956] (-630.384) -- 0:01:00
Average standard deviation of split frequencies: 0.038759
90500 -- [-629.974] (-633.190) (-629.635) (-631.056) * [-630.270] (-633.782) (-636.029) (-632.122) -- 0:01:00
91000 -- [-630.497] (-631.982) (-631.853) (-630.657) * (-631.142) (-632.993) [-632.807] (-629.563) -- 0:00:59
91500 -- [-629.186] (-634.183) (-632.587) (-630.969) * (-632.541) (-630.855) (-639.207) [-629.453] -- 0:00:59
92000 -- (-629.649) (-633.562) (-632.730) [-630.580] * [-630.360] (-630.401) (-633.775) (-630.209) -- 0:00:59
92500 -- (-631.390) (-636.059) [-630.859] (-631.538) * (-632.055) (-630.952) [-628.960] (-629.562) -- 0:00:58
93000 -- (-630.343) (-634.625) [-630.411] (-630.610) * [-633.461] (-629.107) (-629.189) (-629.610) -- 0:00:58
93500 -- (-630.196) (-630.677) (-632.602) [-629.676] * [-632.827] (-629.256) (-629.189) (-630.644) -- 0:00:58
94000 -- (-630.734) (-629.840) (-634.698) [-629.544] * (-635.383) (-631.277) (-630.576) [-629.823] -- 0:00:57
94500 -- (-629.267) [-632.081] (-632.428) (-633.603) * (-632.186) (-633.065) [-630.429] (-631.910) -- 0:00:57
95000 -- (-630.991) (-630.369) [-631.335] (-629.787) * (-631.130) (-629.985) [-629.070] (-630.361) -- 0:00:57
Average standard deviation of split frequencies: 0.039518
95500 -- (-629.327) (-629.929) (-630.496) [-629.934] * [-632.758] (-632.803) (-630.018) (-631.447) -- 0:00:56
96000 -- (-630.524) (-630.176) (-629.637) [-629.533] * (-631.138) (-631.378) [-629.976] (-632.082) -- 0:00:56
96500 -- (-632.620) [-631.534] (-629.996) (-629.588) * (-631.366) (-630.115) (-630.611) [-632.052] -- 0:00:56
97000 -- (-634.739) (-629.754) (-631.497) [-628.658] * (-630.547) (-630.142) (-631.111) [-636.288] -- 0:00:55
97500 -- (-630.262) (-629.984) (-631.372) [-630.014] * [-630.176] (-631.039) (-631.413) (-633.248) -- 0:00:55
98000 -- [-634.347] (-630.073) (-629.449) (-630.231) * (-631.567) (-630.571) (-629.693) [-629.702] -- 0:00:55
98500 -- [-630.483] (-630.172) (-633.516) (-630.123) * [-629.907] (-631.180) (-632.066) (-629.190) -- 0:00:54
99000 -- (-640.552) [-630.005] (-633.843) (-631.460) * (-630.384) [-631.012] (-636.668) (-631.750) -- 0:00:54
99500 -- (-631.352) [-631.681] (-631.273) (-630.398) * (-632.834) [-631.062] (-634.491) (-631.678) -- 0:00:54
100000 -- [-629.567] (-630.083) (-631.641) (-633.032) * (-630.487) (-631.728) [-631.853] (-631.570) -- 0:01:02
Average standard deviation of split frequencies: 0.036571
100500 -- (-631.175) [-630.581] (-633.905) (-632.390) * (-629.796) [-629.906] (-630.654) (-632.048) -- 0:01:02
101000 -- [-630.425] (-629.300) (-633.665) (-633.138) * (-630.615) (-629.553) [-629.296] (-633.279) -- 0:01:02
101500 -- [-630.881] (-633.372) (-634.150) (-632.507) * [-633.968] (-631.220) (-631.766) (-633.294) -- 0:01:01
102000 -- (-630.383) (-632.757) [-630.884] (-629.790) * (-633.293) [-632.616] (-629.791) (-629.748) -- 0:01:01
102500 -- (-630.426) (-636.993) [-634.542] (-630.364) * (-631.065) (-631.872) (-635.526) [-632.843] -- 0:01:01
103000 -- [-631.712] (-632.037) (-634.856) (-629.550) * (-628.983) (-630.157) (-632.125) [-631.704] -- 0:01:00
103500 -- [-631.911] (-633.591) (-631.486) (-632.547) * (-629.101) [-628.960] (-632.823) (-630.388) -- 0:01:00
104000 -- (-630.617) (-631.125) (-629.194) [-630.138] * (-633.073) [-630.326] (-638.968) (-631.722) -- 0:01:00
104500 -- (-632.049) (-630.550) [-630.405] (-628.903) * [-630.687] (-636.703) (-634.995) (-629.794) -- 0:00:59
105000 -- (-631.369) [-629.788] (-629.934) (-631.266) * (-629.751) (-630.658) (-630.631) [-631.191] -- 0:00:59
Average standard deviation of split frequencies: 0.034224
105500 -- (-628.986) (-630.410) [-632.810] (-631.762) * (-630.432) (-636.460) [-629.988] (-629.409) -- 0:00:59
106000 -- (-629.426) (-629.618) (-628.735) [-630.365] * (-629.895) (-633.079) (-631.711) [-630.578] -- 0:00:59
106500 -- [-629.675] (-630.494) (-633.589) (-633.780) * [-629.554] (-632.191) (-630.316) (-629.656) -- 0:00:58
107000 -- (-630.566) [-634.132] (-630.128) (-629.468) * (-630.058) (-634.960) (-631.632) [-629.808] -- 0:00:58
107500 -- (-629.545) [-631.201] (-629.374) (-629.802) * (-629.304) (-630.488) (-633.271) [-630.641] -- 0:00:58
108000 -- (-629.446) [-630.019] (-630.454) (-632.254) * (-631.904) (-628.956) (-631.601) [-630.923] -- 0:00:57
108500 -- (-629.395) [-631.033] (-633.660) (-633.761) * [-630.404] (-629.048) (-630.885) (-629.246) -- 0:00:57
109000 -- [-629.723] (-631.602) (-632.748) (-631.014) * [-631.455] (-629.672) (-629.309) (-632.089) -- 0:00:57
109500 -- (-629.279) [-632.757] (-633.136) (-629.441) * (-632.216) [-632.945] (-630.110) (-636.381) -- 0:00:56
110000 -- (-629.373) [-631.647] (-631.383) (-630.755) * (-632.670) [-632.744] (-631.686) (-635.415) -- 0:00:56
Average standard deviation of split frequencies: 0.032596
110500 -- (-629.464) [-630.086] (-631.928) (-630.471) * (-634.563) [-631.072] (-630.253) (-633.882) -- 0:00:56
111000 -- (-631.043) (-629.950) (-629.433) [-629.964] * (-632.020) [-630.130] (-630.860) (-630.963) -- 0:00:56
111500 -- [-629.541] (-628.871) (-630.032) (-629.992) * (-630.625) [-631.947] (-629.327) (-633.913) -- 0:00:55
112000 -- (-629.235) (-629.799) [-630.324] (-631.098) * (-629.527) [-631.556] (-629.567) (-630.540) -- 0:00:55
112500 -- (-629.671) (-630.424) (-630.524) [-631.683] * (-629.395) (-629.701) [-630.812] (-631.491) -- 0:00:55
113000 -- (-628.574) [-630.506] (-632.923) (-632.352) * (-630.273) (-629.016) [-629.403] (-640.003) -- 0:00:54
113500 -- (-629.654) (-629.747) (-629.684) [-632.031] * (-629.065) [-635.798] (-629.596) (-635.309) -- 0:00:54
114000 -- (-631.359) [-629.266] (-632.867) (-634.897) * [-629.892] (-629.678) (-632.357) (-630.865) -- 0:00:54
114500 -- (-630.139) (-628.640) (-631.180) [-628.748] * [-629.520] (-636.055) (-631.782) (-630.636) -- 0:00:54
115000 -- (-629.888) [-630.316] (-630.223) (-629.113) * (-629.033) (-631.944) [-634.070] (-629.645) -- 0:00:53
Average standard deviation of split frequencies: 0.031627
115500 -- (-630.765) [-631.829] (-631.136) (-634.066) * [-631.171] (-631.217) (-630.364) (-631.236) -- 0:00:53
116000 -- (-633.284) (-630.304) (-634.510) [-631.358] * (-630.396) (-633.143) [-634.505] (-635.038) -- 0:00:53
116500 -- [-631.610] (-633.208) (-630.707) (-630.295) * (-633.221) [-629.383] (-631.345) (-633.639) -- 0:00:53
117000 -- (-632.124) (-629.535) [-629.565] (-630.816) * (-629.690) [-629.758] (-634.090) (-631.523) -- 0:01:00
117500 -- (-630.942) [-630.772] (-629.433) (-629.519) * (-631.063) [-631.104] (-629.493) (-630.589) -- 0:01:00
118000 -- (-630.598) [-628.809] (-631.569) (-632.260) * [-629.263] (-632.081) (-630.294) (-632.000) -- 0:00:59
118500 -- (-634.873) (-629.613) [-629.617] (-634.833) * (-629.621) (-629.271) (-633.084) [-632.330] -- 0:00:59
119000 -- (-632.896) (-628.905) (-632.023) [-630.678] * (-629.666) (-629.094) [-631.882] (-631.255) -- 0:00:59
119500 -- (-630.078) (-632.416) [-632.469] (-630.299) * (-631.961) [-628.606] (-631.699) (-630.051) -- 0:00:58
120000 -- (-634.776) (-631.445) [-631.544] (-631.343) * (-631.412) (-628.905) (-633.105) [-630.154] -- 0:00:58
Average standard deviation of split frequencies: 0.031067
120500 -- [-632.250] (-631.641) (-631.042) (-630.227) * (-632.418) (-630.334) [-631.069] (-630.074) -- 0:00:58
121000 -- [-630.915] (-630.955) (-630.513) (-631.007) * [-635.786] (-630.493) (-630.907) (-631.977) -- 0:00:58
121500 -- (-631.236) [-630.853] (-630.458) (-638.370) * (-629.573) (-635.014) (-631.656) [-630.281] -- 0:00:57
122000 -- (-630.455) [-629.140] (-630.480) (-630.552) * (-629.852) (-631.304) [-629.665] (-634.601) -- 0:00:57
122500 -- (-633.864) [-629.063] (-633.060) (-630.544) * (-628.997) (-632.947) (-628.989) [-631.385] -- 0:00:57
123000 -- [-631.076] (-633.409) (-632.701) (-630.081) * (-630.203) [-631.278] (-629.130) (-628.958) -- 0:00:57
123500 -- (-631.280) [-633.256] (-628.755) (-632.531) * (-629.558) (-629.449) [-629.487] (-629.972) -- 0:00:56
124000 -- [-631.895] (-630.309) (-631.473) (-632.896) * (-630.387) (-629.959) [-631.407] (-630.598) -- 0:00:56
124500 -- (-629.202) [-630.869] (-632.049) (-630.723) * [-629.460] (-630.815) (-630.324) (-631.505) -- 0:00:56
125000 -- (-628.675) [-629.521] (-630.277) (-631.426) * (-629.352) [-632.151] (-630.066) (-631.415) -- 0:00:56
Average standard deviation of split frequencies: 0.029768
125500 -- (-631.004) (-629.564) (-630.825) [-630.467] * [-629.404] (-630.402) (-629.614) (-629.480) -- 0:00:55
126000 -- (-631.695) (-628.584) [-633.919] (-629.419) * [-630.606] (-631.219) (-629.971) (-632.874) -- 0:00:55
126500 -- (-630.036) (-629.304) [-631.513] (-629.989) * (-631.099) (-630.883) (-629.347) [-631.776] -- 0:00:55
127000 -- [-634.551] (-629.388) (-630.792) (-630.485) * (-628.524) (-638.743) (-631.440) [-628.632] -- 0:00:54
127500 -- (-635.978) [-629.645] (-630.177) (-632.757) * [-628.487] (-634.470) (-631.504) (-633.155) -- 0:00:54
128000 -- (-637.192) (-630.552) [-629.144] (-634.994) * [-629.357] (-633.274) (-630.697) (-628.967) -- 0:00:54
128500 -- (-633.090) (-631.108) (-629.327) [-632.281] * [-632.717] (-631.568) (-634.197) (-633.895) -- 0:00:54
129000 -- (-634.944) (-631.860) [-629.969] (-629.521) * (-638.137) (-633.222) (-630.125) [-629.807] -- 0:00:54
129500 -- [-635.547] (-631.461) (-630.425) (-628.825) * (-631.173) (-634.352) (-629.185) [-631.307] -- 0:00:53
130000 -- (-630.890) (-630.669) [-631.565] (-629.311) * [-632.205] (-630.743) (-629.499) (-634.712) -- 0:00:53
Average standard deviation of split frequencies: 0.025418
130500 -- (-630.652) (-630.225) (-630.858) [-629.264] * (-630.495) (-630.988) (-632.103) [-629.555] -- 0:00:53
131000 -- (-632.461) (-633.307) [-629.721] (-630.047) * (-631.351) (-629.606) [-630.353] (-631.892) -- 0:00:53
131500 -- (-630.065) (-631.576) (-630.353) [-634.355] * (-635.362) [-630.529] (-629.122) (-633.039) -- 0:00:52
132000 -- (-636.273) (-635.036) [-631.187] (-629.803) * [-631.677] (-628.778) (-629.835) (-635.958) -- 0:00:52
132500 -- (-640.590) (-634.260) (-630.616) [-629.422] * (-630.332) (-629.309) (-631.693) [-632.671] -- 0:00:52
133000 -- (-633.629) (-629.337) [-629.906] (-637.984) * [-629.440] (-630.987) (-631.223) (-633.787) -- 0:00:52
133500 -- (-630.152) [-630.948] (-628.551) (-632.263) * (-632.022) (-631.799) [-629.734] (-633.212) -- 0:00:51
134000 -- (-632.261) (-630.257) (-630.353) [-629.494] * (-630.842) (-630.642) [-629.440] (-632.164) -- 0:00:58
134500 -- (-633.663) [-631.002] (-630.902) (-631.163) * [-630.596] (-630.183) (-629.633) (-634.448) -- 0:00:57
135000 -- (-629.793) (-631.230) (-630.869) [-631.037] * [-629.071] (-633.593) (-630.253) (-630.800) -- 0:00:57
Average standard deviation of split frequencies: 0.027069
135500 -- (-631.424) (-629.382) [-629.744] (-629.895) * (-628.862) (-632.966) (-629.778) [-630.046] -- 0:00:57
136000 -- (-631.474) (-628.591) [-631.023] (-631.110) * (-631.307) (-629.994) (-633.116) [-629.270] -- 0:00:57
136500 -- (-632.206) [-634.249] (-637.599) (-631.486) * (-631.471) (-629.989) [-637.825] (-629.850) -- 0:00:56
137000 -- [-632.180] (-632.669) (-636.627) (-631.646) * (-633.870) (-628.920) (-629.480) [-631.170] -- 0:00:56
137500 -- (-629.724) (-630.047) [-631.928] (-630.449) * (-636.393) [-629.459] (-629.396) (-629.325) -- 0:00:56
138000 -- (-629.461) [-629.765] (-633.410) (-630.549) * [-631.964] (-629.700) (-630.431) (-632.630) -- 0:00:56
138500 -- [-630.605] (-630.500) (-632.020) (-630.675) * (-633.782) [-630.550] (-630.316) (-631.794) -- 0:00:55
139000 -- (-631.869) [-632.394] (-634.153) (-629.990) * (-633.046) [-630.787] (-630.940) (-633.540) -- 0:00:55
139500 -- (-633.375) (-632.545) [-630.575] (-629.284) * (-631.265) (-629.548) (-636.668) [-633.536] -- 0:00:55
140000 -- [-630.794] (-631.252) (-630.859) (-629.123) * (-631.622) [-629.348] (-632.886) (-630.809) -- 0:00:55
Average standard deviation of split frequencies: 0.021448
140500 -- [-629.406] (-634.829) (-632.629) (-629.638) * (-630.918) [-630.070] (-635.778) (-629.686) -- 0:00:55
141000 -- [-629.385] (-630.572) (-631.115) (-628.946) * (-635.490) (-630.990) (-630.718) [-629.211] -- 0:00:54
141500 -- [-629.397] (-632.463) (-629.710) (-629.496) * (-629.533) [-631.798] (-629.277) (-630.389) -- 0:00:54
142000 -- (-634.742) (-638.792) (-629.117) [-632.907] * (-631.958) (-637.343) (-630.030) [-630.070] -- 0:00:54
142500 -- (-634.606) (-633.268) (-629.547) [-629.297] * (-629.222) (-629.690) [-629.389] (-629.309) -- 0:00:54
143000 -- (-631.144) (-633.164) [-630.660] (-630.868) * (-628.838) (-629.419) [-629.180] (-630.631) -- 0:00:53
143500 -- (-633.736) [-631.413] (-629.447) (-631.104) * [-630.392] (-634.231) (-633.323) (-630.499) -- 0:00:53
144000 -- (-629.545) [-632.461] (-630.878) (-631.373) * (-629.970) (-632.337) (-633.831) [-631.969] -- 0:00:53
144500 -- (-633.751) (-632.024) (-630.062) [-630.216] * (-630.632) [-632.278] (-631.347) (-634.263) -- 0:00:53
145000 -- (-629.400) (-632.482) [-629.853] (-631.702) * (-629.962) [-631.087] (-630.372) (-631.558) -- 0:00:53
Average standard deviation of split frequencies: 0.022440
145500 -- (-630.229) (-635.208) (-634.101) [-629.748] * (-631.302) (-631.657) (-631.464) [-631.598] -- 0:00:52
146000 -- (-630.061) (-631.740) (-629.795) [-631.027] * [-630.980] (-629.235) (-629.399) (-630.689) -- 0:00:52
146500 -- (-633.553) (-633.859) (-632.755) [-631.478] * (-630.293) [-629.892] (-634.050) (-636.562) -- 0:00:52
147000 -- (-632.499) [-630.074] (-630.411) (-629.700) * [-631.010] (-629.729) (-629.124) (-638.020) -- 0:00:52
147500 -- (-632.031) (-629.586) [-633.090] (-635.344) * (-635.241) (-630.584) (-630.304) [-633.787] -- 0:00:52
148000 -- (-629.582) [-629.388] (-629.329) (-630.639) * (-631.299) [-634.191] (-630.159) (-628.867) -- 0:00:51
148500 -- (-632.188) (-629.326) [-633.317] (-633.074) * (-633.053) (-635.526) (-632.686) [-629.014] -- 0:00:51
149000 -- (-632.372) (-629.613) [-630.262] (-630.452) * (-630.954) (-632.078) (-632.545) [-632.686] -- 0:00:51
149500 -- (-632.136) (-630.122) (-634.305) [-629.905] * (-630.668) (-630.824) (-629.753) [-631.587] -- 0:00:51
150000 -- (-631.880) (-630.726) [-629.775] (-632.793) * (-630.450) (-631.826) [-630.130] (-631.165) -- 0:00:51
Average standard deviation of split frequencies: 0.021589
150500 -- (-630.338) [-628.949] (-630.033) (-634.736) * (-632.124) (-632.463) (-632.187) [-631.570] -- 0:00:56
151000 -- (-630.390) (-628.883) (-632.169) [-632.234] * (-629.780) (-636.608) [-630.407] (-631.469) -- 0:00:56
151500 -- (-629.772) [-631.420] (-630.773) (-639.171) * [-631.652] (-631.215) (-634.827) (-633.480) -- 0:00:56
152000 -- (-630.838) [-633.632] (-629.823) (-639.125) * [-629.767] (-632.253) (-633.976) (-629.269) -- 0:00:55
152500 -- (-630.044) (-632.485) [-630.235] (-636.600) * [-628.884] (-633.080) (-632.325) (-632.214) -- 0:00:55
153000 -- (-629.980) (-632.014) [-634.079] (-630.880) * (-629.540) (-633.058) (-629.153) [-633.421] -- 0:00:55
153500 -- (-632.972) [-632.157] (-630.531) (-631.326) * (-631.861) (-629.442) [-630.513] (-633.232) -- 0:00:55
154000 -- (-631.665) (-633.977) (-629.913) [-634.037] * (-632.568) [-634.362] (-629.424) (-632.168) -- 0:00:54
154500 -- (-629.931) (-630.559) (-630.110) [-630.312] * (-632.561) [-631.103] (-629.478) (-639.749) -- 0:00:54
155000 -- (-630.378) (-631.874) [-630.972] (-631.553) * (-633.156) [-628.746] (-632.068) (-629.760) -- 0:00:54
Average standard deviation of split frequencies: 0.019721
155500 -- (-630.735) (-633.044) [-629.855] (-629.973) * [-634.813] (-629.329) (-630.784) (-629.837) -- 0:00:54
156000 -- (-631.547) (-629.198) [-630.037] (-629.054) * (-628.831) (-632.942) (-641.609) [-629.928] -- 0:00:54
156500 -- (-630.928) (-630.183) (-631.710) [-628.962] * (-629.950) [-629.813] (-631.759) (-635.003) -- 0:00:53
157000 -- (-630.116) (-629.793) [-629.933] (-629.903) * (-631.781) (-629.166) [-636.907] (-631.559) -- 0:00:53
157500 -- (-631.715) (-630.485) [-630.431] (-632.440) * [-631.570] (-632.130) (-634.945) (-632.080) -- 0:00:53
158000 -- (-632.121) [-631.328] (-632.299) (-629.200) * (-637.072) (-632.546) (-630.545) [-635.778] -- 0:00:53
158500 -- (-634.104) (-630.939) (-631.344) [-628.656] * (-631.072) (-632.484) [-628.914] (-632.611) -- 0:00:53
159000 -- (-630.889) [-630.276] (-630.215) (-630.633) * (-632.546) [-632.710] (-629.445) (-630.888) -- 0:00:52
159500 -- [-629.275] (-630.619) (-629.090) (-630.478) * (-629.409) [-629.719] (-630.742) (-630.239) -- 0:00:52
160000 -- (-629.789) (-629.436) [-630.886] (-630.875) * (-630.667) (-632.130) [-630.702] (-633.702) -- 0:00:52
Average standard deviation of split frequencies: 0.017751
160500 -- (-629.398) [-631.343] (-635.777) (-630.994) * (-631.914) (-630.770) [-628.819] (-630.116) -- 0:00:52
161000 -- (-630.436) [-630.809] (-636.036) (-632.126) * [-629.152] (-629.758) (-631.115) (-630.342) -- 0:00:52
161500 -- [-632.306] (-633.962) (-631.143) (-629.715) * (-633.519) (-630.568) [-631.477] (-632.010) -- 0:00:51
162000 -- (-631.048) (-629.828) [-629.832] (-630.049) * (-630.136) [-630.978] (-631.582) (-630.082) -- 0:00:51
162500 -- (-630.154) (-634.427) [-630.658] (-629.146) * (-632.035) (-629.385) (-631.235) [-629.772] -- 0:00:51
163000 -- (-634.188) (-632.333) (-631.490) [-630.476] * [-636.469] (-632.301) (-630.790) (-630.625) -- 0:00:51
163500 -- (-632.396) (-629.375) (-629.763) [-629.994] * (-632.688) (-632.813) [-633.018] (-632.831) -- 0:00:51
164000 -- (-630.844) (-633.360) (-631.448) [-633.630] * (-630.597) (-630.682) (-630.378) [-629.896] -- 0:00:50
164500 -- (-629.194) (-631.874) (-635.227) [-631.797] * (-630.840) (-636.364) [-631.378] (-629.740) -- 0:00:50
165000 -- (-629.370) (-632.131) [-638.423] (-628.733) * (-634.038) [-632.626] (-629.500) (-633.920) -- 0:00:50
Average standard deviation of split frequencies: 0.018774
165500 -- (-630.070) (-633.146) [-637.951] (-630.187) * (-635.009) (-630.527) (-628.813) [-631.799] -- 0:00:50
166000 -- [-630.385] (-631.900) (-631.771) (-630.914) * (-629.438) [-629.298] (-628.872) (-631.923) -- 0:00:50
166500 -- (-630.512) (-630.342) (-633.579) [-629.405] * (-629.083) (-629.812) [-628.730] (-631.687) -- 0:00:50
167000 -- (-629.740) (-629.077) [-630.455] (-629.405) * (-631.102) (-630.254) [-632.052] (-633.684) -- 0:00:49
167500 -- (-629.297) [-630.958] (-630.096) (-630.644) * (-633.689) (-630.158) (-635.491) [-629.252] -- 0:00:54
168000 -- (-630.686) [-630.349] (-628.714) (-629.975) * (-629.560) (-629.132) (-634.405) [-629.735] -- 0:00:54
168500 -- (-630.376) (-628.424) [-629.782] (-629.656) * (-637.599) (-631.404) [-631.091] (-630.094) -- 0:00:54
169000 -- (-629.480) (-631.141) (-629.889) [-632.743] * [-631.926] (-629.098) (-631.116) (-629.902) -- 0:00:54
169500 -- [-634.161] (-630.402) (-629.083) (-630.124) * [-630.408] (-632.912) (-630.033) (-629.862) -- 0:00:53
170000 -- [-630.569] (-629.527) (-629.427) (-632.326) * (-628.751) [-631.777] (-636.240) (-630.027) -- 0:00:53
Average standard deviation of split frequencies: 0.020472
170500 -- (-631.377) (-631.798) (-630.455) [-632.564] * [-630.488] (-631.991) (-633.932) (-631.166) -- 0:00:53
171000 -- (-633.829) (-629.790) [-630.243] (-632.682) * (-631.334) [-630.383] (-630.275) (-631.485) -- 0:00:53
171500 -- (-629.910) (-633.875) [-630.353] (-631.265) * (-631.801) (-633.179) (-630.091) [-633.235] -- 0:00:53
172000 -- (-632.901) (-632.104) [-629.023] (-632.421) * (-631.711) (-635.304) (-629.748) [-630.922] -- 0:00:52
172500 -- [-628.987] (-630.045) (-629.008) (-631.502) * (-630.431) [-631.827] (-630.847) (-630.578) -- 0:00:52
173000 -- [-630.416] (-628.863) (-630.342) (-632.658) * (-628.746) [-635.139] (-630.606) (-636.210) -- 0:00:52
173500 -- (-630.139) [-629.853] (-632.522) (-632.278) * (-630.195) (-630.602) (-631.067) [-633.031] -- 0:00:52
174000 -- (-631.793) (-630.699) (-637.473) [-630.778] * (-630.371) (-631.408) [-628.958] (-631.237) -- 0:00:52
174500 -- [-630.864] (-629.799) (-629.855) (-631.954) * (-631.321) (-640.623) (-631.105) [-632.021] -- 0:00:52
175000 -- (-632.130) [-630.694] (-631.279) (-631.856) * (-632.543) (-636.073) [-629.366] (-629.915) -- 0:00:51
Average standard deviation of split frequencies: 0.018005
175500 -- [-631.375] (-629.608) (-631.523) (-629.918) * (-630.609) [-632.124] (-630.934) (-629.908) -- 0:00:51
176000 -- (-631.246) (-632.409) (-631.073) [-631.271] * [-630.376] (-632.280) (-629.035) (-631.510) -- 0:00:51
176500 -- [-630.626] (-630.078) (-629.468) (-635.930) * (-630.963) (-628.959) [-631.727] (-630.044) -- 0:00:51
177000 -- [-630.276] (-630.311) (-629.083) (-633.896) * (-630.937) (-632.377) (-630.764) [-630.201] -- 0:00:51
177500 -- [-631.771] (-631.034) (-629.695) (-632.816) * (-629.191) (-632.612) (-631.468) [-630.683] -- 0:00:50
178000 -- (-631.491) (-628.698) (-632.944) [-633.078] * (-629.785) (-629.974) (-631.219) [-633.285] -- 0:00:50
178500 -- (-631.807) (-632.935) [-632.331] (-635.509) * (-630.133) [-630.304] (-629.800) (-633.842) -- 0:00:50
179000 -- (-630.675) [-631.513] (-631.109) (-632.877) * (-632.649) (-630.719) [-633.166] (-632.260) -- 0:00:50
179500 -- [-629.407] (-629.333) (-629.408) (-633.190) * (-633.183) (-631.850) (-629.321) [-629.587] -- 0:00:50
180000 -- (-629.468) (-629.323) (-629.054) [-630.235] * (-630.010) [-631.146] (-631.293) (-630.450) -- 0:00:50
Average standard deviation of split frequencies: 0.018700
180500 -- (-629.056) (-631.094) [-629.015] (-629.532) * (-629.436) [-631.464] (-629.276) (-630.949) -- 0:00:49
181000 -- (-632.227) (-634.842) [-631.988] (-631.616) * (-630.773) (-631.477) (-630.020) [-629.632] -- 0:00:49
181500 -- (-631.344) (-630.225) [-628.414] (-632.835) * (-633.162) [-629.342] (-629.781) (-632.067) -- 0:00:49
182000 -- (-632.814) (-630.021) [-629.800] (-630.051) * [-629.862] (-629.930) (-631.126) (-630.858) -- 0:00:49
182500 -- (-631.001) (-629.756) [-630.588] (-630.396) * [-632.499] (-629.684) (-631.032) (-634.005) -- 0:00:49
183000 -- (-631.245) [-628.953] (-634.917) (-633.277) * [-631.796] (-629.656) (-629.857) (-632.065) -- 0:00:49
183500 -- (-631.804) (-630.970) (-632.246) [-631.293] * (-635.801) (-631.689) [-632.111] (-632.878) -- 0:00:48
184000 -- [-629.791] (-631.856) (-629.759) (-632.603) * [-629.908] (-631.193) (-629.465) (-633.038) -- 0:00:48
184500 -- (-632.849) (-629.492) (-632.632) [-630.942] * (-630.714) [-629.823] (-628.735) (-630.878) -- 0:00:53
185000 -- (-632.239) (-629.168) (-632.220) [-631.229] * [-629.126] (-633.312) (-631.068) (-631.250) -- 0:00:52
Average standard deviation of split frequencies: 0.017207
185500 -- (-632.944) [-630.080] (-630.892) (-633.374) * [-629.145] (-633.013) (-630.660) (-629.635) -- 0:00:52
186000 -- [-631.748] (-630.059) (-630.411) (-632.970) * (-632.631) (-631.687) [-630.273] (-629.495) -- 0:00:52
186500 -- (-633.156) (-630.730) (-631.865) [-632.266] * (-630.496) (-635.381) [-630.478] (-630.469) -- 0:00:52
187000 -- (-629.611) [-629.247] (-629.461) (-635.904) * (-629.997) [-635.972] (-631.619) (-630.540) -- 0:00:52
187500 -- (-635.066) (-631.612) (-629.693) [-631.375] * [-633.080] (-631.278) (-629.560) (-631.143) -- 0:00:52
188000 -- (-633.059) (-630.457) (-629.449) [-631.243] * (-633.396) (-631.339) [-630.115] (-631.652) -- 0:00:51
188500 -- (-634.999) [-631.386] (-634.201) (-629.810) * (-633.513) [-635.015] (-631.580) (-632.742) -- 0:00:51
189000 -- (-630.358) [-629.342] (-632.210) (-628.858) * (-629.947) (-632.710) [-632.433] (-630.400) -- 0:00:51
189500 -- [-629.364] (-630.391) (-633.010) (-631.102) * (-632.482) (-632.350) (-633.422) [-630.759] -- 0:00:51
190000 -- (-630.785) [-629.853] (-632.011) (-634.344) * (-629.726) (-632.339) (-635.142) [-632.705] -- 0:00:51
Average standard deviation of split frequencies: 0.015933
190500 -- [-632.853] (-631.376) (-633.322) (-635.035) * (-631.513) (-634.364) (-635.700) [-637.182] -- 0:00:50
191000 -- (-632.044) [-629.604] (-631.576) (-632.953) * [-631.125] (-631.264) (-630.654) (-631.134) -- 0:00:50
191500 -- (-632.733) (-629.684) [-633.802] (-629.799) * [-634.807] (-631.443) (-631.948) (-631.418) -- 0:00:50
192000 -- (-631.487) [-629.849] (-630.140) (-630.973) * [-636.188] (-630.949) (-633.788) (-633.886) -- 0:00:50
192500 -- [-628.971] (-631.224) (-630.960) (-631.193) * (-630.437) (-629.126) [-631.440] (-633.567) -- 0:00:50
193000 -- (-628.961) (-631.874) [-629.808] (-631.220) * [-630.308] (-629.597) (-630.257) (-631.186) -- 0:00:50
193500 -- (-634.743) [-630.353] (-633.810) (-630.353) * (-633.186) [-634.861] (-629.014) (-633.688) -- 0:00:50
194000 -- (-635.218) (-631.843) [-633.372] (-633.309) * [-629.001] (-629.938) (-629.510) (-630.068) -- 0:00:49
194500 -- [-630.362] (-636.121) (-630.182) (-628.748) * (-630.784) (-628.733) (-632.526) [-633.133] -- 0:00:49
195000 -- (-635.291) (-631.566) (-635.481) [-631.922] * (-630.036) [-629.997] (-636.269) (-632.799) -- 0:00:49
Average standard deviation of split frequencies: 0.014714
195500 -- (-633.630) [-630.897] (-630.091) (-632.877) * (-635.210) (-633.414) [-631.468] (-632.207) -- 0:00:49
196000 -- [-632.118] (-631.348) (-630.336) (-629.067) * [-629.396] (-632.191) (-630.764) (-631.725) -- 0:00:49
196500 -- (-630.859) [-630.345] (-631.319) (-630.084) * (-632.919) (-632.559) (-629.819) [-631.203] -- 0:00:49
197000 -- [-630.086] (-631.459) (-629.929) (-631.294) * [-629.690] (-633.637) (-630.632) (-631.726) -- 0:00:48
197500 -- (-630.928) (-632.153) [-630.023] (-633.486) * (-633.874) (-631.897) (-630.158) [-631.773] -- 0:00:48
198000 -- (-632.908) (-631.165) (-629.033) [-632.743] * (-631.655) (-632.641) (-630.643) [-631.669] -- 0:00:48
198500 -- (-631.425) (-629.849) [-629.474] (-630.446) * (-631.634) (-629.930) (-630.823) [-635.254] -- 0:00:48
199000 -- (-629.579) [-632.260] (-630.564) (-628.920) * (-633.034) [-632.932] (-632.535) (-634.457) -- 0:00:48
199500 -- (-630.980) (-629.463) (-630.593) [-630.620] * [-631.334] (-631.988) (-631.437) (-633.129) -- 0:00:48
200000 -- (-631.362) (-629.225) (-631.812) [-629.490] * [-630.688] (-631.984) (-629.589) (-632.584) -- 0:00:48
Average standard deviation of split frequencies: 0.014786
200500 -- [-629.041] (-630.049) (-631.535) (-628.751) * (-629.629) [-633.938] (-629.838) (-629.038) -- 0:00:47
201000 -- (-630.611) (-629.404) [-629.920] (-628.963) * (-631.483) [-630.907] (-632.804) (-629.631) -- 0:00:47
201500 -- (-630.890) (-630.041) (-631.817) [-629.582] * (-630.885) (-628.521) [-633.128] (-632.283) -- 0:00:51
202000 -- [-631.521] (-637.693) (-637.501) (-632.838) * (-630.941) (-628.474) (-630.998) [-630.673] -- 0:00:51
202500 -- (-633.456) (-629.837) [-630.354] (-631.908) * (-629.801) (-632.532) [-631.825] (-632.133) -- 0:00:51
203000 -- (-629.822) (-629.983) (-629.479) [-629.760] * (-629.734) [-629.426] (-632.792) (-630.914) -- 0:00:51
203500 -- [-630.197] (-630.986) (-630.547) (-631.029) * [-630.448] (-630.827) (-631.320) (-629.555) -- 0:00:50
204000 -- (-630.168) (-633.396) [-630.259] (-629.821) * (-633.490) (-640.622) (-632.109) [-631.458] -- 0:00:50
204500 -- (-629.272) (-633.967) (-632.547) [-628.728] * (-630.994) [-630.245] (-635.420) (-631.478) -- 0:00:50
205000 -- (-631.952) (-634.321) [-629.148] (-633.415) * [-630.548] (-630.360) (-632.924) (-633.284) -- 0:00:50
Average standard deviation of split frequencies: 0.014134
205500 -- [-628.541] (-632.406) (-630.280) (-630.587) * (-631.337) [-629.803] (-636.327) (-631.070) -- 0:00:50
206000 -- (-632.719) [-631.999] (-629.766) (-629.586) * (-644.593) (-629.301) [-631.474] (-629.485) -- 0:00:50
206500 -- (-634.034) (-631.722) (-631.997) [-629.186] * (-636.069) [-628.722] (-638.895) (-632.064) -- 0:00:49
207000 -- (-629.914) [-629.342] (-636.410) (-629.678) * [-628.743] (-631.879) (-633.127) (-631.898) -- 0:00:49
207500 -- (-632.707) (-630.233) (-633.153) [-628.952] * (-630.669) [-632.809] (-633.482) (-630.977) -- 0:00:49
208000 -- [-630.356] (-630.283) (-630.583) (-628.729) * (-629.699) (-630.794) [-630.783] (-630.412) -- 0:00:49
208500 -- (-633.868) (-629.084) [-631.312] (-631.356) * [-629.579] (-630.444) (-630.459) (-630.559) -- 0:00:49
209000 -- (-629.236) [-633.479] (-630.411) (-630.837) * (-630.492) (-633.812) [-634.093] (-632.330) -- 0:00:49
209500 -- (-629.247) (-630.779) [-632.626] (-633.224) * [-630.696] (-635.041) (-631.062) (-630.433) -- 0:00:49
210000 -- (-630.824) (-630.297) (-632.057) [-630.635] * (-629.939) (-632.343) (-629.457) [-631.187] -- 0:00:48
Average standard deviation of split frequencies: 0.013426
210500 -- (-636.185) (-631.003) (-631.779) [-629.351] * (-631.279) [-630.741] (-632.769) (-630.151) -- 0:00:48
211000 -- (-633.881) (-628.823) [-632.145] (-629.074) * [-630.738] (-632.781) (-632.269) (-629.564) -- 0:00:48
211500 -- (-631.389) (-632.235) (-630.599) [-629.255] * (-630.667) (-632.014) (-630.620) [-629.147] -- 0:00:48
212000 -- (-629.870) (-630.529) [-628.961] (-629.091) * [-629.742] (-631.369) (-631.759) (-629.480) -- 0:00:48
212500 -- (-630.233) (-632.700) [-635.230] (-632.382) * (-631.661) [-632.311] (-630.282) (-631.024) -- 0:00:48
213000 -- (-630.375) [-630.333] (-631.983) (-631.892) * (-629.422) (-631.591) (-628.792) [-629.320] -- 0:00:48
213500 -- (-629.683) [-629.737] (-631.368) (-631.513) * (-631.828) (-631.250) [-629.597] (-630.123) -- 0:00:47
214000 -- [-630.012] (-636.828) (-631.714) (-630.176) * [-630.104] (-631.195) (-630.806) (-632.058) -- 0:00:47
214500 -- (-632.613) (-632.719) (-635.357) [-633.296] * (-632.085) (-630.178) [-628.973] (-631.803) -- 0:00:47
215000 -- [-630.150] (-629.826) (-634.712) (-633.039) * (-631.459) (-631.450) [-634.984] (-631.275) -- 0:00:47
Average standard deviation of split frequencies: 0.012838
215500 -- (-629.068) [-629.988] (-633.522) (-634.098) * (-633.514) [-629.166] (-632.564) (-630.770) -- 0:00:47
216000 -- (-631.320) (-634.712) (-634.711) [-630.055] * (-633.312) [-633.461] (-630.199) (-632.381) -- 0:00:47
216500 -- [-631.101] (-631.861) (-630.077) (-629.581) * (-632.806) (-630.257) [-630.647] (-631.430) -- 0:00:47
217000 -- (-630.986) (-629.733) [-631.159] (-635.336) * (-635.263) [-630.845] (-629.939) (-629.789) -- 0:00:46
217500 -- (-630.233) (-629.504) [-629.298] (-634.988) * (-639.687) (-629.865) (-629.958) [-631.510] -- 0:00:46
218000 -- (-630.650) (-630.068) (-630.851) [-631.652] * (-635.737) (-628.988) (-632.080) [-631.417] -- 0:00:46
218500 -- (-629.514) [-630.810] (-631.390) (-630.437) * (-631.918) [-629.430] (-629.760) (-630.808) -- 0:00:50
219000 -- (-629.480) (-631.190) (-629.440) [-629.962] * (-631.380) (-629.312) [-631.410] (-632.152) -- 0:00:49
219500 -- (-629.636) (-630.538) (-630.899) [-630.512] * (-629.646) (-631.561) (-631.197) [-635.550] -- 0:00:49
220000 -- (-631.846) (-632.262) [-629.143] (-629.446) * (-629.648) [-633.002] (-629.970) (-629.297) -- 0:00:49
Average standard deviation of split frequencies: 0.012315
220500 -- (-631.488) (-630.609) [-630.448] (-635.020) * (-631.153) [-630.669] (-628.556) (-630.959) -- 0:00:49
221000 -- (-631.913) [-629.634] (-628.891) (-631.678) * [-630.102] (-634.055) (-629.239) (-629.644) -- 0:00:49
221500 -- (-632.840) (-628.782) [-628.696] (-629.598) * (-630.277) (-630.159) [-630.746] (-631.807) -- 0:00:49
222000 -- (-632.795) (-629.528) [-631.740] (-629.312) * [-629.699] (-633.153) (-630.767) (-634.300) -- 0:00:49
222500 -- (-633.384) [-630.360] (-629.285) (-629.653) * [-632.150] (-631.756) (-631.170) (-638.967) -- 0:00:48
223000 -- (-631.709) [-628.769] (-629.587) (-634.143) * (-632.420) [-628.865] (-632.343) (-634.467) -- 0:00:48
223500 -- (-630.616) [-630.304] (-629.715) (-633.216) * (-629.467) [-630.619] (-629.525) (-635.484) -- 0:00:48
224000 -- (-630.119) (-631.052) (-629.607) [-630.550] * (-631.802) (-631.989) (-631.593) [-630.228] -- 0:00:48
224500 -- [-629.997] (-629.327) (-629.588) (-629.878) * (-631.660) (-633.633) (-629.112) [-630.530] -- 0:00:48
225000 -- [-629.395] (-629.753) (-630.535) (-629.584) * (-630.569) (-631.777) [-629.978] (-638.429) -- 0:00:48
Average standard deviation of split frequencies: 0.011902
225500 -- (-630.384) (-630.158) (-629.273) [-629.802] * [-631.483] (-630.891) (-630.121) (-635.844) -- 0:00:48
226000 -- (-630.581) [-630.270] (-630.301) (-633.498) * (-629.716) [-633.942] (-631.395) (-630.174) -- 0:00:47
226500 -- (-633.868) (-631.196) [-632.129] (-632.932) * [-630.727] (-630.578) (-628.765) (-630.239) -- 0:00:47
227000 -- (-631.984) (-631.296) [-629.720] (-629.952) * (-631.049) (-630.018) (-630.524) [-630.942] -- 0:00:47
227500 -- (-643.813) (-632.681) (-629.502) [-630.506] * (-633.703) [-632.097] (-632.092) (-629.243) -- 0:00:47
228000 -- (-630.736) (-630.484) [-629.944] (-629.354) * (-629.690) (-630.759) [-631.502] (-630.121) -- 0:00:47
228500 -- (-633.515) (-630.826) [-630.649] (-629.441) * (-630.693) (-634.449) (-632.768) [-630.480] -- 0:00:47
229000 -- (-633.845) (-631.719) [-629.776] (-633.416) * (-631.348) (-632.699) (-628.914) [-630.411] -- 0:00:47
229500 -- (-629.741) (-632.038) [-632.127] (-632.809) * [-632.695] (-631.889) (-631.410) (-633.852) -- 0:00:47
230000 -- [-629.795] (-630.862) (-629.530) (-629.861) * (-630.251) [-630.938] (-634.699) (-629.646) -- 0:00:46
Average standard deviation of split frequencies: 0.011420
230500 -- (-630.802) (-629.875) [-628.666] (-631.759) * (-630.598) (-629.438) (-630.594) [-631.380] -- 0:00:46
231000 -- (-630.523) (-631.238) (-629.890) [-633.958] * [-636.867] (-628.867) (-630.884) (-629.856) -- 0:00:46
231500 -- (-630.922) [-630.988] (-630.715) (-633.135) * (-632.241) (-630.547) (-629.286) [-629.849] -- 0:00:46
232000 -- (-632.996) (-629.268) (-630.988) [-631.849] * [-629.384] (-632.664) (-629.076) (-629.873) -- 0:00:46
232500 -- [-633.119] (-630.513) (-629.127) (-632.590) * (-630.985) (-633.646) [-629.649] (-631.864) -- 0:00:46
233000 -- (-632.565) (-630.719) [-629.452] (-630.143) * (-635.736) [-632.005] (-632.890) (-631.600) -- 0:00:46
233500 -- (-630.196) (-631.761) [-630.161] (-632.068) * (-636.489) (-630.437) (-632.546) [-629.969] -- 0:00:45
234000 -- [-630.083] (-630.483) (-631.920) (-632.819) * (-637.847) [-634.796] (-630.917) (-629.586) -- 0:00:45
234500 -- (-632.268) [-631.855] (-631.198) (-630.678) * (-632.345) (-630.127) [-629.548] (-630.999) -- 0:00:45
235000 -- (-631.909) (-634.493) (-630.962) [-632.760] * [-629.248] (-630.069) (-630.032) (-634.638) -- 0:00:45
Average standard deviation of split frequencies: 0.011750
235500 -- [-630.441] (-629.134) (-630.326) (-633.180) * (-631.634) (-630.772) (-630.751) [-632.788] -- 0:00:48
236000 -- [-632.608] (-629.759) (-630.673) (-631.091) * (-629.487) (-629.223) [-628.627] (-630.577) -- 0:00:48
236500 -- (-633.810) (-631.399) [-630.842] (-633.592) * (-633.997) (-630.855) [-632.842] (-630.949) -- 0:00:48
237000 -- (-635.311) [-631.173] (-629.363) (-633.671) * (-633.235) (-628.987) [-631.044] (-631.168) -- 0:00:48
237500 -- (-629.855) [-630.641] (-630.460) (-628.710) * (-632.170) [-630.719] (-633.032) (-630.696) -- 0:00:48
238000 -- (-636.944) (-632.324) (-635.773) [-630.954] * (-630.518) (-633.605) [-631.761] (-628.755) -- 0:00:48
238500 -- (-632.455) [-630.527] (-630.961) (-630.327) * [-628.934] (-629.857) (-633.569) (-629.239) -- 0:00:47
239000 -- (-631.557) [-630.727] (-629.874) (-630.817) * (-629.074) [-629.987] (-636.078) (-632.071) -- 0:00:47
239500 -- [-629.094] (-629.804) (-629.528) (-632.938) * [-634.146] (-635.801) (-631.584) (-632.794) -- 0:00:47
240000 -- [-628.961] (-630.841) (-631.055) (-630.473) * (-633.497) (-631.256) (-631.610) [-632.407] -- 0:00:47
Average standard deviation of split frequencies: 0.010283
240500 -- (-630.797) (-632.464) (-629.864) [-634.544] * [-630.992] (-630.783) (-634.147) (-632.923) -- 0:00:47
241000 -- (-628.648) [-631.696] (-628.929) (-631.942) * (-630.379) [-629.840] (-634.259) (-635.747) -- 0:00:47
241500 -- [-630.156] (-629.436) (-630.151) (-631.919) * (-632.869) [-631.222] (-630.632) (-632.951) -- 0:00:47
242000 -- (-630.558) (-629.420) [-632.223] (-632.470) * [-632.978] (-631.849) (-629.928) (-631.308) -- 0:00:46
242500 -- (-635.662) [-630.254] (-633.601) (-636.533) * (-630.290) (-630.231) [-630.753] (-631.215) -- 0:00:46
243000 -- (-631.850) (-630.812) (-636.435) [-632.040] * (-633.779) (-630.496) [-630.980] (-629.820) -- 0:00:46
243500 -- [-632.861] (-629.204) (-636.625) (-633.108) * (-630.620) (-629.610) [-629.691] (-630.618) -- 0:00:46
244000 -- (-631.389) [-629.901] (-633.191) (-632.900) * (-630.299) [-631.870] (-633.370) (-634.554) -- 0:00:46
244500 -- [-632.134] (-633.066) (-630.583) (-632.084) * [-629.798] (-629.808) (-631.474) (-629.337) -- 0:00:46
245000 -- (-631.704) (-631.507) [-633.257] (-634.175) * (-633.055) [-632.833] (-631.673) (-629.210) -- 0:00:46
Average standard deviation of split frequencies: 0.010540
245500 -- (-633.787) (-634.539) (-630.385) [-632.147] * (-629.820) (-629.303) [-630.435] (-631.624) -- 0:00:46
246000 -- (-632.462) (-632.697) [-629.460] (-631.462) * (-634.455) (-631.655) [-633.605] (-631.644) -- 0:00:45
246500 -- (-631.922) [-631.386] (-630.222) (-629.822) * (-631.780) (-629.958) (-637.754) [-630.298] -- 0:00:45
247000 -- (-632.475) (-630.657) [-631.321] (-628.985) * [-628.759] (-630.302) (-630.810) (-630.316) -- 0:00:45
247500 -- (-635.584) (-629.681) [-630.542] (-632.611) * (-630.643) (-635.079) [-628.888] (-629.932) -- 0:00:45
248000 -- (-632.927) [-629.663] (-631.420) (-631.061) * (-631.784) (-631.812) (-632.050) [-628.873] -- 0:00:45
248500 -- (-630.911) [-629.807] (-636.017) (-629.055) * [-630.779] (-632.507) (-635.374) (-630.968) -- 0:00:45
249000 -- (-629.836) (-632.158) (-630.216) [-629.928] * (-630.106) (-632.309) (-631.030) [-630.541] -- 0:00:45
249500 -- (-630.661) (-630.760) [-631.947] (-632.953) * [-630.033] (-633.419) (-630.838) (-637.325) -- 0:00:45
250000 -- (-633.282) (-630.409) [-629.866] (-634.243) * [-630.358] (-631.521) (-631.064) (-634.985) -- 0:00:45
Average standard deviation of split frequencies: 0.010226
250500 -- [-634.245] (-629.293) (-633.416) (-632.107) * [-629.065] (-631.237) (-630.632) (-631.001) -- 0:00:44
251000 -- (-636.041) (-631.766) [-633.606] (-635.007) * [-629.678] (-633.367) (-632.189) (-634.371) -- 0:00:44
251500 -- [-630.303] (-630.874) (-630.139) (-632.356) * (-629.597) [-631.403] (-630.939) (-632.792) -- 0:00:44
252000 -- (-629.084) [-630.748] (-630.504) (-630.507) * (-630.559) (-635.229) (-629.996) [-631.331] -- 0:00:47
252500 -- (-630.962) (-633.396) [-630.502] (-630.513) * (-629.677) (-633.174) (-630.472) [-637.498] -- 0:00:47
253000 -- [-632.103] (-630.373) (-629.399) (-631.681) * (-630.015) (-631.222) [-631.817] (-634.281) -- 0:00:47
253500 -- (-630.221) [-629.124] (-629.692) (-629.375) * (-630.793) (-630.411) (-631.719) [-630.496] -- 0:00:47
254000 -- (-631.293) [-631.196] (-630.144) (-629.414) * [-630.419] (-630.262) (-630.004) (-632.184) -- 0:00:46
254500 -- [-632.654] (-629.899) (-633.821) (-629.427) * (-631.190) [-631.579] (-630.724) (-631.667) -- 0:00:46
255000 -- (-633.131) (-630.178) [-633.290] (-632.294) * (-631.586) (-632.548) [-629.087] (-632.052) -- 0:00:46
Average standard deviation of split frequencies: 0.010243
255500 -- (-629.223) [-629.899] (-631.220) (-633.394) * (-631.711) [-629.353] (-630.247) (-631.906) -- 0:00:46
256000 -- [-630.957] (-629.538) (-633.167) (-631.860) * (-631.035) (-631.678) [-630.335] (-631.538) -- 0:00:46
256500 -- (-631.542) (-629.168) [-631.006] (-634.819) * [-629.525] (-629.720) (-631.101) (-629.343) -- 0:00:46
257000 -- (-631.194) [-629.723] (-630.077) (-629.835) * [-630.596] (-631.688) (-632.788) (-628.751) -- 0:00:46
257500 -- (-632.932) [-629.777] (-630.724) (-632.822) * (-631.139) (-633.359) (-629.201) [-629.636] -- 0:00:46
258000 -- (-631.700) (-629.869) (-632.811) [-630.059] * (-632.519) (-634.334) (-629.216) [-630.533] -- 0:00:46
258500 -- (-633.260) (-632.239) (-630.145) [-632.014] * (-633.687) [-629.481] (-634.360) (-632.612) -- 0:00:45
259000 -- (-636.263) (-635.213) [-632.138] (-631.886) * (-632.582) [-630.212] (-635.530) (-629.348) -- 0:00:45
259500 -- [-630.299] (-629.656) (-631.802) (-631.651) * (-630.054) [-633.024] (-633.516) (-630.515) -- 0:00:45
260000 -- (-632.431) (-632.736) (-635.826) [-631.259] * (-629.730) [-629.127] (-632.542) (-629.143) -- 0:00:45
Average standard deviation of split frequencies: 0.009607
260500 -- (-630.203) [-632.573] (-630.867) (-634.671) * (-631.268) (-632.973) [-631.462] (-630.998) -- 0:00:45
261000 -- (-630.109) (-631.118) (-630.236) [-629.851] * (-629.885) (-630.864) [-630.729] (-629.826) -- 0:00:45
261500 -- (-632.537) [-630.424] (-631.115) (-629.018) * (-630.664) [-629.503] (-632.725) (-634.617) -- 0:00:45
262000 -- (-632.427) (-631.971) [-628.820] (-630.916) * (-630.372) (-629.708) [-628.870] (-631.274) -- 0:00:45
262500 -- (-632.109) (-631.635) (-628.772) [-631.183] * (-631.336) [-630.724] (-629.172) (-630.366) -- 0:00:44
263000 -- (-630.447) (-636.341) [-629.973] (-629.940) * (-630.764) [-630.799] (-629.438) (-630.084) -- 0:00:44
263500 -- [-630.698] (-631.963) (-631.572) (-630.212) * (-631.097) (-631.734) (-629.073) [-629.321] -- 0:00:44
264000 -- (-630.338) (-629.119) (-628.863) [-632.250] * (-634.429) [-632.009] (-632.024) (-632.496) -- 0:00:44
264500 -- (-629.482) (-628.500) (-631.043) [-629.468] * [-631.429] (-631.768) (-629.148) (-635.566) -- 0:00:44
265000 -- (-628.540) (-630.708) [-631.750] (-629.651) * (-631.940) [-630.000] (-632.427) (-633.692) -- 0:00:44
Average standard deviation of split frequencies: 0.008236
265500 -- (-629.985) [-636.293] (-629.448) (-629.011) * [-630.750] (-630.600) (-631.297) (-630.394) -- 0:00:44
266000 -- (-630.727) (-632.597) [-630.890] (-630.487) * (-630.475) [-633.091] (-632.743) (-630.700) -- 0:00:44
266500 -- (-635.514) (-631.044) (-629.172) [-633.108] * [-628.881] (-636.165) (-630.156) (-633.500) -- 0:00:44
267000 -- (-635.877) (-631.426) [-629.603] (-633.655) * (-629.974) (-629.723) [-630.205] (-631.334) -- 0:00:43
267500 -- [-630.959] (-631.997) (-631.470) (-634.101) * (-632.938) (-629.363) (-630.023) [-631.691] -- 0:00:43
268000 -- (-630.378) (-631.193) [-631.164] (-632.208) * [-630.688] (-629.690) (-629.949) (-629.817) -- 0:00:43
268500 -- [-630.882] (-632.696) (-636.007) (-633.638) * (-636.116) [-632.441] (-633.315) (-629.020) -- 0:00:43
269000 -- (-629.371) [-631.185] (-632.689) (-631.853) * (-631.796) [-631.827] (-632.800) (-630.286) -- 0:00:46
269500 -- [-630.126] (-635.174) (-633.016) (-632.359) * [-629.145] (-632.073) (-633.231) (-629.764) -- 0:00:46
270000 -- (-629.685) (-631.244) (-634.772) [-629.436] * (-630.865) (-631.762) [-630.525] (-630.180) -- 0:00:45
Average standard deviation of split frequencies: 0.007946
270500 -- (-630.772) (-632.096) [-629.448] (-629.924) * (-629.208) (-630.405) (-633.028) [-629.523] -- 0:00:45
271000 -- (-632.653) (-630.134) [-629.337] (-628.585) * (-629.395) [-630.232] (-633.302) (-632.021) -- 0:00:45
271500 -- (-632.945) [-629.322] (-630.316) (-630.002) * (-630.473) (-635.867) (-632.035) [-631.121] -- 0:00:45
272000 -- (-629.410) [-630.006] (-631.150) (-629.939) * (-631.707) (-631.422) [-629.231] (-631.084) -- 0:00:45
272500 -- (-630.773) (-629.421) (-633.207) [-630.632] * (-629.975) [-629.756] (-630.748) (-630.201) -- 0:00:45
273000 -- (-630.550) (-629.747) [-631.946] (-633.667) * (-629.384) [-631.776] (-629.329) (-631.251) -- 0:00:45
273500 -- (-630.175) [-633.518] (-628.736) (-631.035) * (-629.561) (-634.066) [-629.448] (-631.043) -- 0:00:45
274000 -- (-633.051) [-630.547] (-633.391) (-633.981) * [-630.272] (-636.531) (-628.949) (-630.205) -- 0:00:45
274500 -- (-631.937) (-629.193) (-635.872) [-629.723] * (-632.799) (-631.030) (-629.738) [-629.627] -- 0:00:44
275000 -- (-631.590) (-632.224) [-631.051] (-631.393) * (-629.382) (-632.672) [-629.235] (-631.612) -- 0:00:44
Average standard deviation of split frequencies: 0.008220
275500 -- (-633.995) (-632.231) (-630.704) [-633.375] * [-629.362] (-630.929) (-636.245) (-629.821) -- 0:00:44
276000 -- [-634.380] (-631.775) (-630.561) (-632.165) * (-629.897) [-630.228] (-631.396) (-632.401) -- 0:00:44
276500 -- (-632.121) [-630.805] (-630.781) (-631.043) * (-630.222) (-629.403) [-630.133] (-631.002) -- 0:00:44
277000 -- (-636.811) [-630.911] (-634.972) (-632.849) * (-632.041) (-629.011) [-628.689] (-631.677) -- 0:00:44
277500 -- (-631.041) [-630.364] (-630.497) (-629.978) * (-630.502) (-631.128) [-629.535] (-630.789) -- 0:00:44
278000 -- (-631.984) [-630.984] (-630.450) (-630.795) * (-630.505) (-630.983) [-629.395] (-630.780) -- 0:00:44
278500 -- (-628.958) (-632.931) [-629.824] (-631.174) * (-630.685) (-630.614) (-629.458) [-629.965] -- 0:00:44
279000 -- [-629.214] (-631.278) (-630.844) (-630.691) * (-630.166) (-631.664) (-629.029) [-630.160] -- 0:00:43
279500 -- [-629.692] (-632.492) (-631.247) (-632.604) * (-631.518) (-630.436) [-630.454] (-630.696) -- 0:00:43
280000 -- (-630.670) (-636.390) (-630.885) [-632.075] * (-632.936) (-630.571) [-631.994] (-632.107) -- 0:00:43
Average standard deviation of split frequencies: 0.007838
280500 -- (-630.286) [-628.800] (-630.960) (-629.918) * (-629.867) (-631.235) (-633.316) [-631.259] -- 0:00:43
281000 -- [-630.486] (-630.063) (-633.489) (-630.705) * (-633.847) [-629.726] (-631.813) (-628.863) -- 0:00:43
281500 -- [-631.140] (-632.379) (-636.579) (-629.545) * (-633.103) [-631.151] (-629.338) (-629.456) -- 0:00:43
282000 -- (-634.239) (-631.233) (-635.502) [-629.496] * [-630.447] (-629.133) (-629.078) (-631.104) -- 0:00:43
282500 -- [-630.471] (-630.092) (-636.195) (-628.999) * (-629.364) [-629.115] (-631.991) (-630.415) -- 0:00:43
283000 -- [-630.264] (-633.642) (-634.399) (-633.715) * [-629.752] (-630.303) (-630.902) (-631.269) -- 0:00:43
283500 -- (-630.399) (-628.859) [-630.274] (-628.683) * (-630.623) (-631.290) (-635.904) [-631.030] -- 0:00:42
284000 -- (-630.801) (-631.881) [-630.547] (-631.329) * (-630.474) (-634.368) (-634.928) [-629.480] -- 0:00:42
284500 -- (-631.751) (-631.061) [-631.607] (-630.692) * (-631.194) (-630.967) (-630.839) [-632.400] -- 0:00:42
285000 -- [-630.604] (-630.683) (-629.407) (-632.131) * (-629.122) [-633.349] (-630.954) (-631.641) -- 0:00:42
Average standard deviation of split frequencies: 0.008344
285500 -- [-628.745] (-631.159) (-632.951) (-630.630) * (-629.876) [-631.318] (-633.865) (-629.693) -- 0:00:42
286000 -- [-630.037] (-630.360) (-628.936) (-630.208) * (-632.994) [-632.490] (-631.629) (-633.517) -- 0:00:44
286500 -- (-630.513) [-630.645] (-630.350) (-638.901) * (-631.741) [-631.628] (-631.112) (-630.792) -- 0:00:44
287000 -- [-629.178] (-632.510) (-630.450) (-631.523) * (-632.750) (-629.450) (-629.112) [-628.985] -- 0:00:44
287500 -- [-628.981] (-628.998) (-629.474) (-632.321) * (-637.875) (-629.651) (-632.021) [-632.857] -- 0:00:44
288000 -- (-628.821) (-630.006) (-631.577) [-630.467] * (-632.327) [-629.953] (-631.170) (-634.199) -- 0:00:44
288500 -- (-629.696) (-629.371) (-632.155) [-633.729] * (-632.724) (-629.445) (-631.339) [-630.670] -- 0:00:44
289000 -- (-629.326) [-631.907] (-630.882) (-629.444) * [-631.302] (-632.918) (-630.364) (-631.083) -- 0:00:44
289500 -- [-630.671] (-631.578) (-632.127) (-632.629) * (-632.907) (-629.394) (-632.915) [-633.650] -- 0:00:44
290000 -- (-633.175) (-631.011) [-629.255] (-630.366) * (-632.418) (-629.285) [-629.753] (-633.004) -- 0:00:44
Average standard deviation of split frequencies: 0.007906
290500 -- (-632.727) [-630.307] (-630.509) (-628.845) * (-629.930) (-628.726) [-629.333] (-630.261) -- 0:00:43
291000 -- (-629.608) (-631.485) (-630.593) [-629.037] * (-629.906) (-629.452) (-633.204) [-631.031] -- 0:00:43
291500 -- (-631.615) (-632.482) [-632.422] (-629.003) * (-629.900) (-629.941) [-632.014] (-633.775) -- 0:00:43
292000 -- [-630.800] (-632.351) (-629.157) (-632.127) * (-632.071) (-631.434) [-634.614] (-639.514) -- 0:00:43
292500 -- (-632.376) [-634.241] (-631.539) (-629.529) * (-634.174) (-631.706) [-631.755] (-630.720) -- 0:00:43
293000 -- (-631.724) [-630.779] (-632.119) (-632.903) * [-628.610] (-631.611) (-630.229) (-629.487) -- 0:00:43
293500 -- [-631.243] (-630.240) (-629.395) (-629.850) * (-629.884) (-630.971) [-631.775] (-629.205) -- 0:00:43
294000 -- [-633.868] (-635.354) (-630.453) (-629.127) * (-631.642) [-631.056] (-634.168) (-632.817) -- 0:00:43
294500 -- (-630.311) (-632.993) [-633.145] (-629.155) * [-631.534] (-630.704) (-633.843) (-630.185) -- 0:00:43
295000 -- (-630.628) (-631.564) [-633.613] (-629.137) * (-630.916) (-632.618) [-630.232] (-630.049) -- 0:00:43
Average standard deviation of split frequencies: 0.008461
295500 -- (-630.781) [-632.404] (-635.539) (-630.739) * (-632.071) (-631.822) [-630.705] (-629.529) -- 0:00:42
296000 -- (-631.357) (-630.950) [-629.866] (-631.830) * (-631.251) [-629.405] (-630.344) (-630.431) -- 0:00:42
296500 -- (-633.931) (-628.981) [-630.629] (-629.452) * (-631.411) (-632.394) (-633.754) [-629.232] -- 0:00:42
297000 -- (-632.082) [-629.094] (-632.895) (-633.969) * (-630.017) (-631.038) (-633.762) [-629.052] -- 0:00:42
297500 -- (-630.570) (-631.114) (-632.891) [-632.460] * [-628.866] (-630.691) (-629.713) (-631.274) -- 0:00:42
298000 -- (-634.971) (-629.586) (-634.888) [-630.773] * (-629.549) (-630.344) [-629.800] (-631.868) -- 0:00:42
298500 -- (-632.614) (-629.536) (-630.574) [-629.784] * [-631.249] (-631.359) (-631.640) (-629.422) -- 0:00:42
299000 -- (-632.313) [-628.787] (-631.221) (-634.233) * [-633.042] (-634.015) (-630.366) (-629.454) -- 0:00:42
299500 -- [-633.588] (-633.662) (-629.706) (-630.768) * [-632.634] (-631.835) (-630.461) (-631.339) -- 0:00:42
300000 -- (-631.491) (-632.804) (-631.021) [-630.648] * (-630.164) [-631.567] (-630.744) (-632.269) -- 0:00:42
Average standard deviation of split frequencies: 0.007378
300500 -- (-632.672) (-631.143) (-631.285) [-630.666] * (-629.896) (-631.202) [-630.689] (-629.405) -- 0:00:41
301000 -- (-631.465) (-629.717) [-629.402] (-631.074) * (-629.950) (-634.904) [-630.800] (-630.554) -- 0:00:41
301500 -- (-631.323) (-628.988) (-630.019) [-630.788] * (-631.566) [-631.082] (-631.621) (-630.172) -- 0:00:41
302000 -- [-630.792] (-630.801) (-637.506) (-632.115) * (-629.882) (-629.209) [-630.058] (-630.226) -- 0:00:41
302500 -- (-632.446) [-630.749] (-629.978) (-632.646) * (-631.599) [-630.553] (-629.328) (-629.682) -- 0:00:41
303000 -- [-632.373] (-632.305) (-632.934) (-628.949) * (-631.912) (-628.989) (-632.049) [-634.589] -- 0:00:43
303500 -- (-632.769) (-632.278) (-631.662) [-630.789] * (-630.436) [-632.363] (-628.962) (-635.114) -- 0:00:43
304000 -- (-633.174) [-633.819] (-634.026) (-630.228) * (-634.498) [-631.926] (-629.575) (-635.150) -- 0:00:43
304500 -- [-635.455] (-630.104) (-633.257) (-629.867) * (-632.146) (-630.897) (-631.951) [-635.076] -- 0:00:43
305000 -- (-630.225) (-628.935) [-631.841] (-628.991) * (-629.455) (-629.229) (-633.832) [-633.495] -- 0:00:43
Average standard deviation of split frequencies: 0.006978
305500 -- (-629.237) [-629.024] (-631.977) (-631.919) * (-628.971) [-630.152] (-634.044) (-631.745) -- 0:00:43
306000 -- (-630.505) (-633.473) (-630.532) [-629.125] * (-631.370) (-631.510) [-629.000] (-631.792) -- 0:00:43
306500 -- (-629.973) (-632.318) [-632.493] (-628.710) * (-631.449) (-631.404) (-629.162) [-629.665] -- 0:00:42
307000 -- (-630.182) [-628.699] (-632.015) (-630.015) * [-629.699] (-632.430) (-628.964) (-630.530) -- 0:00:42
307500 -- (-629.965) (-629.022) [-631.464] (-629.933) * [-630.591] (-632.721) (-628.868) (-629.343) -- 0:00:42
308000 -- (-632.018) [-630.093] (-633.726) (-629.465) * (-633.807) [-631.807] (-630.186) (-632.144) -- 0:00:42
308500 -- (-628.637) [-630.876] (-633.283) (-630.639) * [-631.854] (-630.247) (-629.632) (-629.253) -- 0:00:42
309000 -- [-630.574] (-631.036) (-629.673) (-630.520) * (-630.768) [-630.688] (-631.364) (-630.390) -- 0:00:42
309500 -- (-630.548) (-634.678) [-631.937] (-631.063) * (-630.694) (-629.314) (-630.338) [-632.730] -- 0:00:42
310000 -- (-630.435) (-631.767) (-632.774) [-630.732] * (-632.777) (-628.567) [-632.970] (-635.267) -- 0:00:42
Average standard deviation of split frequencies: 0.006784
310500 -- (-630.639) (-632.592) (-629.324) [-630.430] * [-629.633] (-630.575) (-630.407) (-634.133) -- 0:00:42
311000 -- (-634.202) (-636.059) [-629.981] (-630.007) * (-629.273) [-631.926] (-631.337) (-631.259) -- 0:00:42
311500 -- (-637.191) (-634.025) [-632.075] (-630.064) * [-630.327] (-632.007) (-632.967) (-629.772) -- 0:00:41
312000 -- (-636.439) (-631.476) [-630.281] (-629.294) * (-630.477) [-629.837] (-630.667) (-631.147) -- 0:00:41
312500 -- (-635.639) [-630.879] (-629.755) (-628.943) * (-629.557) (-629.565) [-631.136] (-630.329) -- 0:00:41
313000 -- (-630.401) (-629.632) (-631.783) [-628.835] * [-629.275] (-633.052) (-630.578) (-631.188) -- 0:00:41
313500 -- [-629.741] (-629.398) (-632.368) (-629.160) * (-630.268) [-629.389] (-631.863) (-632.701) -- 0:00:41
314000 -- [-629.777] (-629.094) (-629.926) (-631.615) * (-630.470) (-631.084) (-629.356) [-630.841] -- 0:00:41
314500 -- (-631.097) [-629.200] (-632.654) (-629.763) * (-633.037) (-633.972) [-628.976] (-633.054) -- 0:00:41
315000 -- (-629.955) (-629.086) (-630.341) [-630.160] * [-631.373] (-630.868) (-633.038) (-629.464) -- 0:00:41
Average standard deviation of split frequencies: 0.006669
315500 -- [-630.465] (-628.810) (-632.255) (-630.261) * (-630.901) (-632.568) [-630.987] (-632.925) -- 0:00:41
316000 -- [-629.043] (-630.739) (-629.883) (-629.138) * [-631.049] (-630.470) (-630.483) (-630.277) -- 0:00:41
316500 -- [-629.354] (-632.545) (-636.230) (-629.619) * (-631.295) [-630.984] (-630.312) (-628.796) -- 0:00:41
317000 -- (-633.210) (-632.493) [-631.316] (-632.265) * (-629.525) [-630.957] (-633.041) (-633.279) -- 0:00:40
317500 -- (-630.308) (-631.279) (-629.326) [-630.882] * (-630.055) (-636.154) [-630.556] (-629.401) -- 0:00:40
318000 -- (-629.291) (-633.296) (-629.704) [-630.774] * (-632.865) [-633.453] (-630.150) (-631.140) -- 0:00:40
318500 -- [-630.801] (-629.874) (-630.719) (-629.980) * (-631.993) (-630.818) (-636.854) [-633.591] -- 0:00:40
319000 -- (-632.185) [-629.812] (-632.338) (-630.402) * (-632.631) (-629.547) (-630.422) [-632.690] -- 0:00:40
319500 -- (-630.509) [-631.523] (-630.361) (-632.444) * [-631.240] (-632.790) (-631.865) (-630.862) -- 0:00:40
320000 -- (-629.812) (-630.384) [-631.313] (-628.776) * (-631.421) (-632.299) [-630.801] (-634.280) -- 0:00:42
Average standard deviation of split frequencies: 0.006156
320500 -- (-630.372) [-631.372] (-632.646) (-628.504) * [-631.735] (-631.089) (-633.345) (-629.336) -- 0:00:42
321000 -- (-630.791) (-632.179) (-631.621) [-632.868] * [-630.156] (-629.362) (-631.316) (-630.353) -- 0:00:42
321500 -- (-631.771) [-630.437] (-629.709) (-630.446) * (-628.708) (-631.135) (-630.380) [-631.387] -- 0:00:42
322000 -- (-630.183) (-631.531) (-629.797) [-629.010] * (-629.021) [-631.407] (-636.800) (-630.998) -- 0:00:42
322500 -- [-630.971] (-632.325) (-633.410) (-632.103) * (-630.816) (-631.824) (-632.463) [-633.013] -- 0:00:42
323000 -- (-629.266) (-630.236) (-632.133) [-628.616] * (-630.006) (-630.818) [-629.158] (-630.221) -- 0:00:41
323500 -- (-629.559) (-629.313) (-632.484) [-630.451] * [-629.024] (-630.474) (-630.541) (-630.397) -- 0:00:41
324000 -- [-629.628] (-629.273) (-631.835) (-628.661) * (-628.761) (-631.563) [-629.719] (-631.430) -- 0:00:41
324500 -- (-630.193) (-631.520) (-633.966) [-629.809] * (-629.604) [-630.500] (-634.465) (-631.845) -- 0:00:41
325000 -- (-629.176) [-628.803] (-630.103) (-632.729) * (-628.633) (-630.212) [-634.184] (-632.463) -- 0:00:41
Average standard deviation of split frequencies: 0.006465
325500 -- (-631.052) [-631.507] (-628.730) (-630.756) * [-630.127] (-629.428) (-630.679) (-632.266) -- 0:00:41
326000 -- (-629.590) (-631.769) (-629.231) [-632.170] * (-630.295) (-630.689) (-629.347) [-631.298] -- 0:00:41
326500 -- (-628.530) [-637.002] (-628.691) (-631.169) * (-629.661) (-632.010) (-629.562) [-631.487] -- 0:00:41
327000 -- (-632.715) (-632.299) (-629.594) [-632.741] * (-628.909) [-631.761] (-629.161) (-629.648) -- 0:00:41
327500 -- [-630.941] (-632.199) (-629.562) (-629.359) * (-631.632) (-632.223) [-629.633] (-631.634) -- 0:00:41
328000 -- [-630.721] (-630.984) (-629.568) (-629.725) * (-632.532) [-630.002] (-629.938) (-631.125) -- 0:00:40
328500 -- [-628.597] (-631.586) (-631.618) (-629.211) * (-631.966) (-629.992) (-630.843) [-630.799] -- 0:00:40
329000 -- (-628.741) (-630.976) [-631.342] (-630.637) * (-631.054) (-630.781) [-630.952] (-632.062) -- 0:00:40
329500 -- (-633.579) [-630.832] (-631.532) (-631.233) * (-630.386) (-630.287) [-629.365] (-631.132) -- 0:00:40
330000 -- (-630.324) (-629.988) [-631.780] (-630.034) * (-628.755) [-629.691] (-630.798) (-629.809) -- 0:00:40
Average standard deviation of split frequencies: 0.006653
330500 -- (-629.812) [-628.906] (-634.034) (-631.123) * (-630.452) (-629.734) [-630.081] (-630.079) -- 0:00:40
331000 -- (-637.422) (-629.588) [-632.382] (-628.592) * [-631.479] (-632.440) (-630.477) (-632.042) -- 0:00:40
331500 -- (-631.832) (-631.324) (-629.490) [-634.791] * [-630.740] (-631.424) (-634.336) (-631.420) -- 0:00:40
332000 -- (-632.204) [-630.264] (-635.807) (-629.971) * (-631.241) (-633.551) (-631.221) [-630.258] -- 0:00:40
332500 -- (-633.005) (-630.289) [-633.083] (-633.726) * (-631.618) (-633.442) (-632.116) [-631.064] -- 0:00:40
333000 -- (-630.046) (-630.767) (-632.136) [-631.606] * (-629.563) [-631.136] (-632.928) (-629.257) -- 0:00:40
333500 -- [-629.659] (-631.116) (-634.764) (-631.733) * [-630.983] (-629.470) (-632.142) (-633.801) -- 0:00:39
334000 -- (-628.658) [-629.700] (-633.878) (-629.333) * (-629.679) (-629.372) (-630.307) [-637.958] -- 0:00:39
334500 -- [-630.709] (-631.475) (-630.528) (-631.797) * (-632.506) [-629.936] (-628.976) (-632.549) -- 0:00:39
335000 -- (-631.865) [-631.280] (-635.095) (-636.213) * [-631.277] (-631.313) (-635.239) (-630.966) -- 0:00:39
Average standard deviation of split frequencies: 0.007510
335500 -- (-631.861) [-632.950] (-630.582) (-630.374) * [-632.916] (-631.924) (-630.526) (-629.237) -- 0:00:39
336000 -- [-629.132] (-636.664) (-634.445) (-628.861) * (-630.260) (-630.148) [-631.704] (-631.287) -- 0:00:39
336500 -- (-630.139) (-631.564) (-629.151) [-631.180] * (-633.681) (-633.797) [-628.914] (-630.264) -- 0:00:39
337000 -- [-631.251] (-628.831) (-633.264) (-629.345) * (-633.400) (-630.408) (-630.822) [-630.615] -- 0:00:41
337500 -- (-632.155) [-629.810] (-630.084) (-634.329) * [-630.163] (-629.367) (-631.088) (-632.378) -- 0:00:41
338000 -- (-631.626) [-632.160] (-634.175) (-633.208) * (-632.549) [-629.934] (-630.258) (-633.827) -- 0:00:41
338500 -- [-631.242] (-629.403) (-629.810) (-634.372) * (-635.134) (-629.934) (-629.670) [-632.728] -- 0:00:41
339000 -- (-630.325) (-632.250) [-631.051] (-631.152) * [-631.142] (-628.770) (-634.581) (-633.497) -- 0:00:40
339500 -- (-629.589) (-631.103) (-632.315) [-628.640] * (-629.958) (-630.519) (-631.118) [-631.828] -- 0:00:40
340000 -- [-629.699] (-632.320) (-629.621) (-631.246) * (-632.480) [-631.851] (-633.474) (-629.640) -- 0:00:40
Average standard deviation of split frequencies: 0.007733
340500 -- (-631.256) (-630.221) [-629.281] (-628.511) * (-630.845) (-629.430) (-635.371) [-629.525] -- 0:00:40
341000 -- (-630.363) [-631.339] (-629.674) (-632.984) * (-632.396) (-630.136) (-630.683) [-630.180] -- 0:00:40
341500 -- (-630.653) (-633.017) (-634.091) [-631.017] * (-632.942) (-629.888) [-631.826] (-632.249) -- 0:00:40
342000 -- (-630.707) [-631.791] (-632.107) (-630.026) * (-635.880) (-630.424) [-634.358] (-632.607) -- 0:00:40
342500 -- (-633.005) [-630.303] (-630.029) (-630.479) * (-632.389) [-630.364] (-634.284) (-630.073) -- 0:00:40
343000 -- [-630.367] (-631.025) (-633.057) (-629.986) * (-634.535) (-630.466) (-634.515) [-634.114] -- 0:00:40
343500 -- (-634.694) (-632.373) (-629.843) [-631.255] * (-632.198) [-629.901] (-633.873) (-630.912) -- 0:00:40
344000 -- [-633.087] (-630.354) (-630.589) (-628.766) * (-633.863) [-634.689] (-632.484) (-632.887) -- 0:00:40
344500 -- [-634.018] (-630.775) (-632.811) (-628.714) * (-630.849) (-631.333) (-631.461) [-629.096] -- 0:00:39
345000 -- (-629.317) (-632.154) (-632.232) [-629.465] * (-630.185) (-631.517) [-629.383] (-629.100) -- 0:00:39
Average standard deviation of split frequencies: 0.007720
345500 -- (-630.092) (-628.938) [-631.574] (-630.841) * [-632.858] (-633.859) (-631.303) (-634.554) -- 0:00:39
346000 -- (-628.588) [-629.710] (-632.194) (-635.371) * (-633.264) [-631.998] (-632.783) (-630.954) -- 0:00:39
346500 -- [-629.951] (-629.858) (-630.020) (-633.511) * (-635.337) [-632.258] (-630.231) (-629.382) -- 0:00:39
347000 -- (-631.405) [-629.820] (-630.299) (-634.923) * (-631.040) (-633.643) [-631.838] (-631.814) -- 0:00:39
347500 -- (-637.087) (-629.084) [-630.678] (-629.788) * [-632.715] (-630.425) (-629.758) (-629.586) -- 0:00:39
348000 -- [-631.253] (-629.604) (-629.898) (-630.683) * (-632.949) [-630.561] (-630.882) (-633.995) -- 0:00:39
348500 -- (-635.572) [-631.065] (-632.151) (-628.860) * (-632.077) [-629.659] (-629.036) (-632.230) -- 0:00:39
349000 -- (-629.364) (-630.824) [-630.312] (-630.125) * (-630.349) (-629.708) (-629.836) [-631.037] -- 0:00:39
349500 -- (-630.042) [-631.847] (-630.727) (-631.130) * (-630.479) (-631.782) (-629.342) [-629.398] -- 0:00:39
350000 -- (-633.642) [-630.365] (-632.699) (-629.582) * (-635.668) (-630.046) (-632.295) [-631.608] -- 0:00:39
Average standard deviation of split frequencies: 0.008663
350500 -- (-634.701) (-636.073) [-631.827] (-629.956) * (-629.433) (-631.932) [-629.760] (-635.130) -- 0:00:38
351000 -- (-632.911) (-634.032) (-630.281) [-630.829] * (-631.683) (-633.502) (-629.974) [-629.201] -- 0:00:38
351500 -- (-629.154) (-629.035) [-630.755] (-630.319) * (-629.054) [-629.373] (-629.913) (-632.212) -- 0:00:38
352000 -- (-631.199) (-632.361) [-630.436] (-637.733) * (-631.774) (-632.456) [-629.764] (-628.869) -- 0:00:38
352500 -- [-629.654] (-631.184) (-630.030) (-637.209) * (-636.815) [-629.584] (-629.694) (-630.051) -- 0:00:38
353000 -- (-634.731) (-630.104) (-632.505) [-633.256] * (-631.321) (-629.157) [-629.070] (-630.432) -- 0:00:38
353500 -- (-634.048) (-632.166) (-631.088) [-630.498] * [-630.168] (-632.401) (-630.683) (-630.289) -- 0:00:38
354000 -- (-629.730) [-630.959] (-633.507) (-632.632) * (-630.594) (-628.855) [-629.454] (-630.743) -- 0:00:40
354500 -- (-629.809) (-630.345) [-632.558] (-631.864) * [-632.249] (-629.066) (-629.393) (-630.315) -- 0:00:40
355000 -- [-630.476] (-631.413) (-630.088) (-630.401) * (-630.905) (-630.399) [-631.773] (-629.744) -- 0:00:39
Average standard deviation of split frequencies: 0.007945
355500 -- (-629.936) [-630.539] (-630.262) (-631.705) * (-636.011) (-629.921) [-631.161] (-631.520) -- 0:00:39
356000 -- (-636.341) (-629.938) (-635.130) [-631.054] * (-633.718) (-631.049) (-630.056) [-631.717] -- 0:00:39
356500 -- (-633.211) [-633.681] (-635.256) (-631.109) * (-628.738) [-630.875] (-631.075) (-631.121) -- 0:00:39
357000 -- (-631.266) (-635.807) (-630.661) [-629.634] * (-632.052) [-630.759] (-629.464) (-629.372) -- 0:00:39
357500 -- [-634.153] (-630.830) (-631.263) (-630.213) * (-629.807) (-635.050) [-629.419] (-629.611) -- 0:00:39
358000 -- (-631.410) [-630.378] (-639.432) (-629.339) * (-632.755) (-630.264) (-634.518) [-631.329] -- 0:00:39
358500 -- [-630.996] (-629.734) (-633.574) (-629.489) * (-634.562) [-630.148] (-629.520) (-629.789) -- 0:00:39
359000 -- (-630.449) [-630.672] (-629.659) (-630.365) * (-634.562) [-633.678] (-630.393) (-629.330) -- 0:00:39
359500 -- (-637.951) (-631.307) (-632.025) [-631.069] * (-633.270) (-633.273) [-635.144] (-629.716) -- 0:00:39
360000 -- (-632.903) (-633.302) (-631.698) [-630.431] * [-630.374] (-630.741) (-632.990) (-630.165) -- 0:00:39
Average standard deviation of split frequencies: 0.008332
360500 -- (-630.968) (-631.974) [-633.778] (-630.159) * (-632.895) (-629.098) (-635.528) [-630.700] -- 0:00:39
361000 -- (-633.170) (-630.266) [-632.521] (-630.271) * (-632.242) [-630.784] (-630.851) (-632.509) -- 0:00:38
361500 -- [-630.926] (-634.888) (-632.711) (-629.533) * (-632.074) [-630.538] (-629.787) (-629.041) -- 0:00:38
362000 -- (-630.483) [-629.551] (-629.823) (-630.373) * (-635.567) [-630.694] (-630.153) (-629.100) -- 0:00:38
362500 -- [-629.463] (-638.389) (-633.017) (-634.409) * (-631.262) (-629.517) [-630.466] (-629.100) -- 0:00:38
363000 -- (-630.721) (-630.792) (-631.718) [-631.745] * (-628.743) (-633.204) [-632.468] (-632.206) -- 0:00:38
363500 -- (-630.960) [-629.264] (-631.737) (-629.122) * (-628.803) (-629.714) [-629.610] (-635.356) -- 0:00:38
364000 -- [-629.835] (-630.070) (-629.990) (-631.718) * (-630.322) (-630.993) (-629.612) [-633.535] -- 0:00:38
364500 -- (-630.692) (-631.908) [-629.256] (-631.985) * (-632.133) (-630.717) (-631.138) [-630.380] -- 0:00:38
365000 -- (-631.423) [-629.708] (-631.059) (-633.708) * (-633.258) (-629.450) [-632.230] (-631.918) -- 0:00:38
Average standard deviation of split frequencies: 0.008935
365500 -- (-630.171) (-632.798) (-631.198) [-632.041] * (-630.310) [-632.743] (-634.598) (-640.034) -- 0:00:38
366000 -- (-633.528) (-631.125) [-630.878] (-633.037) * [-631.373] (-631.795) (-629.824) (-632.535) -- 0:00:38
366500 -- (-629.247) (-631.631) (-631.931) [-633.505] * (-632.881) (-630.574) [-630.227] (-635.042) -- 0:00:38
367000 -- [-629.863] (-629.384) (-631.787) (-630.311) * (-630.352) [-629.461] (-632.187) (-629.899) -- 0:00:37
367500 -- (-630.873) (-632.744) [-631.481] (-629.951) * (-630.059) [-630.691] (-630.257) (-629.879) -- 0:00:37
368000 -- (-631.616) (-629.961) [-633.504] (-629.745) * [-629.874] (-630.646) (-636.142) (-629.069) -- 0:00:37
368500 -- (-629.263) (-631.031) (-630.332) [-628.659] * (-629.874) (-630.038) [-629.668] (-630.320) -- 0:00:37
369000 -- (-631.168) (-629.659) [-632.167] (-628.940) * [-629.657] (-629.630) (-633.463) (-634.044) -- 0:00:37
369500 -- (-631.320) [-631.321] (-633.290) (-630.147) * (-630.989) (-636.770) (-634.269) [-631.123] -- 0:00:37
370000 -- (-633.547) (-631.493) (-636.004) [-632.332] * (-630.426) [-630.394] (-630.119) (-629.334) -- 0:00:37
Average standard deviation of split frequencies: 0.007790
370500 -- [-630.233] (-631.643) (-632.636) (-630.597) * [-630.359] (-629.188) (-629.318) (-631.070) -- 0:00:37
371000 -- (-631.786) [-629.417] (-632.688) (-629.664) * [-630.554] (-631.671) (-634.078) (-636.143) -- 0:00:37
371500 -- (-630.798) (-636.695) (-630.254) [-630.612] * (-630.662) (-630.482) (-630.295) [-633.091] -- 0:00:38
372000 -- [-631.152] (-630.978) (-630.276) (-633.296) * [-630.429] (-634.309) (-631.151) (-629.828) -- 0:00:38
372500 -- (-630.968) (-632.051) (-631.235) [-633.445] * [-632.028] (-634.572) (-630.608) (-631.027) -- 0:00:38
373000 -- (-629.359) (-630.573) (-629.073) [-629.359] * (-630.511) (-631.149) [-630.127] (-633.682) -- 0:00:38
373500 -- [-628.796] (-629.916) (-629.718) (-635.024) * (-631.681) [-632.125] (-630.842) (-630.874) -- 0:00:38
374000 -- (-629.350) (-635.752) [-632.842] (-630.040) * (-631.704) (-630.421) [-633.136] (-634.403) -- 0:00:38
374500 -- [-630.328] (-631.408) (-631.200) (-629.514) * (-631.727) (-632.042) [-634.701] (-630.178) -- 0:00:38
375000 -- (-632.418) (-629.411) [-631.114] (-638.524) * (-630.585) [-631.470] (-635.122) (-629.955) -- 0:00:38
Average standard deviation of split frequencies: 0.007444
375500 -- (-633.517) (-629.148) [-629.276] (-633.540) * (-629.705) [-632.881] (-630.210) (-633.876) -- 0:00:38
376000 -- (-630.245) (-629.942) (-631.650) [-629.682] * (-629.670) (-629.874) [-631.624] (-630.524) -- 0:00:38
376500 -- [-630.848] (-633.979) (-630.538) (-631.919) * [-630.611] (-628.509) (-629.185) (-633.516) -- 0:00:38
377000 -- (-631.747) [-628.710] (-630.644) (-630.035) * (-629.719) (-628.509) [-628.873] (-630.231) -- 0:00:38
377500 -- (-630.497) [-629.457] (-632.127) (-632.054) * (-629.895) [-628.563] (-629.545) (-629.635) -- 0:00:37
378000 -- (-629.729) (-632.857) [-635.446] (-630.966) * (-631.368) [-632.138] (-630.141) (-632.734) -- 0:00:37
378500 -- (-629.584) (-632.862) (-631.883) [-630.601] * (-630.904) (-632.282) (-630.403) [-629.861] -- 0:00:37
379000 -- (-630.041) (-632.864) (-631.792) [-630.556] * (-632.032) (-630.723) (-631.658) [-629.507] -- 0:00:37
379500 -- (-628.574) [-629.745] (-629.684) (-631.143) * [-631.666] (-630.873) (-632.011) (-633.872) -- 0:00:37
380000 -- [-629.687] (-633.879) (-630.469) (-629.064) * (-631.178) [-630.186] (-631.284) (-633.125) -- 0:00:37
Average standard deviation of split frequencies: 0.007043
380500 -- (-632.575) (-632.329) [-631.686] (-633.977) * (-634.956) (-631.283) [-630.194] (-632.920) -- 0:00:37
381000 -- (-632.660) (-630.223) [-631.866] (-633.412) * (-636.262) (-630.683) (-631.984) [-630.414] -- 0:00:37
381500 -- (-631.926) (-630.095) [-630.097] (-633.172) * (-637.678) [-633.195] (-630.009) (-633.910) -- 0:00:37
382000 -- (-630.786) (-629.215) [-630.432] (-631.835) * (-632.748) (-630.762) (-631.563) [-629.355] -- 0:00:37
382500 -- [-631.332] (-630.448) (-632.870) (-632.253) * (-630.017) (-631.265) (-630.881) [-630.146] -- 0:00:37
383000 -- (-633.233) (-629.953) (-631.837) [-629.865] * (-629.511) (-630.949) (-632.336) [-631.366] -- 0:00:37
383500 -- (-631.301) [-629.874] (-632.014) (-629.707) * (-632.443) (-632.152) [-629.315] (-631.578) -- 0:00:36
384000 -- (-631.055) (-629.949) [-631.945] (-630.567) * (-638.104) (-632.539) [-631.091] (-631.061) -- 0:00:36
384500 -- (-631.966) (-633.460) (-629.542) [-629.550] * (-635.961) [-631.460] (-629.040) (-634.369) -- 0:00:36
385000 -- [-629.536] (-630.143) (-631.485) (-631.518) * [-629.545] (-629.499) (-630.518) (-632.014) -- 0:00:36
Average standard deviation of split frequencies: 0.006946
385500 -- (-631.108) [-630.067] (-629.817) (-631.097) * (-630.338) [-629.342] (-630.718) (-631.028) -- 0:00:36
386000 -- (-629.324) [-629.654] (-630.772) (-637.096) * (-630.786) [-632.863] (-630.703) (-633.010) -- 0:00:36
386500 -- [-630.203] (-629.128) (-631.069) (-635.080) * [-631.761] (-632.915) (-631.465) (-634.897) -- 0:00:36
387000 -- [-631.882] (-631.093) (-632.396) (-633.140) * [-633.771] (-631.286) (-629.224) (-631.322) -- 0:00:36
387500 -- (-631.103) [-630.045] (-631.301) (-632.506) * (-635.889) (-629.464) [-629.394] (-630.773) -- 0:00:36
388000 -- (-632.014) [-631.324] (-629.889) (-634.807) * (-633.904) [-630.681] (-632.630) (-630.033) -- 0:00:36
388500 -- (-629.572) (-632.393) [-630.603] (-629.592) * (-631.415) [-628.760] (-632.175) (-630.561) -- 0:00:37
389000 -- (-628.860) (-631.807) [-633.454] (-629.691) * (-630.909) (-630.055) (-631.277) [-630.734] -- 0:00:37
389500 -- [-629.533] (-630.672) (-631.370) (-631.655) * (-629.353) [-629.776] (-629.250) (-633.765) -- 0:00:37
390000 -- (-631.109) (-628.667) [-632.219] (-630.448) * (-629.928) [-629.542] (-633.812) (-634.598) -- 0:00:37
Average standard deviation of split frequencies: 0.007240
390500 -- [-629.798] (-628.786) (-630.332) (-629.103) * (-632.555) [-635.632] (-636.418) (-632.156) -- 0:00:37
391000 -- [-631.306] (-629.960) (-631.540) (-631.659) * (-633.550) (-631.097) (-631.605) [-632.033] -- 0:00:37
391500 -- (-630.927) (-631.157) [-631.630] (-631.639) * (-632.898) [-629.621] (-629.772) (-632.685) -- 0:00:37
392000 -- [-632.763] (-631.335) (-630.307) (-630.567) * [-631.082] (-632.015) (-630.071) (-630.817) -- 0:00:37
392500 -- [-630.425] (-629.411) (-630.788) (-632.974) * [-631.110] (-634.480) (-631.405) (-629.547) -- 0:00:37
393000 -- (-630.357) [-630.039] (-633.189) (-631.286) * [-633.665] (-631.056) (-631.298) (-630.049) -- 0:00:37
393500 -- (-634.900) (-629.898) [-633.205] (-629.390) * [-632.871] (-632.120) (-632.316) (-628.450) -- 0:00:36
394000 -- (-629.821) [-631.297] (-629.256) (-631.045) * (-630.523) [-629.520] (-637.958) (-630.122) -- 0:00:36
394500 -- (-629.333) [-633.682] (-629.794) (-631.112) * (-632.828) [-631.901] (-632.722) (-632.331) -- 0:00:36
395000 -- [-632.454] (-630.334) (-633.324) (-629.399) * (-632.431) (-631.450) (-630.690) [-629.823] -- 0:00:36
Average standard deviation of split frequencies: 0.007283
395500 -- (-629.952) (-630.765) (-631.051) [-629.516] * (-632.522) (-628.840) (-630.039) [-629.295] -- 0:00:36
396000 -- (-629.537) [-631.337] (-630.067) (-631.545) * (-629.218) [-631.950] (-633.476) (-630.778) -- 0:00:36
396500 -- (-630.616) (-629.212) (-630.961) [-629.363] * (-628.515) (-629.445) (-633.670) [-629.363] -- 0:00:36
397000 -- (-631.096) [-629.060] (-630.597) (-628.967) * [-629.197] (-631.550) (-632.127) (-634.902) -- 0:00:36
397500 -- (-629.841) (-628.793) (-630.588) [-630.436] * (-629.904) (-632.776) [-630.116] (-632.687) -- 0:00:36
398000 -- (-629.761) [-628.881] (-631.005) (-629.185) * (-631.553) (-630.927) [-629.073] (-630.613) -- 0:00:36
398500 -- [-628.984] (-631.397) (-629.680) (-629.282) * [-629.782] (-630.868) (-628.978) (-632.561) -- 0:00:36
399000 -- (-630.905) (-634.589) [-629.191] (-630.041) * (-628.995) (-629.229) [-629.479] (-631.529) -- 0:00:36
399500 -- [-631.007] (-630.851) (-630.210) (-628.556) * [-629.742] (-631.918) (-629.255) (-633.049) -- 0:00:36
400000 -- (-630.741) (-630.310) [-634.757] (-629.636) * (-633.132) (-634.791) (-629.211) [-629.591] -- 0:00:36
Average standard deviation of split frequencies: 0.006713
400500 -- [-630.766] (-630.927) (-636.353) (-631.799) * (-629.628) (-631.565) (-634.339) [-630.766] -- 0:00:35
401000 -- (-630.359) (-631.567) [-635.708] (-631.094) * (-632.991) (-630.559) (-630.952) [-631.743] -- 0:00:35
401500 -- (-630.567) (-631.871) (-629.998) [-632.434] * (-629.660) (-629.146) (-632.938) [-631.257] -- 0:00:35
402000 -- (-630.274) (-630.353) [-631.162] (-629.955) * (-630.804) [-629.668] (-631.657) (-633.421) -- 0:00:35
402500 -- [-631.111] (-631.953) (-631.111) (-629.736) * (-629.633) (-631.361) [-629.568] (-633.132) -- 0:00:35
403000 -- (-633.237) [-632.355] (-632.683) (-631.293) * (-629.169) [-631.692] (-632.833) (-632.719) -- 0:00:35
403500 -- (-631.618) [-631.644] (-630.756) (-631.600) * [-630.502] (-631.733) (-630.317) (-629.943) -- 0:00:35
404000 -- [-632.719] (-633.825) (-628.777) (-632.880) * (-629.680) (-629.930) [-630.984] (-633.565) -- 0:00:35
404500 -- (-631.007) [-630.702] (-630.321) (-630.405) * (-630.373) (-629.666) (-630.941) [-630.088] -- 0:00:35
405000 -- (-629.809) (-635.497) [-630.450] (-630.855) * (-630.016) (-629.154) [-630.571] (-630.470) -- 0:00:35
Average standard deviation of split frequencies: 0.007445
405500 -- (-631.985) (-633.528) (-631.654) [-631.640] * (-629.846) (-631.019) (-631.402) [-629.917] -- 0:00:36
406000 -- (-629.276) (-636.519) (-631.205) [-629.791] * (-629.149) (-630.963) (-630.954) [-629.535] -- 0:00:36
406500 -- [-633.069] (-630.227) (-631.169) (-631.727) * [-630.870] (-631.948) (-632.666) (-634.260) -- 0:00:36
407000 -- (-635.039) (-629.751) [-630.542] (-628.699) * (-632.993) (-633.127) [-630.966] (-634.583) -- 0:00:36
407500 -- (-635.696) [-631.963] (-630.350) (-631.263) * [-629.303] (-633.423) (-630.663) (-632.499) -- 0:00:36
408000 -- (-633.296) (-628.888) [-629.683] (-630.600) * (-631.057) [-631.186] (-631.308) (-635.981) -- 0:00:36
408500 -- (-630.994) [-629.627] (-628.804) (-632.078) * (-629.852) [-633.199] (-631.664) (-632.003) -- 0:00:36
409000 -- (-630.800) (-631.248) [-629.086] (-629.229) * (-630.273) (-630.400) [-629.696] (-630.146) -- 0:00:36
409500 -- (-630.830) (-634.720) (-631.226) [-629.228] * (-632.722) [-629.544] (-629.360) (-631.863) -- 0:00:36
410000 -- (-631.224) (-636.937) (-630.946) [-630.013] * (-634.209) (-632.789) (-630.451) [-635.240] -- 0:00:35
Average standard deviation of split frequencies: 0.007293
410500 -- (-629.068) [-631.709] (-631.970) (-631.297) * (-632.117) (-634.265) [-629.665] (-632.421) -- 0:00:35
411000 -- (-629.730) (-634.224) (-632.545) [-632.065] * (-632.125) (-635.016) (-629.497) [-630.866] -- 0:00:35
411500 -- (-633.117) (-633.851) (-629.840) [-628.883] * (-635.872) (-633.172) (-631.418) [-632.560] -- 0:00:35
412000 -- [-632.296] (-633.255) (-630.562) (-630.261) * (-634.529) (-633.164) [-630.248] (-628.971) -- 0:00:35
412500 -- [-629.656] (-629.467) (-634.432) (-630.090) * (-629.140) (-632.498) [-635.226] (-628.992) -- 0:00:35
413000 -- (-630.343) (-629.642) [-629.836] (-630.277) * (-630.858) (-635.210) (-631.153) [-630.789] -- 0:00:35
413500 -- (-633.392) (-628.894) [-631.763] (-630.260) * (-632.141) (-631.648) (-634.183) [-629.988] -- 0:00:35
414000 -- (-632.268) [-629.111] (-636.322) (-630.590) * (-629.913) [-630.270] (-629.723) (-630.180) -- 0:00:35
414500 -- (-630.504) [-628.880] (-630.719) (-629.407) * [-629.323] (-630.858) (-629.683) (-634.279) -- 0:00:35
415000 -- [-634.625] (-629.234) (-630.359) (-630.822) * (-633.908) [-629.915] (-629.389) (-629.604) -- 0:00:35
Average standard deviation of split frequencies: 0.007999
415500 -- (-632.499) (-629.306) [-631.243] (-630.289) * (-630.882) (-629.904) [-634.146] (-629.114) -- 0:00:35
416000 -- (-632.766) (-630.064) [-633.454] (-634.285) * (-632.085) [-630.676] (-629.647) (-629.353) -- 0:00:35
416500 -- (-633.265) (-630.143) [-630.338] (-631.865) * [-630.291] (-636.145) (-629.536) (-629.108) -- 0:00:35
417000 -- (-631.946) (-631.366) [-630.927] (-633.402) * (-631.823) (-635.441) [-630.057] (-632.524) -- 0:00:34
417500 -- [-629.399] (-631.128) (-632.622) (-629.061) * [-631.647] (-637.943) (-633.049) (-630.123) -- 0:00:34
418000 -- (-634.179) (-632.070) (-633.790) [-629.792] * (-630.491) [-633.493] (-636.599) (-629.526) -- 0:00:34
418500 -- (-631.771) (-633.147) [-633.822] (-629.938) * (-628.950) (-633.438) (-629.940) [-630.707] -- 0:00:34
419000 -- [-630.946] (-632.959) (-633.074) (-629.756) * [-630.936] (-631.388) (-632.267) (-630.222) -- 0:00:34
419500 -- (-634.185) (-631.307) [-633.300] (-630.289) * (-631.530) [-629.020] (-629.635) (-630.491) -- 0:00:34
420000 -- (-629.292) (-629.097) [-630.244] (-631.172) * (-633.956) (-629.735) (-631.396) [-631.898] -- 0:00:34
Average standard deviation of split frequencies: 0.007910
420500 -- (-629.831) (-631.062) [-629.482] (-631.755) * (-633.284) (-633.416) [-632.392] (-634.046) -- 0:00:34
421000 -- (-630.587) (-629.510) (-628.720) [-629.241] * [-632.225] (-630.166) (-635.483) (-631.629) -- 0:00:34
421500 -- (-633.821) (-630.082) (-629.171) [-629.882] * (-632.330) (-631.221) [-635.064] (-628.547) -- 0:00:34
422000 -- [-630.598] (-630.886) (-631.278) (-630.363) * (-631.520) [-631.349] (-630.950) (-629.441) -- 0:00:34
422500 -- (-629.336) [-632.297] (-633.550) (-638.436) * (-631.628) (-631.282) (-633.010) [-631.142] -- 0:00:35
423000 -- (-629.922) (-631.062) (-632.718) [-632.257] * (-630.665) [-629.690] (-635.192) (-631.466) -- 0:00:35
423500 -- (-630.246) (-630.501) (-632.157) [-629.912] * (-629.934) [-630.039] (-631.988) (-630.560) -- 0:00:35
424000 -- (-629.289) [-630.682] (-631.004) (-630.860) * (-629.550) (-629.593) [-630.974] (-630.168) -- 0:00:35
424500 -- (-631.060) (-631.271) [-630.526] (-630.238) * (-629.993) [-629.688] (-630.379) (-631.747) -- 0:00:35
425000 -- (-630.772) (-630.855) [-629.504] (-629.971) * (-632.486) (-631.760) (-632.365) [-630.747] -- 0:00:35
Average standard deviation of split frequencies: 0.008722
425500 -- (-632.906) [-629.612] (-630.494) (-629.097) * (-632.595) (-630.531) [-628.600] (-634.359) -- 0:00:35
426000 -- (-631.635) (-629.718) (-632.840) [-629.097] * [-631.081] (-631.024) (-628.491) (-629.238) -- 0:00:35
426500 -- (-630.415) (-630.822) [-629.313] (-630.528) * (-629.991) [-630.763] (-628.905) (-631.518) -- 0:00:34
427000 -- (-630.548) (-632.147) (-629.518) [-631.679] * (-632.163) [-629.269] (-631.398) (-630.053) -- 0:00:34
427500 -- (-630.960) (-629.858) (-629.901) [-630.536] * (-631.237) (-631.492) (-629.663) [-630.612] -- 0:00:34
428000 -- [-633.538] (-633.815) (-630.653) (-630.404) * [-632.273] (-629.962) (-630.832) (-631.399) -- 0:00:34
428500 -- (-629.151) [-628.956] (-630.900) (-638.415) * [-631.807] (-631.473) (-628.592) (-630.856) -- 0:00:34
429000 -- (-630.933) (-633.793) [-633.344] (-633.731) * (-635.298) [-630.926] (-628.592) (-632.135) -- 0:00:34
429500 -- (-629.360) (-632.579) [-632.480] (-634.065) * [-631.976] (-630.082) (-629.824) (-633.166) -- 0:00:34
430000 -- (-634.961) (-632.332) (-631.381) [-633.150] * (-632.018) (-632.530) (-634.295) [-630.161] -- 0:00:34
Average standard deviation of split frequencies: 0.008821
430500 -- [-632.067] (-635.769) (-631.443) (-631.954) * [-630.130] (-634.508) (-636.025) (-632.537) -- 0:00:34
431000 -- (-631.747) (-631.390) [-629.414] (-632.248) * (-631.476) (-631.479) (-633.222) [-632.038] -- 0:00:34
431500 -- (-631.434) [-629.401] (-631.341) (-630.062) * (-630.908) (-630.434) [-631.756] (-631.059) -- 0:00:34
432000 -- [-631.340] (-630.772) (-636.410) (-632.744) * (-630.346) (-628.724) [-629.429] (-631.326) -- 0:00:34
432500 -- [-630.904] (-632.937) (-633.006) (-629.964) * [-630.140] (-629.894) (-631.962) (-635.442) -- 0:00:34
433000 -- (-631.305) (-629.892) (-630.141) [-629.667] * (-629.408) [-631.216] (-632.022) (-634.352) -- 0:00:34
433500 -- [-630.796] (-630.621) (-632.892) (-630.322) * [-633.922] (-630.894) (-632.495) (-631.531) -- 0:00:33
434000 -- [-630.304] (-632.854) (-634.211) (-631.149) * (-638.323) (-632.611) [-630.311] (-631.393) -- 0:00:33
434500 -- (-630.485) (-629.919) (-632.254) [-632.459] * (-632.904) [-633.714] (-628.832) (-632.506) -- 0:00:33
435000 -- [-630.234] (-631.029) (-631.060) (-630.613) * [-630.110] (-629.077) (-630.216) (-629.968) -- 0:00:33
Average standard deviation of split frequencies: 0.008586
435500 -- (-630.326) (-632.400) [-629.741] (-630.600) * (-629.040) (-630.338) (-630.025) [-631.360] -- 0:00:33
436000 -- (-631.765) (-630.151) [-633.111] (-632.112) * (-631.066) (-633.348) (-629.978) [-630.932] -- 0:00:33
436500 -- (-631.661) (-630.830) (-629.144) [-633.295] * (-630.430) [-631.060] (-633.823) (-635.476) -- 0:00:33
437000 -- [-633.864] (-629.298) (-633.183) (-629.637) * [-632.350] (-633.420) (-631.975) (-633.420) -- 0:00:33
437500 -- (-630.419) [-631.053] (-629.591) (-630.711) * [-630.447] (-632.545) (-631.263) (-631.763) -- 0:00:33
438000 -- [-630.471] (-631.858) (-629.594) (-630.679) * (-631.113) (-630.288) [-630.248] (-634.099) -- 0:00:33
438500 -- [-628.756] (-633.261) (-631.467) (-631.009) * (-629.318) (-630.799) (-634.077) [-632.418] -- 0:00:33
439000 -- (-629.046) (-632.691) [-629.889] (-630.284) * (-629.490) (-632.109) (-633.924) [-630.652] -- 0:00:33
439500 -- [-631.261] (-634.244) (-628.837) (-631.404) * (-629.618) (-630.408) [-635.124] (-630.544) -- 0:00:34
440000 -- (-629.690) (-629.987) (-629.562) [-628.756] * (-628.949) [-632.343] (-630.628) (-629.913) -- 0:00:34
Average standard deviation of split frequencies: 0.008369
440500 -- [-631.619] (-630.978) (-628.454) (-632.769) * [-628.762] (-630.341) (-630.011) (-630.266) -- 0:00:34
441000 -- [-630.410] (-629.237) (-632.109) (-631.836) * [-630.425] (-633.214) (-630.469) (-632.326) -- 0:00:34
441500 -- (-629.907) (-639.512) (-630.592) [-630.008] * (-631.587) [-630.730] (-630.338) (-635.638) -- 0:00:34
442000 -- (-630.718) (-637.889) (-629.023) [-631.983] * (-632.095) [-632.125] (-637.339) (-630.055) -- 0:00:34
442500 -- (-630.145) (-630.939) (-634.221) [-633.478] * [-633.084] (-631.426) (-629.534) (-631.844) -- 0:00:34
443000 -- [-629.416] (-629.819) (-636.349) (-633.033) * (-632.277) (-628.736) [-630.125] (-632.050) -- 0:00:33
443500 -- (-632.715) [-629.686] (-629.473) (-631.621) * [-629.750] (-630.932) (-630.980) (-629.441) -- 0:00:33
444000 -- (-635.681) (-629.058) [-629.194] (-631.508) * (-628.899) (-629.228) [-631.324] (-629.683) -- 0:00:33
444500 -- (-631.807) (-628.713) (-630.941) [-630.752] * (-630.331) (-631.267) [-629.469] (-633.550) -- 0:00:33
445000 -- [-631.182] (-633.482) (-633.119) (-630.428) * (-630.714) (-628.949) (-634.360) [-629.586] -- 0:00:33
Average standard deviation of split frequencies: 0.008749
445500 -- (-631.056) [-631.407] (-632.679) (-633.079) * (-630.292) (-629.788) (-629.606) [-632.739] -- 0:00:33
446000 -- [-630.533] (-632.296) (-630.593) (-634.511) * (-630.378) (-630.155) [-630.811] (-630.726) -- 0:00:33
446500 -- [-629.514] (-632.091) (-629.136) (-633.971) * (-630.005) [-634.804] (-630.233) (-630.854) -- 0:00:33
447000 -- (-630.603) [-630.070] (-632.226) (-629.571) * [-629.259] (-631.803) (-630.806) (-630.123) -- 0:00:33
447500 -- (-634.104) (-629.371) (-631.493) [-631.525] * (-629.460) (-633.846) (-629.823) [-629.459] -- 0:00:33
448000 -- [-629.617] (-629.934) (-629.848) (-632.707) * (-631.952) (-634.001) [-630.002] (-631.453) -- 0:00:33
448500 -- (-632.755) [-628.960] (-629.228) (-630.064) * [-629.182] (-630.013) (-629.727) (-634.030) -- 0:00:33
449000 -- (-629.568) (-632.668) [-629.789] (-632.424) * [-629.114] (-634.599) (-630.094) (-629.524) -- 0:00:33
449500 -- [-630.255] (-630.538) (-630.082) (-630.570) * (-628.923) (-637.148) (-630.501) [-633.449] -- 0:00:33
450000 -- (-631.193) [-628.928] (-629.559) (-630.934) * (-631.184) (-630.732) (-630.639) [-631.225] -- 0:00:33
Average standard deviation of split frequencies: 0.008891
450500 -- [-630.606] (-630.207) (-631.093) (-634.118) * (-631.261) (-628.609) [-631.608] (-633.546) -- 0:00:32
451000 -- [-629.024] (-630.471) (-632.101) (-630.692) * [-634.831] (-628.615) (-629.090) (-629.936) -- 0:00:32
451500 -- [-637.310] (-629.945) (-634.884) (-629.825) * [-631.641] (-628.470) (-633.053) (-629.922) -- 0:00:32
452000 -- (-630.812) [-632.919] (-634.971) (-631.026) * (-630.825) [-628.582] (-634.062) (-629.055) -- 0:00:32
452500 -- [-632.285] (-630.944) (-631.371) (-632.270) * (-632.632) (-631.786) (-633.509) [-630.093] -- 0:00:32
453000 -- (-629.951) [-629.177] (-633.442) (-629.381) * (-632.045) [-631.992] (-634.701) (-630.264) -- 0:00:32
453500 -- [-630.509] (-629.006) (-629.438) (-631.565) * (-630.361) [-629.184] (-630.838) (-629.345) -- 0:00:32
454000 -- (-630.497) [-629.956] (-630.865) (-631.032) * (-634.063) (-629.070) (-629.911) [-629.217] -- 0:00:32
454500 -- [-630.052] (-630.720) (-632.967) (-628.941) * (-634.303) (-629.256) (-630.818) [-631.092] -- 0:00:32
455000 -- [-630.434] (-630.503) (-634.570) (-632.109) * (-628.945) [-629.229] (-630.193) (-634.597) -- 0:00:32
Average standard deviation of split frequencies: 0.008959
455500 -- (-634.328) (-628.798) [-633.747] (-633.477) * (-631.498) [-629.435] (-629.968) (-630.334) -- 0:00:32
456000 -- (-630.410) [-628.941] (-633.139) (-631.472) * (-631.035) [-629.000] (-630.611) (-630.880) -- 0:00:32
456500 -- [-629.753] (-630.404) (-635.434) (-631.473) * (-629.327) [-632.529] (-629.341) (-630.760) -- 0:00:33
457000 -- (-630.005) [-628.700] (-631.891) (-630.479) * [-629.987] (-628.933) (-635.419) (-631.193) -- 0:00:33
457500 -- (-630.981) (-632.033) [-630.600] (-629.805) * (-629.085) (-629.313) [-632.357] (-634.155) -- 0:00:33
458000 -- (-631.951) (-628.775) [-629.285] (-631.870) * (-629.902) (-633.444) (-629.675) [-631.387] -- 0:00:33
458500 -- (-629.851) (-630.102) [-629.359] (-631.261) * (-636.920) [-633.534] (-628.987) (-631.575) -- 0:00:33
459000 -- (-630.082) (-630.256) [-629.398] (-640.221) * (-637.383) (-631.736) (-630.200) [-631.175] -- 0:00:33
459500 -- [-629.341] (-634.120) (-630.307) (-633.381) * (-629.675) (-629.434) (-631.480) [-630.977] -- 0:00:32
460000 -- [-632.470] (-629.750) (-634.458) (-631.779) * (-629.510) [-629.741] (-638.671) (-631.595) -- 0:00:32
Average standard deviation of split frequencies: 0.009029
460500 -- [-629.384] (-630.102) (-629.584) (-631.828) * (-631.887) (-628.995) (-629.855) [-632.441] -- 0:00:32
461000 -- (-629.353) [-631.349] (-631.623) (-639.817) * (-631.909) (-629.512) (-629.771) [-633.472] -- 0:00:32
461500 -- (-631.719) [-629.353] (-631.108) (-636.162) * [-632.196] (-631.194) (-632.284) (-630.334) -- 0:00:32
462000 -- (-632.583) [-629.957] (-629.851) (-635.724) * (-633.060) (-629.001) [-630.357] (-630.258) -- 0:00:32
462500 -- (-630.070) [-629.591] (-629.017) (-634.573) * [-632.389] (-630.190) (-631.851) (-629.692) -- 0:00:32
463000 -- [-631.982] (-629.731) (-629.536) (-632.316) * (-630.168) (-633.014) [-630.320] (-629.344) -- 0:00:32
463500 -- (-630.847) [-628.968] (-629.288) (-631.287) * (-631.377) (-631.507) (-630.955) [-631.185] -- 0:00:32
464000 -- [-633.485] (-629.734) (-630.614) (-629.573) * [-629.478] (-631.945) (-632.021) (-631.126) -- 0:00:32
464500 -- [-630.347] (-632.828) (-630.827) (-631.336) * (-629.749) (-630.775) (-632.306) [-631.828] -- 0:00:32
465000 -- [-631.682] (-631.497) (-629.801) (-631.937) * (-631.145) [-630.998] (-630.321) (-632.980) -- 0:00:32
Average standard deviation of split frequencies: 0.009385
465500 -- (-632.521) (-634.666) (-632.279) [-632.363] * (-630.093) (-632.283) [-630.563] (-633.734) -- 0:00:32
466000 -- (-630.524) (-630.547) [-632.042] (-634.309) * (-632.457) (-629.023) (-631.056) [-633.395] -- 0:00:32
466500 -- [-629.457] (-632.082) (-629.495) (-630.137) * (-631.616) (-630.711) (-631.413) [-630.220] -- 0:00:32
467000 -- (-630.460) [-630.095] (-630.920) (-631.400) * [-628.945] (-631.717) (-631.122) (-633.251) -- 0:00:31
467500 -- [-633.460] (-630.814) (-631.710) (-629.673) * (-630.064) (-630.552) [-630.586] (-631.815) -- 0:00:31
468000 -- (-630.464) (-631.576) [-631.098] (-628.814) * (-632.703) (-629.605) [-630.301] (-632.468) -- 0:00:31
468500 -- (-629.181) (-635.727) (-630.346) [-629.131] * (-630.352) [-629.405] (-629.805) (-632.608) -- 0:00:31
469000 -- (-631.245) [-633.058] (-630.211) (-628.864) * [-628.920] (-629.070) (-630.061) (-633.702) -- 0:00:31
469500 -- (-630.021) (-630.031) (-631.342) [-628.874] * (-632.032) (-629.629) [-628.850] (-632.343) -- 0:00:31
470000 -- (-629.167) (-631.240) (-633.188) [-629.640] * [-631.747] (-631.575) (-630.245) (-632.356) -- 0:00:31
Average standard deviation of split frequencies: 0.009191
470500 -- (-629.548) [-630.678] (-632.381) (-629.812) * (-631.142) (-632.535) [-630.203] (-635.767) -- 0:00:31
471000 -- (-630.140) (-630.160) (-631.313) [-630.042] * (-632.801) (-632.860) (-630.211) [-629.940] -- 0:00:31
471500 -- (-629.569) (-630.025) (-630.780) [-628.719] * (-632.538) [-632.303] (-630.839) (-632.510) -- 0:00:31
472000 -- (-630.958) [-631.049] (-633.688) (-629.513) * (-633.997) (-629.473) (-633.465) [-629.547] -- 0:00:31
472500 -- [-630.347] (-634.239) (-630.750) (-630.461) * [-630.806] (-629.113) (-632.067) (-630.044) -- 0:00:31
473000 -- (-632.865) (-632.379) [-630.899] (-629.386) * [-629.675] (-633.569) (-629.741) (-630.211) -- 0:00:32
473500 -- (-629.289) [-629.203] (-633.145) (-632.695) * [-630.362] (-629.712) (-632.278) (-633.717) -- 0:00:32
474000 -- (-630.690) [-629.319] (-632.007) (-632.667) * (-632.699) [-629.251] (-629.645) (-631.428) -- 0:00:32
474500 -- (-629.851) (-629.153) [-629.152] (-630.782) * (-631.802) (-633.900) (-630.008) [-630.799] -- 0:00:32
475000 -- [-630.701] (-631.052) (-631.340) (-631.278) * [-630.193] (-633.155) (-632.464) (-630.783) -- 0:00:32
Average standard deviation of split frequencies: 0.009146
475500 -- (-630.632) [-631.054] (-633.707) (-631.166) * (-630.903) (-632.301) (-630.457) [-630.013] -- 0:00:31
476000 -- (-629.187) (-629.138) (-633.289) [-629.364] * (-631.600) (-631.069) [-629.378] (-631.080) -- 0:00:31
476500 -- [-630.085] (-632.675) (-630.404) (-632.165) * (-631.159) (-629.819) [-629.845] (-631.233) -- 0:00:31
477000 -- (-630.651) (-630.664) (-629.920) [-629.945] * (-630.456) [-632.304] (-629.440) (-634.178) -- 0:00:31
477500 -- (-632.636) (-629.902) [-629.642] (-633.307) * (-631.747) (-632.651) [-633.210] (-630.053) -- 0:00:31
478000 -- [-631.411] (-629.720) (-631.283) (-637.937) * (-630.822) [-630.102] (-631.452) (-629.199) -- 0:00:31
478500 -- [-630.475] (-631.308) (-632.695) (-629.602) * [-630.353] (-632.042) (-630.130) (-630.468) -- 0:00:31
479000 -- (-629.753) (-628.694) [-629.547] (-630.814) * (-632.658) (-630.065) [-634.593] (-632.155) -- 0:00:31
479500 -- (-630.749) [-628.874] (-631.271) (-632.829) * (-629.179) [-631.635] (-632.271) (-630.780) -- 0:00:31
480000 -- [-632.454] (-630.853) (-632.111) (-629.860) * [-629.334] (-629.943) (-631.446) (-632.065) -- 0:00:31
Average standard deviation of split frequencies: 0.009230
480500 -- [-630.201] (-629.413) (-630.586) (-630.257) * (-630.222) (-629.667) [-631.863] (-630.700) -- 0:00:31
481000 -- (-630.125) (-629.578) (-631.107) [-631.169] * (-633.610) [-629.216] (-629.052) (-631.002) -- 0:00:31
481500 -- [-629.297] (-630.657) (-632.947) (-629.309) * (-635.701) [-631.463] (-629.267) (-631.453) -- 0:00:31
482000 -- (-629.041) (-631.564) (-633.248) [-632.083] * (-635.100) (-633.397) [-628.809] (-632.622) -- 0:00:31
482500 -- (-630.724) (-629.951) [-630.824] (-630.987) * (-631.998) [-628.985] (-628.939) (-633.194) -- 0:00:31
483000 -- (-637.038) (-631.545) [-628.938] (-632.790) * (-631.314) (-629.022) (-628.621) [-630.311] -- 0:00:31
483500 -- (-633.019) (-630.115) [-630.081] (-631.813) * (-629.795) [-630.192] (-630.829) (-630.444) -- 0:00:30
484000 -- (-629.158) (-634.488) (-635.676) [-630.330] * (-630.527) (-629.319) [-633.242] (-630.657) -- 0:00:30
484500 -- (-629.183) (-636.178) (-629.580) [-629.717] * (-630.897) [-631.592] (-630.042) (-629.468) -- 0:00:30
485000 -- [-629.147] (-630.447) (-631.355) (-630.993) * (-629.528) (-630.594) (-632.734) [-630.776] -- 0:00:30
Average standard deviation of split frequencies: 0.009357
485500 -- (-629.612) [-630.528] (-629.636) (-632.726) * [-632.212] (-633.867) (-629.979) (-629.810) -- 0:00:30
486000 -- (-632.757) [-630.172] (-635.540) (-632.624) * [-631.790] (-631.789) (-631.786) (-633.905) -- 0:00:30
486500 -- (-634.640) (-631.291) [-629.703] (-629.781) * (-630.037) (-630.359) (-630.514) [-629.555] -- 0:00:30
487000 -- (-630.786) (-629.226) (-632.961) [-629.641] * (-629.121) [-629.568] (-632.050) (-632.655) -- 0:00:30
487500 -- [-630.948] (-629.576) (-629.628) (-629.092) * (-629.179) (-633.168) [-630.532] (-632.232) -- 0:00:30
488000 -- (-630.411) [-629.032] (-629.929) (-628.614) * (-631.505) [-632.627] (-629.203) (-633.485) -- 0:00:30
488500 -- [-631.514] (-632.204) (-633.906) (-629.084) * (-634.498) [-630.422] (-630.318) (-631.258) -- 0:00:30
489000 -- (-632.761) (-631.866) [-630.587] (-629.314) * (-629.374) (-631.434) [-630.935] (-628.802) -- 0:00:30
489500 -- (-631.852) (-633.119) [-631.235] (-631.696) * (-633.465) (-628.727) [-629.496] (-629.874) -- 0:00:30
490000 -- (-631.753) (-633.329) [-633.894] (-631.840) * (-634.425) (-631.939) (-632.768) [-631.003] -- 0:00:31
Average standard deviation of split frequencies: 0.009551
490500 -- [-631.535] (-634.826) (-633.750) (-631.237) * (-630.841) (-635.933) (-633.343) [-629.505] -- 0:00:31
491000 -- (-629.827) [-629.256] (-631.218) (-631.264) * (-630.894) [-631.024] (-637.512) (-629.526) -- 0:00:31
491500 -- (-630.081) (-630.215) [-634.144] (-631.846) * (-632.652) (-631.183) [-629.642] (-629.336) -- 0:00:31
492000 -- (-632.248) [-629.045] (-629.020) (-632.285) * (-635.069) [-632.712] (-629.289) (-632.743) -- 0:00:30
492500 -- [-631.033] (-628.751) (-631.388) (-634.040) * (-630.635) (-632.442) [-630.682] (-629.069) -- 0:00:30
493000 -- (-628.868) [-632.293] (-630.560) (-630.035) * [-628.950] (-630.562) (-630.033) (-630.273) -- 0:00:30
493500 -- (-631.007) [-631.005] (-629.165) (-631.910) * [-630.824] (-633.467) (-631.875) (-631.963) -- 0:00:30
494000 -- (-631.337) (-631.400) [-630.702] (-631.132) * [-630.878] (-629.938) (-629.639) (-632.392) -- 0:00:30
494500 -- [-631.310] (-632.730) (-629.470) (-629.107) * (-631.318) (-629.781) [-630.968] (-632.337) -- 0:00:30
495000 -- (-630.995) (-632.515) [-630.378] (-631.094) * (-630.270) (-630.128) (-633.122) [-629.240] -- 0:00:30
Average standard deviation of split frequencies: 0.010734
495500 -- [-631.545] (-629.596) (-630.347) (-630.608) * (-635.695) (-630.837) [-631.150] (-630.713) -- 0:00:30
496000 -- (-631.838) (-630.176) [-633.923] (-629.235) * (-630.728) (-633.965) (-630.508) [-630.383] -- 0:00:30
496500 -- (-632.602) (-630.004) [-630.742] (-632.340) * (-631.012) (-630.810) (-630.509) [-632.069] -- 0:00:30
497000 -- (-633.416) (-630.445) (-630.204) [-630.289] * (-631.469) (-629.442) (-628.836) [-632.794] -- 0:00:30
497500 -- (-630.560) (-628.825) (-631.362) [-629.622] * (-632.256) (-632.506) [-628.918] (-630.427) -- 0:00:30
498000 -- (-630.116) (-628.733) [-630.840] (-629.722) * (-635.935) (-634.147) (-628.829) [-630.553] -- 0:00:30
498500 -- (-632.524) (-629.454) [-631.744] (-629.731) * (-633.528) [-636.240] (-630.605) (-630.306) -- 0:00:30
499000 -- (-631.307) (-629.504) [-631.622] (-630.962) * [-632.963] (-636.201) (-633.138) (-630.655) -- 0:00:30
499500 -- (-632.165) [-630.543] (-629.569) (-633.858) * (-636.255) (-632.718) (-630.921) [-631.491] -- 0:00:30
500000 -- [-629.405] (-634.027) (-630.268) (-634.618) * (-630.833) (-629.892) (-629.382) [-629.230] -- 0:00:30
Average standard deviation of split frequencies: 0.009769
500500 -- (-631.063) [-629.373] (-631.810) (-632.258) * (-631.643) [-629.430] (-629.181) (-630.978) -- 0:00:29
501000 -- (-628.995) [-629.158] (-628.881) (-632.082) * [-629.221] (-633.372) (-630.693) (-632.501) -- 0:00:29
501500 -- (-631.411) (-629.566) (-631.359) [-630.023] * [-631.956] (-629.763) (-633.078) (-630.448) -- 0:00:29
502000 -- (-634.270) (-631.142) (-630.694) [-633.237] * (-629.599) (-629.753) (-630.168) [-631.895] -- 0:00:29
502500 -- (-629.735) (-630.539) [-630.845] (-634.014) * (-631.673) [-629.682] (-629.723) (-632.288) -- 0:00:29
503000 -- [-630.021] (-632.657) (-629.441) (-633.439) * [-631.043] (-631.720) (-629.672) (-631.262) -- 0:00:29
503500 -- (-632.817) (-632.513) (-631.683) [-629.919] * (-629.256) (-632.141) [-633.107] (-634.090) -- 0:00:29
504000 -- (-634.097) [-629.692] (-632.308) (-632.372) * (-629.489) [-634.078] (-630.862) (-630.461) -- 0:00:29
504500 -- (-630.168) (-629.143) (-631.356) [-629.564] * (-628.990) (-631.410) (-632.283) [-629.339] -- 0:00:29
505000 -- (-629.240) [-630.052] (-633.246) (-631.965) * (-629.725) (-630.272) (-629.680) [-630.557] -- 0:00:29
Average standard deviation of split frequencies: 0.010303
505500 -- [-630.234] (-630.090) (-628.981) (-629.352) * [-629.101] (-630.096) (-630.570) (-630.675) -- 0:00:29
506000 -- (-629.392) (-631.081) [-631.654] (-635.627) * (-628.818) [-631.584] (-632.969) (-629.190) -- 0:00:29
506500 -- [-632.096] (-634.023) (-629.497) (-633.174) * [-630.096] (-631.289) (-635.306) (-630.415) -- 0:00:29
507000 -- (-631.892) [-628.746] (-629.070) (-632.940) * (-629.266) [-631.367] (-631.273) (-630.770) -- 0:00:30
507500 -- (-631.833) [-630.779] (-630.604) (-630.698) * (-634.451) [-632.810] (-630.157) (-633.814) -- 0:00:30
508000 -- [-629.250] (-629.006) (-630.961) (-631.639) * [-633.868] (-630.248) (-634.612) (-630.256) -- 0:00:30
508500 -- (-631.082) (-632.462) (-629.597) [-631.343] * (-630.988) [-630.267] (-631.210) (-632.529) -- 0:00:29
509000 -- (-631.553) [-632.717] (-629.422) (-629.092) * (-630.991) [-635.667] (-632.789) (-634.161) -- 0:00:29
509500 -- (-629.693) (-631.602) (-628.530) [-631.349] * [-632.030] (-635.195) (-632.688) (-630.022) -- 0:00:29
510000 -- (-631.306) [-632.788] (-631.212) (-633.927) * [-629.342] (-635.330) (-629.412) (-629.923) -- 0:00:29
Average standard deviation of split frequencies: 0.010317
510500 -- (-631.264) (-630.486) (-631.594) [-630.631] * (-628.836) [-632.488] (-633.970) (-632.700) -- 0:00:29
511000 -- (-630.485) (-629.608) (-632.253) [-630.770] * (-631.152) (-632.044) [-631.329] (-630.191) -- 0:00:29
511500 -- (-629.385) (-630.014) (-630.605) [-631.844] * (-630.293) [-631.574] (-630.529) (-631.645) -- 0:00:29
512000 -- (-633.419) [-630.232] (-631.004) (-629.663) * [-631.507] (-633.515) (-630.196) (-633.508) -- 0:00:29
512500 -- (-632.201) [-630.804] (-630.837) (-629.894) * (-631.102) (-630.790) (-639.335) [-631.839] -- 0:00:29
513000 -- (-633.536) [-631.759] (-635.228) (-631.718) * [-631.247] (-630.990) (-631.027) (-632.821) -- 0:00:29
513500 -- (-629.808) [-629.898] (-631.534) (-628.683) * (-630.319) (-631.494) (-629.137) [-631.766] -- 0:00:29
514000 -- (-631.548) [-629.876] (-631.536) (-631.875) * (-629.712) (-629.895) (-630.153) [-629.944] -- 0:00:29
514500 -- (-633.951) [-631.915] (-631.236) (-628.526) * [-631.031] (-633.799) (-632.127) (-632.644) -- 0:00:29
515000 -- (-635.138) [-630.157] (-631.522) (-629.338) * [-632.157] (-630.792) (-629.973) (-630.552) -- 0:00:29
Average standard deviation of split frequencies: 0.010802
515500 -- (-631.849) [-633.743] (-629.001) (-632.179) * (-630.392) (-629.248) [-629.987] (-634.329) -- 0:00:29
516000 -- (-629.843) (-628.937) [-629.810] (-629.322) * [-630.641] (-631.686) (-632.475) (-629.759) -- 0:00:29
516500 -- [-628.694] (-628.973) (-630.540) (-629.970) * (-634.162) (-630.033) (-633.156) [-630.097] -- 0:00:29
517000 -- (-629.954) [-629.116] (-628.633) (-629.992) * (-633.607) (-630.204) (-630.366) [-631.967] -- 0:00:28
517500 -- (-631.242) (-629.681) [-635.282] (-630.144) * (-634.105) (-631.067) (-630.115) [-631.095] -- 0:00:28
518000 -- (-629.799) [-629.902] (-629.165) (-629.655) * (-631.663) [-630.244] (-630.201) (-632.115) -- 0:00:28
518500 -- [-629.744] (-630.259) (-630.083) (-630.484) * [-633.515] (-630.304) (-629.550) (-630.733) -- 0:00:28
519000 -- (-632.054) (-629.861) [-629.514] (-632.410) * (-631.039) (-631.502) [-629.295] (-631.248) -- 0:00:28
519500 -- [-630.569] (-631.056) (-629.930) (-631.674) * (-632.437) (-632.536) [-628.759] (-630.174) -- 0:00:28
520000 -- (-634.251) (-630.663) [-628.762] (-630.019) * [-632.115] (-632.061) (-630.645) (-631.164) -- 0:00:28
Average standard deviation of split frequencies: 0.010332
520500 -- [-629.786] (-630.588) (-630.263) (-630.988) * (-632.494) (-631.448) [-630.763] (-631.939) -- 0:00:28
521000 -- (-637.275) [-630.668] (-630.486) (-630.343) * (-631.367) [-631.819] (-629.933) (-634.053) -- 0:00:28
521500 -- (-631.990) (-632.092) (-633.993) [-631.025] * (-631.121) [-629.209] (-630.313) (-632.349) -- 0:00:28
522000 -- (-632.100) (-631.660) (-630.966) [-631.809] * [-630.085] (-629.393) (-630.227) (-630.275) -- 0:00:28
522500 -- [-634.367] (-635.078) (-631.017) (-629.527) * (-633.162) [-629.697] (-630.035) (-630.098) -- 0:00:28
523000 -- (-632.302) (-629.611) (-631.063) [-629.631] * (-630.124) (-628.885) [-630.061] (-630.098) -- 0:00:28
523500 -- [-631.531] (-633.041) (-631.379) (-630.221) * (-630.240) [-628.887] (-632.044) (-632.745) -- 0:00:29
524000 -- (-631.969) (-631.383) [-630.518] (-629.207) * (-629.788) (-629.040) [-629.531] (-633.536) -- 0:00:29
524500 -- [-629.992] (-630.104) (-632.152) (-628.805) * (-631.694) (-629.027) (-630.549) [-635.839] -- 0:00:29
525000 -- [-629.812] (-629.832) (-630.897) (-633.142) * (-632.678) (-633.717) (-631.401) [-629.931] -- 0:00:28
Average standard deviation of split frequencies: 0.010754
525500 -- (-630.356) (-628.822) [-629.528] (-630.336) * (-630.758) (-633.427) (-632.644) [-630.112] -- 0:00:28
526000 -- (-628.706) (-629.501) (-628.889) [-631.093] * (-629.440) [-628.920] (-634.460) (-630.779) -- 0:00:28
526500 -- (-629.433) (-629.146) (-630.803) [-638.466] * (-631.288) (-630.078) (-635.029) [-629.343] -- 0:00:28
527000 -- (-631.773) [-630.441] (-631.542) (-633.597) * (-630.865) (-629.733) [-631.269] (-630.448) -- 0:00:28
527500 -- [-630.647] (-629.568) (-632.899) (-631.065) * (-630.557) (-634.810) [-629.858] (-630.625) -- 0:00:28
528000 -- (-629.672) (-630.181) (-631.586) [-629.624] * (-632.625) (-632.561) [-630.241] (-629.831) -- 0:00:28
528500 -- [-629.783] (-629.618) (-629.559) (-637.253) * (-633.555) [-633.770] (-628.853) (-631.875) -- 0:00:28
529000 -- (-631.579) [-630.273] (-631.811) (-629.535) * [-635.409] (-632.421) (-632.441) (-639.409) -- 0:00:28
529500 -- (-629.535) [-629.859] (-630.550) (-629.520) * (-630.658) (-632.533) (-629.179) [-632.272] -- 0:00:28
530000 -- (-630.160) [-628.724] (-629.666) (-629.431) * (-631.303) (-631.371) [-629.058] (-631.553) -- 0:00:28
Average standard deviation of split frequencies: 0.010817
530500 -- [-630.558] (-630.523) (-630.693) (-632.427) * (-630.816) [-629.913] (-628.776) (-629.884) -- 0:00:28
531000 -- (-631.737) (-631.257) [-629.994] (-632.422) * (-631.778) (-629.089) (-629.386) [-631.287] -- 0:00:28
531500 -- (-632.386) (-631.002) [-630.094] (-629.383) * (-631.412) (-631.333) (-632.681) [-631.833] -- 0:00:28
532000 -- (-635.637) [-632.324] (-630.577) (-630.012) * (-631.230) (-632.945) (-629.611) [-631.996] -- 0:00:28
532500 -- (-631.444) [-629.562] (-632.571) (-629.307) * (-630.797) (-632.924) [-629.624] (-631.852) -- 0:00:28
533000 -- (-629.227) (-631.756) (-632.342) [-630.794] * [-629.640] (-630.260) (-628.870) (-632.931) -- 0:00:28
533500 -- [-633.568] (-630.095) (-635.992) (-629.699) * (-628.995) [-633.398] (-629.522) (-633.051) -- 0:00:27
534000 -- (-631.840) (-631.596) [-628.883] (-629.876) * (-629.805) (-633.085) (-629.397) [-632.876] -- 0:00:27
534500 -- (-634.192) (-633.533) [-630.521] (-629.364) * (-628.598) (-633.560) [-629.195] (-632.835) -- 0:00:27
535000 -- (-629.850) (-634.291) (-631.562) [-629.218] * (-630.457) (-631.648) (-631.105) [-631.172] -- 0:00:27
Average standard deviation of split frequencies: 0.010813
535500 -- (-631.639) [-632.178] (-631.343) (-630.651) * [-631.092] (-631.644) (-631.693) (-631.284) -- 0:00:27
536000 -- (-631.129) (-632.114) (-630.637) [-630.857] * (-632.389) [-632.326] (-631.024) (-635.046) -- 0:00:27
536500 -- (-630.281) (-633.367) [-630.038] (-629.383) * [-630.761] (-629.008) (-634.009) (-632.839) -- 0:00:27
537000 -- (-630.029) (-629.417) (-629.398) [-632.727] * [-630.589] (-636.829) (-630.711) (-630.472) -- 0:00:27
537500 -- (-630.599) [-630.094] (-632.151) (-630.960) * (-629.747) (-630.486) [-632.040] (-631.986) -- 0:00:27
538000 -- [-629.771] (-629.905) (-628.681) (-630.585) * [-629.527] (-630.089) (-629.485) (-635.047) -- 0:00:27
538500 -- (-630.027) (-630.825) [-628.851] (-629.579) * (-633.272) [-629.736] (-632.820) (-629.832) -- 0:00:27
539000 -- [-630.361] (-631.224) (-629.399) (-635.163) * (-634.480) [-629.734] (-632.584) (-633.467) -- 0:00:27
539500 -- (-630.582) [-631.683] (-630.468) (-631.373) * (-632.041) [-629.420] (-632.261) (-633.888) -- 0:00:27
540000 -- [-629.264] (-630.653) (-630.463) (-629.959) * (-630.242) [-631.786] (-629.138) (-629.754) -- 0:00:27
Average standard deviation of split frequencies: 0.010617
540500 -- (-629.407) (-632.070) [-628.772] (-628.951) * (-630.997) (-630.619) [-629.441] (-632.494) -- 0:00:28
541000 -- (-630.685) [-632.134] (-629.729) (-629.752) * (-630.313) (-631.758) (-633.162) [-629.615] -- 0:00:27
541500 -- (-631.538) [-631.641] (-629.727) (-630.239) * (-629.595) (-632.839) [-630.283] (-629.551) -- 0:00:27
542000 -- (-633.319) (-632.195) (-630.551) [-630.713] * (-631.166) (-630.191) (-632.718) [-628.496] -- 0:00:27
542500 -- (-628.834) [-632.701] (-634.988) (-632.119) * (-630.467) (-630.619) (-630.047) [-628.891] -- 0:00:27
543000 -- (-628.767) [-629.856] (-630.286) (-632.691) * (-632.922) [-628.599] (-631.331) (-629.574) -- 0:00:27
543500 -- [-629.799] (-630.492) (-630.531) (-631.316) * [-633.658] (-631.860) (-631.878) (-633.380) -- 0:00:27
544000 -- (-630.854) [-629.643] (-630.269) (-630.228) * (-630.603) [-632.031] (-630.067) (-636.110) -- 0:00:27
544500 -- (-630.720) (-630.707) [-635.715] (-632.827) * (-629.678) (-630.430) [-630.717] (-633.229) -- 0:00:27
545000 -- (-630.738) (-631.116) (-641.446) [-630.213] * (-628.911) (-633.029) [-629.703] (-631.003) -- 0:00:27
Average standard deviation of split frequencies: 0.009954
545500 -- [-630.620] (-630.837) (-631.156) (-630.405) * (-632.439) [-629.504] (-629.500) (-631.656) -- 0:00:27
546000 -- (-635.283) (-630.409) (-631.557) [-629.742] * (-632.511) [-630.530] (-631.111) (-631.458) -- 0:00:27
546500 -- [-629.732] (-631.968) (-632.699) (-629.642) * (-629.828) (-633.201) [-629.196] (-628.728) -- 0:00:27
547000 -- (-630.591) (-629.856) [-634.720] (-630.986) * (-635.733) (-632.213) (-633.296) [-629.221] -- 0:00:27
547500 -- (-630.363) (-629.496) (-631.801) [-632.007] * [-630.963] (-629.245) (-631.853) (-630.384) -- 0:00:27
548000 -- [-632.829] (-630.140) (-630.308) (-631.442) * (-633.404) (-630.182) (-630.545) [-632.269] -- 0:00:27
548500 -- (-629.668) (-630.561) [-629.801] (-629.587) * (-635.483) (-629.693) (-630.278) [-634.028] -- 0:00:27
549000 -- (-631.554) [-630.355] (-628.939) (-630.299) * (-630.590) (-629.449) (-632.910) [-633.444] -- 0:00:27
549500 -- [-630.329] (-629.918) (-630.253) (-629.771) * (-630.360) (-632.719) [-629.122] (-631.605) -- 0:00:27
550000 -- [-630.851] (-631.192) (-630.023) (-633.995) * (-630.276) [-630.151] (-630.481) (-632.597) -- 0:00:27
Average standard deviation of split frequencies: 0.009203
550500 -- (-633.087) [-635.036] (-632.906) (-632.764) * (-631.105) [-631.266] (-634.487) (-632.220) -- 0:00:26
551000 -- (-633.379) (-630.662) [-631.532] (-631.017) * (-634.148) [-632.210] (-632.688) (-628.583) -- 0:00:26
551500 -- (-630.595) (-628.742) [-629.179] (-632.014) * (-631.814) [-629.590] (-631.089) (-632.759) -- 0:00:26
552000 -- [-632.213] (-630.442) (-632.641) (-629.682) * (-633.085) (-632.042) [-628.622] (-632.527) -- 0:00:26
552500 -- (-629.758) [-629.470] (-629.485) (-630.312) * (-629.248) [-630.814] (-629.906) (-630.866) -- 0:00:26
553000 -- (-632.020) [-629.309] (-635.014) (-629.489) * [-629.615] (-630.594) (-633.521) (-633.750) -- 0:00:26
553500 -- (-630.210) (-629.869) [-632.182] (-628.798) * (-632.629) (-630.099) (-629.070) [-630.469] -- 0:00:26
554000 -- (-631.155) [-630.854] (-631.161) (-630.585) * (-632.922) (-629.802) [-633.052] (-634.355) -- 0:00:26
554500 -- [-631.564] (-631.051) (-631.414) (-633.484) * (-631.590) (-631.050) [-631.628] (-629.649) -- 0:00:26
555000 -- (-629.284) [-630.714] (-632.026) (-633.413) * (-632.126) (-632.633) [-631.793] (-631.092) -- 0:00:26
Average standard deviation of split frequencies: 0.009432
555500 -- (-632.840) (-631.037) (-629.232) [-630.106] * [-631.295] (-629.923) (-629.547) (-631.269) -- 0:00:26
556000 -- (-632.632) [-629.236] (-629.203) (-637.839) * [-629.837] (-629.872) (-629.219) (-632.428) -- 0:00:26
556500 -- [-632.619] (-629.774) (-632.543) (-637.900) * [-628.963] (-628.828) (-633.153) (-636.559) -- 0:00:26
557000 -- (-629.664) (-631.246) [-630.152] (-633.522) * (-630.133) [-629.835] (-632.724) (-630.506) -- 0:00:26
557500 -- (-629.274) (-629.379) (-630.609) [-631.236] * (-631.644) (-629.740) [-633.606] (-630.587) -- 0:00:26
558000 -- [-629.289] (-630.302) (-631.030) (-636.599) * (-629.610) (-629.500) (-631.726) [-632.969] -- 0:00:26
558500 -- (-630.468) [-630.042] (-631.466) (-632.467) * [-630.692] (-629.955) (-632.011) (-632.440) -- 0:00:26
559000 -- (-629.794) (-629.867) (-631.736) [-631.066] * [-630.265] (-630.152) (-629.996) (-632.313) -- 0:00:26
559500 -- [-631.011] (-631.493) (-629.997) (-631.379) * (-630.676) [-634.687] (-630.695) (-629.635) -- 0:00:26
560000 -- (-636.828) [-630.478] (-629.931) (-630.985) * (-632.290) (-628.673) (-633.356) [-629.742] -- 0:00:26
Average standard deviation of split frequencies: 0.008632
560500 -- [-633.985] (-630.827) (-629.700) (-628.720) * [-631.305] (-629.351) (-629.608) (-637.130) -- 0:00:26
561000 -- (-632.943) [-629.132] (-629.504) (-628.781) * (-631.506) (-631.328) [-630.754] (-629.124) -- 0:00:26
561500 -- (-631.695) (-628.761) (-630.317) [-629.320] * (-630.873) [-630.483] (-631.254) (-629.079) -- 0:00:26
562000 -- (-629.732) [-629.829] (-629.341) (-630.996) * (-631.238) [-629.300] (-632.071) (-631.899) -- 0:00:26
562500 -- (-632.141) (-634.671) (-631.179) [-629.547] * (-630.681) (-631.695) [-630.721] (-630.655) -- 0:00:26
563000 -- (-631.394) (-632.017) (-630.460) [-629.884] * (-630.055) (-631.904) [-629.823] (-631.391) -- 0:00:26
563500 -- (-634.788) (-630.022) [-632.382] (-634.041) * (-631.149) (-631.222) (-628.843) [-632.629] -- 0:00:26
564000 -- (-631.741) (-632.529) [-630.177] (-631.439) * [-630.186] (-630.423) (-630.157) (-631.156) -- 0:00:26
564500 -- (-633.402) [-628.998] (-630.046) (-633.535) * [-631.886] (-628.507) (-630.554) (-630.394) -- 0:00:26
565000 -- (-630.171) (-629.447) (-630.179) [-629.379] * (-630.484) [-629.599] (-630.035) (-631.431) -- 0:00:26
Average standard deviation of split frequencies: 0.009110
565500 -- (-630.984) [-633.538] (-630.086) (-633.183) * (-631.319) (-632.699) (-628.961) [-629.133] -- 0:00:26
566000 -- (-635.903) (-632.443) [-632.661] (-630.142) * (-639.478) (-629.786) (-629.356) [-633.548] -- 0:00:26
566500 -- [-631.043] (-633.331) (-635.511) (-630.653) * (-629.998) (-633.197) [-631.083] (-634.102) -- 0:00:26
567000 -- (-632.690) (-632.710) (-632.877) [-631.212] * (-629.818) (-634.366) [-632.054] (-631.075) -- 0:00:25
567500 -- (-630.544) (-629.778) [-629.839] (-631.706) * [-632.191] (-634.766) (-633.880) (-630.440) -- 0:00:25
568000 -- [-632.384] (-629.986) (-630.541) (-630.998) * (-630.755) [-629.073] (-632.346) (-632.636) -- 0:00:25
568500 -- (-635.006) [-630.478] (-631.042) (-630.416) * [-630.595] (-629.959) (-632.891) (-630.901) -- 0:00:25
569000 -- (-632.507) (-631.186) [-632.030] (-630.570) * (-632.852) (-631.260) [-630.879] (-629.986) -- 0:00:25
569500 -- (-631.679) (-631.620) [-629.699] (-631.344) * (-632.737) (-628.916) (-630.488) [-631.549] -- 0:00:25
570000 -- (-632.574) (-633.066) [-633.455] (-630.450) * [-632.703] (-628.962) (-630.018) (-631.022) -- 0:00:25
Average standard deviation of split frequencies: 0.008570
570500 -- (-630.765) [-633.122] (-630.709) (-630.999) * (-630.598) [-632.111] (-637.856) (-632.040) -- 0:00:25
571000 -- (-629.395) [-633.508] (-632.020) (-629.918) * (-630.465) (-633.229) [-629.946] (-631.980) -- 0:00:25
571500 -- (-630.272) [-634.030] (-632.936) (-631.556) * (-629.382) (-633.397) (-632.579) [-633.298] -- 0:00:25
572000 -- (-632.132) (-632.981) (-630.351) [-632.739] * [-629.083] (-631.886) (-633.487) (-634.976) -- 0:00:25
572500 -- [-630.104] (-631.181) (-630.677) (-632.355) * [-629.456] (-634.323) (-629.443) (-632.689) -- 0:00:25
573000 -- (-630.067) (-631.291) (-630.043) [-628.999] * [-629.409] (-630.651) (-630.065) (-629.603) -- 0:00:25
573500 -- (-630.809) (-636.528) (-631.062) [-629.206] * (-631.947) (-629.303) [-630.302] (-630.906) -- 0:00:25
574000 -- (-637.303) (-632.442) (-630.821) [-630.307] * [-633.556] (-631.298) (-630.446) (-630.511) -- 0:00:25
574500 -- (-629.464) [-631.078] (-630.974) (-629.475) * (-633.163) (-630.148) (-629.950) [-629.703] -- 0:00:25
575000 -- (-631.844) [-631.346] (-634.591) (-630.491) * (-630.220) (-630.705) (-629.141) [-630.678] -- 0:00:25
Average standard deviation of split frequencies: 0.008082
575500 -- [-631.861] (-629.028) (-631.393) (-631.610) * (-629.085) [-629.152] (-633.384) (-631.218) -- 0:00:25
576000 -- (-630.487) (-629.773) [-632.288] (-629.430) * [-629.619] (-631.599) (-631.960) (-630.190) -- 0:00:25
576500 -- (-631.365) (-629.655) (-629.975) [-631.246] * (-630.436) (-633.293) (-629.087) [-628.996] -- 0:00:25
577000 -- [-633.806] (-631.312) (-630.290) (-629.222) * (-630.190) (-631.542) [-633.301] (-629.230) -- 0:00:25
577500 -- (-633.952) [-629.762] (-628.458) (-629.195) * [-630.435] (-634.408) (-631.927) (-631.115) -- 0:00:25
578000 -- [-635.600] (-630.725) (-633.117) (-630.369) * (-634.153) [-631.575] (-631.480) (-631.005) -- 0:00:25
578500 -- (-634.053) (-631.692) (-632.985) [-631.963] * [-631.698] (-629.934) (-635.363) (-631.341) -- 0:00:25
579000 -- (-632.777) (-629.212) [-633.942] (-633.827) * (-632.714) [-628.806] (-632.021) (-631.837) -- 0:00:25
579500 -- [-629.161] (-629.506) (-631.959) (-630.109) * (-629.542) (-634.662) (-631.070) [-632.373] -- 0:00:25
580000 -- [-630.932] (-633.062) (-631.621) (-629.498) * (-632.244) [-629.430] (-630.087) (-629.618) -- 0:00:25
Average standard deviation of split frequencies: 0.007361
580500 -- (-631.014) [-633.075] (-631.706) (-630.591) * (-629.699) (-635.747) [-632.666] (-633.760) -- 0:00:25
581000 -- (-631.513) (-629.887) [-633.123] (-631.472) * (-629.065) (-631.349) (-631.039) [-630.310] -- 0:00:25
581500 -- (-631.650) (-630.570) (-630.535) [-633.414] * (-629.811) [-629.544] (-631.682) (-632.438) -- 0:00:25
582000 -- [-631.333] (-631.339) (-629.932) (-632.646) * (-629.334) (-630.471) (-631.776) [-629.764] -- 0:00:25
582500 -- (-632.695) (-629.506) (-633.161) [-631.325] * [-629.333] (-631.968) (-630.613) (-629.139) -- 0:00:25
583000 -- (-631.235) (-630.905) [-632.916] (-631.308) * (-628.808) (-631.141) (-630.487) [-629.570] -- 0:00:25
583500 -- (-630.042) (-632.324) [-630.022] (-631.537) * (-632.376) [-629.886] (-631.276) (-630.919) -- 0:00:24
584000 -- [-629.171] (-630.401) (-629.235) (-629.630) * (-632.582) (-632.427) (-628.970) [-630.066] -- 0:00:24
584500 -- [-632.036] (-632.586) (-630.662) (-631.294) * (-630.795) (-635.217) (-630.490) [-631.074] -- 0:00:24
585000 -- (-631.751) (-632.085) [-630.669] (-629.197) * (-629.391) (-632.118) (-631.336) [-630.132] -- 0:00:24
Average standard deviation of split frequencies: 0.007133
585500 -- (-630.948) (-634.792) [-630.685] (-630.923) * (-630.790) (-631.338) [-629.506] (-637.602) -- 0:00:24
586000 -- (-629.534) (-630.342) [-629.995] (-629.124) * (-631.629) (-631.905) (-631.865) [-631.946] -- 0:00:24
586500 -- (-630.661) (-632.014) (-629.714) [-628.907] * (-629.653) [-631.650] (-633.106) (-634.346) -- 0:00:24
587000 -- (-631.080) (-630.137) [-629.417] (-628.908) * [-629.481] (-628.905) (-632.546) (-631.527) -- 0:00:24
587500 -- (-632.559) (-631.993) [-630.237] (-631.120) * (-630.289) [-630.001] (-631.554) (-631.392) -- 0:00:24
588000 -- [-629.640] (-630.101) (-630.218) (-632.272) * (-630.795) [-632.122] (-629.999) (-633.264) -- 0:00:24
588500 -- (-629.546) [-630.236] (-630.850) (-629.575) * (-633.138) [-629.882] (-630.435) (-632.776) -- 0:00:24
589000 -- (-630.040) [-630.889] (-630.728) (-629.575) * (-629.902) (-629.251) (-630.317) [-630.474] -- 0:00:24
589500 -- (-630.209) [-630.290] (-631.332) (-630.493) * [-632.053] (-629.043) (-629.816) (-629.985) -- 0:00:24
590000 -- (-630.612) [-629.090] (-631.361) (-631.329) * (-633.928) [-628.777] (-630.896) (-638.695) -- 0:00:24
Average standard deviation of split frequencies: 0.007396
590500 -- (-630.797) [-635.256] (-633.439) (-631.711) * [-630.870] (-629.863) (-631.222) (-632.639) -- 0:00:24
591000 -- [-630.406] (-633.642) (-635.101) (-633.004) * (-635.456) [-630.089] (-632.911) (-630.386) -- 0:00:24
591500 -- (-630.746) (-638.429) [-630.909] (-629.477) * (-630.558) [-630.069] (-632.613) (-630.651) -- 0:00:24
592000 -- (-631.829) (-631.796) (-631.159) [-629.317] * (-630.585) [-630.285] (-634.499) (-631.573) -- 0:00:24
592500 -- (-630.123) [-632.512] (-629.239) (-629.715) * (-630.912) (-629.082) [-629.715] (-630.834) -- 0:00:24
593000 -- (-631.048) [-634.182] (-630.101) (-630.290) * (-629.009) (-628.785) [-628.694] (-630.197) -- 0:00:24
593500 -- [-635.005] (-629.523) (-629.846) (-633.292) * [-630.612] (-631.272) (-630.283) (-632.950) -- 0:00:24
594000 -- (-631.609) [-630.001] (-630.326) (-633.060) * (-631.970) (-630.746) (-631.385) [-630.022] -- 0:00:24
594500 -- (-631.270) (-632.995) [-629.495] (-630.660) * (-630.376) (-631.883) [-631.537] (-629.085) -- 0:00:24
595000 -- (-631.141) (-631.535) [-633.771] (-629.725) * (-630.875) [-630.805] (-629.390) (-631.696) -- 0:00:24
Average standard deviation of split frequencies: 0.006591
595500 -- [-630.065] (-628.914) (-630.739) (-630.230) * (-630.382) (-629.858) (-633.931) [-632.977] -- 0:00:24
596000 -- (-634.931) (-629.102) [-630.124] (-629.338) * [-629.307] (-631.250) (-631.442) (-634.982) -- 0:00:24
596500 -- (-632.147) (-631.884) (-631.336) [-632.116] * [-631.694] (-630.866) (-630.088) (-631.350) -- 0:00:24
597000 -- (-634.018) [-631.640] (-633.629) (-631.194) * (-631.059) [-629.091] (-631.902) (-629.433) -- 0:00:24
597500 -- (-631.955) [-630.729] (-629.188) (-633.445) * (-631.639) [-629.080] (-634.631) (-630.605) -- 0:00:24
598000 -- [-629.840] (-630.037) (-630.841) (-632.265) * [-631.347] (-630.052) (-629.677) (-631.838) -- 0:00:24
598500 -- (-633.514) [-631.296] (-631.698) (-630.977) * (-629.972) (-629.977) (-635.216) [-630.002] -- 0:00:24
599000 -- (-633.408) (-632.193) (-630.488) [-629.374] * [-630.290] (-630.166) (-634.801) (-629.717) -- 0:00:24
599500 -- (-629.346) (-629.383) (-632.038) [-629.385] * (-632.491) (-633.962) (-630.562) [-630.122] -- 0:00:24
600000 -- [-631.207] (-631.411) (-631.478) (-629.939) * (-632.315) (-630.038) (-629.765) [-629.795] -- 0:00:24
Average standard deviation of split frequencies: 0.007482
600500 -- (-629.376) (-632.373) [-631.710] (-631.046) * (-632.496) [-629.597] (-635.043) (-634.657) -- 0:00:23
601000 -- (-629.796) (-631.045) (-629.335) [-630.420] * (-629.606) [-629.810] (-629.899) (-636.918) -- 0:00:23
601500 -- (-632.741) (-634.379) [-629.254] (-630.091) * (-630.538) (-629.239) (-635.911) [-630.644] -- 0:00:23
602000 -- (-632.136) [-630.980] (-629.762) (-631.828) * (-632.605) (-631.253) (-633.251) [-629.794] -- 0:00:23
602500 -- (-633.884) [-636.757] (-629.866) (-633.655) * (-638.387) (-630.193) (-629.629) [-630.585] -- 0:00:23
603000 -- (-630.084) (-630.126) [-631.372] (-631.951) * (-631.983) [-630.686] (-629.294) (-636.721) -- 0:00:23
603500 -- [-631.687] (-630.563) (-637.443) (-629.064) * (-633.505) (-630.194) [-630.652] (-631.795) -- 0:00:23
604000 -- (-631.730) (-630.645) (-629.159) [-629.070] * [-634.566] (-630.345) (-629.223) (-631.415) -- 0:00:23
604500 -- (-630.022) (-630.949) (-629.445) [-629.773] * (-631.458) (-629.339) (-632.128) [-629.913] -- 0:00:23
605000 -- (-632.719) [-631.111] (-629.856) (-629.571) * (-632.704) (-628.802) [-632.780] (-630.788) -- 0:00:23
Average standard deviation of split frequencies: 0.007053
605500 -- (-631.902) (-633.196) (-630.009) [-629.473] * [-629.789] (-628.865) (-630.870) (-631.391) -- 0:00:23
606000 -- (-630.419) [-633.434] (-631.469) (-632.221) * (-629.472) (-629.943) [-631.422] (-628.934) -- 0:00:23
606500 -- [-631.133] (-633.689) (-629.801) (-629.144) * (-630.491) (-630.768) (-634.473) [-630.677] -- 0:00:23
607000 -- (-631.208) (-632.413) [-629.369] (-630.398) * [-630.577] (-630.785) (-635.122) (-630.740) -- 0:00:23
607500 -- [-631.255] (-631.908) (-629.186) (-635.520) * (-629.069) (-629.754) (-630.968) [-629.631] -- 0:00:23
608000 -- [-631.708] (-631.892) (-630.167) (-631.486) * (-632.162) (-630.341) [-628.954] (-628.954) -- 0:00:23
608500 -- (-629.332) (-633.043) [-632.742] (-633.068) * (-631.846) (-629.066) (-630.972) [-629.138] -- 0:00:23
609000 -- (-630.459) (-630.828) [-631.652] (-629.454) * (-631.290) (-635.218) (-630.320) [-630.805] -- 0:00:23
609500 -- (-638.265) (-629.492) [-630.695] (-629.819) * (-635.893) [-630.715] (-631.050) (-629.207) -- 0:00:23
610000 -- (-635.169) (-629.412) (-637.839) [-629.913] * [-630.129] (-631.435) (-631.713) (-631.157) -- 0:00:23
Average standard deviation of split frequencies: 0.006896
610500 -- (-632.546) (-628.856) (-632.545) [-630.704] * (-630.310) (-632.103) [-629.012] (-630.277) -- 0:00:23
611000 -- [-631.717] (-631.428) (-631.860) (-632.312) * (-631.323) [-629.810] (-628.583) (-629.978) -- 0:00:23
611500 -- (-630.703) [-630.200] (-632.573) (-630.950) * (-631.450) (-630.429) [-629.666] (-632.930) -- 0:00:23
612000 -- (-629.282) (-630.211) (-635.256) [-630.421] * (-632.421) [-629.135] (-629.186) (-631.008) -- 0:00:23
612500 -- (-632.006) (-631.554) (-629.857) [-634.312] * (-629.120) (-629.530) (-632.011) [-630.580] -- 0:00:23
613000 -- [-631.794] (-633.716) (-629.605) (-631.730) * (-628.536) (-631.918) [-632.770] (-633.562) -- 0:00:23
613500 -- (-630.048) (-635.145) [-633.124] (-629.008) * (-629.307) (-630.543) (-632.423) [-634.675] -- 0:00:23
614000 -- (-635.292) (-629.610) [-633.039] (-628.876) * (-631.223) (-631.516) (-635.469) [-631.559] -- 0:00:23
614500 -- [-629.997] (-629.626) (-631.822) (-631.191) * (-630.743) (-629.268) [-631.767] (-632.570) -- 0:00:23
615000 -- (-631.905) (-629.376) (-630.436) [-633.201] * (-632.975) [-629.256] (-631.983) (-631.909) -- 0:00:23
Average standard deviation of split frequencies: 0.007194
615500 -- (-629.762) (-631.423) (-629.012) [-630.644] * (-632.960) (-629.034) [-630.743] (-629.176) -- 0:00:23
616000 -- (-630.981) [-631.247] (-630.101) (-630.771) * (-631.446) (-629.031) [-629.672] (-629.063) -- 0:00:23
616500 -- [-628.546] (-630.836) (-629.350) (-630.288) * (-630.479) (-631.452) [-630.611] (-629.235) -- 0:00:23
617000 -- (-629.656) [-629.306] (-633.843) (-631.165) * (-631.004) [-631.149] (-633.879) (-630.593) -- 0:00:22
617500 -- [-630.402] (-632.313) (-632.262) (-631.008) * (-630.793) (-630.846) (-640.133) [-630.102] -- 0:00:22
618000 -- (-630.212) [-630.158] (-634.060) (-637.163) * (-632.952) [-629.659] (-630.566) (-633.227) -- 0:00:22
618500 -- (-634.273) [-630.875] (-631.637) (-637.600) * (-630.785) [-631.414] (-630.846) (-631.294) -- 0:00:22
619000 -- (-630.748) (-629.670) (-631.857) [-631.761] * (-632.356) (-631.742) [-628.641] (-633.415) -- 0:00:22
619500 -- (-629.729) [-630.893] (-629.846) (-629.351) * (-633.163) (-631.336) (-632.348) [-630.401] -- 0:00:22
620000 -- (-630.349) (-630.316) [-629.871] (-630.374) * (-631.087) (-630.091) (-631.069) [-630.448] -- 0:00:22
Average standard deviation of split frequencies: 0.007190
620500 -- (-631.071) [-631.815] (-631.163) (-631.063) * (-630.060) [-628.791] (-628.794) (-632.678) -- 0:00:22
621000 -- [-632.540] (-630.210) (-630.997) (-630.868) * (-629.576) [-628.948] (-629.414) (-632.037) -- 0:00:22
621500 -- (-632.308) (-628.921) [-631.549] (-630.187) * (-632.470) (-628.868) (-629.129) [-630.710] -- 0:00:22
622000 -- (-632.415) (-630.978) [-629.226] (-629.628) * (-629.469) (-629.416) [-632.537] (-634.486) -- 0:00:22
622500 -- (-631.862) (-632.900) (-630.386) [-629.110] * [-629.226] (-632.556) (-632.353) (-632.387) -- 0:00:22
623000 -- [-629.325] (-632.269) (-630.371) (-629.063) * (-631.334) [-631.981] (-629.772) (-632.600) -- 0:00:22
623500 -- [-630.932] (-631.070) (-630.308) (-629.514) * (-631.012) (-632.568) [-629.342] (-630.320) -- 0:00:22
624000 -- (-631.776) (-629.803) [-628.599] (-630.436) * [-631.166] (-631.220) (-631.201) (-630.137) -- 0:00:22
624500 -- (-633.450) [-629.226] (-629.933) (-631.502) * (-633.112) [-632.163] (-630.086) (-629.543) -- 0:00:22
625000 -- (-634.355) [-628.898] (-632.641) (-632.329) * (-632.763) (-629.682) [-629.786] (-631.703) -- 0:00:22
Average standard deviation of split frequencies: 0.007229
625500 -- (-628.814) (-628.770) (-629.570) [-629.353] * (-630.564) (-632.548) [-630.326] (-628.944) -- 0:00:22
626000 -- [-630.337] (-632.357) (-633.138) (-633.546) * (-631.428) (-630.228) [-634.310] (-630.734) -- 0:00:22
626500 -- (-634.004) (-635.231) (-630.867) [-630.050] * (-631.109) (-631.424) (-630.365) [-632.884] -- 0:00:22
627000 -- (-629.655) (-629.727) [-633.641] (-631.262) * (-630.869) [-629.217] (-630.517) (-630.885) -- 0:00:22
627500 -- [-631.175] (-632.159) (-631.126) (-630.916) * (-634.285) [-630.625] (-629.314) (-629.641) -- 0:00:22
628000 -- (-630.043) [-629.423] (-630.675) (-630.998) * (-631.025) (-636.732) [-629.715] (-631.268) -- 0:00:22
628500 -- (-632.040) [-629.423] (-632.597) (-633.082) * [-631.143] (-630.070) (-633.535) (-636.954) -- 0:00:22
629000 -- (-634.872) (-639.055) [-629.466] (-635.692) * (-629.687) (-629.542) (-636.837) [-631.336] -- 0:00:22
629500 -- (-633.398) [-635.382] (-632.746) (-631.701) * [-629.190] (-636.378) (-632.139) (-630.893) -- 0:00:22
630000 -- (-638.223) (-634.816) [-633.958] (-630.112) * (-629.375) (-629.715) (-629.579) [-630.397] -- 0:00:22
Average standard deviation of split frequencies: 0.006279
630500 -- (-636.905) [-630.743] (-630.825) (-630.251) * [-629.885] (-629.696) (-629.058) (-630.481) -- 0:00:22
631000 -- (-635.037) (-630.732) (-632.635) [-634.015] * [-630.746] (-630.483) (-632.655) (-634.644) -- 0:00:22
631500 -- (-629.190) (-631.539) [-629.142] (-631.768) * (-629.963) (-633.441) [-631.730] (-629.698) -- 0:00:22
632000 -- (-632.697) (-631.133) [-629.691] (-629.039) * [-629.881] (-629.765) (-630.799) (-633.311) -- 0:00:22
632500 -- (-635.140) [-629.470] (-631.235) (-632.236) * (-628.748) (-638.795) [-631.117] (-633.768) -- 0:00:22
633000 -- [-631.204] (-631.520) (-633.199) (-630.879) * (-630.894) [-630.837] (-630.087) (-631.931) -- 0:00:22
633500 -- (-630.056) (-632.194) [-630.363] (-631.279) * (-629.647) (-630.663) (-630.829) [-629.499] -- 0:00:21
634000 -- (-633.320) (-629.158) (-629.990) [-631.022] * (-634.873) (-630.905) (-634.666) [-629.068] -- 0:00:21
634500 -- [-630.226] (-630.188) (-632.323) (-634.108) * (-630.188) [-633.202] (-631.607) (-629.123) -- 0:00:21
635000 -- (-630.898) (-631.206) (-633.050) [-630.221] * (-630.082) (-630.938) (-633.857) [-633.739] -- 0:00:21
Average standard deviation of split frequencies: 0.006078
635500 -- (-629.081) (-631.736) (-630.767) [-631.176] * (-633.053) (-629.808) (-631.147) [-631.864] -- 0:00:21
636000 -- (-630.637) [-630.585] (-638.888) (-633.026) * (-629.837) [-629.096] (-630.468) (-630.738) -- 0:00:21
636500 -- (-630.797) (-632.607) (-629.964) [-630.946] * (-630.183) [-632.649] (-630.893) (-629.576) -- 0:00:21
637000 -- [-630.588] (-630.681) (-631.925) (-631.406) * (-630.103) (-632.187) [-628.813] (-630.142) -- 0:00:21
637500 -- (-629.864) (-633.201) (-634.060) [-631.213] * (-630.486) (-631.325) (-631.528) [-630.684] -- 0:00:21
638000 -- (-630.805) (-630.274) [-633.240] (-630.959) * (-631.361) (-629.762) [-630.793] (-629.226) -- 0:00:21
638500 -- (-632.426) (-630.979) (-633.982) [-629.278] * [-633.281] (-629.678) (-630.161) (-630.790) -- 0:00:21
639000 -- [-630.086] (-629.833) (-632.627) (-630.372) * (-630.916) (-631.803) [-633.089] (-630.770) -- 0:00:21
639500 -- (-633.251) [-631.684] (-632.166) (-629.302) * (-630.931) [-633.996] (-637.904) (-629.840) -- 0:00:21
640000 -- (-631.949) (-632.669) [-630.676] (-630.902) * [-635.275] (-632.576) (-640.192) (-629.007) -- 0:00:21
Average standard deviation of split frequencies: 0.005886
640500 -- (-629.909) (-631.549) [-630.291] (-631.481) * (-633.243) (-632.274) [-631.907] (-629.614) -- 0:00:21
641000 -- (-629.807) (-632.535) [-630.875] (-629.625) * (-631.878) [-629.623] (-633.394) (-630.786) -- 0:00:21
641500 -- (-632.235) (-633.658) (-629.454) [-629.831] * (-631.299) [-630.179] (-630.771) (-635.423) -- 0:00:21
642000 -- (-630.175) [-629.748] (-632.216) (-629.363) * (-628.997) (-631.160) (-629.403) [-631.605] -- 0:00:21
642500 -- (-633.346) [-630.733] (-631.972) (-632.037) * [-629.923] (-632.793) (-630.722) (-630.078) -- 0:00:21
643000 -- (-631.998) (-629.365) (-629.645) [-630.534] * (-630.568) (-635.104) (-630.246) [-631.189] -- 0:00:21
643500 -- (-633.231) [-630.544] (-629.193) (-632.380) * (-630.437) (-631.467) (-631.187) [-631.957] -- 0:00:21
644000 -- (-629.973) (-630.480) [-629.191] (-632.037) * [-629.054] (-632.670) (-633.881) (-632.160) -- 0:00:21
644500 -- (-631.095) (-633.752) [-630.326] (-633.363) * (-629.766) (-632.025) [-635.169] (-632.905) -- 0:00:21
645000 -- (-631.078) (-630.296) (-633.881) [-631.341] * (-630.822) (-631.868) [-630.106] (-630.903) -- 0:00:21
Average standard deviation of split frequencies: 0.005935
645500 -- (-633.909) (-634.183) [-633.766] (-632.518) * (-629.690) (-633.070) [-634.433] (-632.539) -- 0:00:21
646000 -- (-629.944) [-630.372] (-630.253) (-630.199) * (-629.875) (-629.325) (-630.952) [-629.889] -- 0:00:21
646500 -- (-631.094) (-632.599) (-632.197) [-630.161] * (-633.764) [-631.197] (-632.209) (-631.642) -- 0:00:21
647000 -- (-629.817) (-632.914) (-631.405) [-631.082] * [-631.511] (-634.013) (-628.883) (-630.815) -- 0:00:21
647500 -- (-629.270) (-630.617) (-632.422) [-630.293] * (-632.241) [-630.247] (-629.751) (-632.202) -- 0:00:21
648000 -- [-629.923] (-632.184) (-629.936) (-630.454) * (-631.744) (-628.505) [-629.706] (-633.121) -- 0:00:21
648500 -- [-632.229] (-630.672) (-630.978) (-630.245) * (-631.117) (-629.242) (-633.084) [-630.516] -- 0:00:21
649000 -- (-635.535) (-630.593) [-629.701] (-629.237) * (-631.269) (-629.015) [-630.275] (-634.275) -- 0:00:21
649500 -- [-630.477] (-632.886) (-630.192) (-633.489) * (-632.034) (-630.250) [-629.510] (-632.490) -- 0:00:21
650000 -- (-630.353) (-632.634) (-631.215) [-634.145] * (-632.005) (-630.183) [-630.474] (-638.830) -- 0:00:21
Average standard deviation of split frequencies: 0.005603
650500 -- (-630.834) (-633.272) [-630.007] (-631.124) * (-633.796) (-629.044) (-630.251) [-633.142] -- 0:00:20
651000 -- (-630.002) (-631.032) [-629.449] (-632.648) * (-631.091) [-629.155] (-628.815) (-633.173) -- 0:00:20
651500 -- (-629.128) [-632.497] (-629.824) (-630.570) * [-630.598] (-629.006) (-630.505) (-630.382) -- 0:00:20
652000 -- (-629.568) (-631.326) (-630.313) [-631.145] * (-629.606) (-629.585) [-630.394] (-629.944) -- 0:00:20
652500 -- [-629.568] (-633.751) (-631.506) (-633.269) * [-629.497] (-631.805) (-633.138) (-630.231) -- 0:00:20
653000 -- (-628.727) (-633.385) (-631.153) [-633.417] * (-631.935) (-631.152) (-630.008) [-631.112] -- 0:00:20
653500 -- (-630.350) (-633.103) (-633.418) [-628.956] * [-629.429] (-632.333) (-630.071) (-631.916) -- 0:00:20
654000 -- [-629.143] (-631.240) (-632.183) (-633.566) * (-628.512) [-630.919] (-633.000) (-632.479) -- 0:00:20
654500 -- (-632.550) (-631.451) (-631.710) [-632.904] * [-631.120] (-632.943) (-631.821) (-631.750) -- 0:00:20
655000 -- [-632.847] (-632.658) (-632.525) (-633.686) * (-631.770) (-632.542) (-630.485) [-629.855] -- 0:00:20
Average standard deviation of split frequencies: 0.005893
655500 -- (-629.132) (-632.981) [-630.833] (-632.223) * (-631.000) [-631.050] (-631.033) (-630.360) -- 0:00:20
656000 -- (-629.238) (-631.820) [-629.843] (-630.569) * (-629.466) [-630.061] (-630.624) (-629.543) -- 0:00:20
656500 -- (-629.012) (-631.811) (-630.185) [-631.818] * (-633.402) (-628.536) [-629.693] (-630.171) -- 0:00:20
657000 -- (-629.980) (-630.011) (-631.649) [-629.634] * (-631.436) [-628.589] (-633.654) (-629.923) -- 0:00:20
657500 -- (-629.407) [-630.799] (-634.265) (-629.933) * (-629.965) (-631.013) (-630.157) [-631.168] -- 0:00:20
658000 -- (-629.451) [-630.459] (-630.631) (-630.116) * [-636.163] (-635.496) (-629.341) (-631.629) -- 0:00:20
658500 -- (-630.982) (-630.179) (-630.930) [-630.927] * (-631.150) (-631.035) [-636.038] (-629.345) -- 0:00:20
659000 -- (-630.186) [-630.168] (-632.097) (-630.260) * (-629.956) (-632.989) [-636.821] (-631.199) -- 0:00:20
659500 -- (-631.941) [-630.507] (-630.981) (-629.346) * (-630.769) (-630.000) [-633.655] (-629.182) -- 0:00:20
660000 -- (-630.160) [-631.526] (-630.457) (-630.554) * (-630.661) (-630.746) (-631.463) [-631.772] -- 0:00:20
Average standard deviation of split frequencies: 0.005613
660500 -- (-628.582) [-632.224] (-630.517) (-633.688) * (-634.633) [-631.999] (-629.287) (-632.521) -- 0:00:20
661000 -- (-632.750) (-630.481) (-629.930) [-629.953] * [-630.638] (-632.244) (-631.273) (-629.069) -- 0:00:20
661500 -- (-635.103) (-630.695) [-629.485] (-629.177) * (-631.173) (-632.207) [-631.569] (-629.638) -- 0:00:20
662000 -- [-632.564] (-630.082) (-632.431) (-631.529) * [-636.030] (-629.602) (-633.405) (-634.903) -- 0:00:20
662500 -- (-633.276) (-631.422) [-630.058] (-631.508) * (-629.969) (-632.335) (-630.290) [-630.066] -- 0:00:20
663000 -- (-630.413) (-631.870) [-629.408] (-630.223) * [-629.448] (-630.888) (-629.545) (-631.505) -- 0:00:20
663500 -- (-632.532) [-633.801] (-630.878) (-635.171) * [-630.424] (-633.609) (-630.911) (-630.956) -- 0:00:20
664000 -- (-631.593) (-631.262) [-629.740] (-632.658) * (-629.016) (-630.388) [-631.761] (-629.700) -- 0:00:20
664500 -- (-632.637) (-630.319) (-631.560) [-630.026] * (-631.363) (-633.732) [-629.849] (-629.523) -- 0:00:20
665000 -- (-634.998) (-629.698) [-633.357] (-633.431) * (-630.257) [-631.088] (-630.505) (-631.661) -- 0:00:20
Average standard deviation of split frequencies: 0.005521
665500 -- (-630.963) [-631.452] (-629.497) (-630.805) * [-633.374] (-631.761) (-631.224) (-630.459) -- 0:00:20
666000 -- (-632.709) [-632.292] (-630.459) (-631.977) * [-630.962] (-628.813) (-631.085) (-629.072) -- 0:00:20
666500 -- (-630.554) (-630.998) (-629.668) [-629.373] * [-629.359] (-631.233) (-630.271) (-629.690) -- 0:00:20
667000 -- [-629.315] (-629.470) (-638.913) (-632.151) * (-630.445) [-629.063] (-630.107) (-629.842) -- 0:00:19
667500 -- (-629.909) [-629.794] (-633.344) (-632.470) * (-632.312) [-629.288] (-631.327) (-630.135) -- 0:00:19
668000 -- [-632.892] (-629.720) (-633.309) (-631.386) * [-629.955] (-632.455) (-631.158) (-631.058) -- 0:00:19
668500 -- (-632.618) (-630.338) [-630.803] (-630.400) * (-634.384) [-632.758] (-630.024) (-631.293) -- 0:00:19
669000 -- (-632.674) (-628.989) [-635.432] (-632.184) * (-634.423) [-629.986] (-634.661) (-631.244) -- 0:00:19
669500 -- (-630.236) [-629.656] (-633.347) (-630.618) * (-631.816) (-631.403) (-631.569) [-629.638] -- 0:00:19
670000 -- [-629.929] (-638.291) (-634.975) (-631.166) * [-635.336] (-631.619) (-629.489) (-629.579) -- 0:00:19
Average standard deviation of split frequencies: 0.005951
670500 -- (-629.133) (-633.878) (-632.084) [-631.247] * (-630.591) (-629.781) (-630.956) [-629.461] -- 0:00:19
671000 -- (-630.117) [-632.362] (-630.676) (-631.815) * [-632.847] (-630.545) (-629.873) (-630.202) -- 0:00:19
671500 -- (-633.488) (-632.059) (-630.781) [-632.005] * (-632.133) (-632.405) [-628.879] (-637.533) -- 0:00:19
672000 -- (-631.196) (-631.398) (-631.330) [-630.805] * (-630.842) (-634.949) (-629.745) [-631.235] -- 0:00:19
672500 -- [-630.220] (-634.210) (-633.764) (-631.461) * [-629.713] (-633.626) (-630.207) (-629.524) -- 0:00:19
673000 -- (-629.787) [-632.306] (-633.422) (-630.199) * (-629.624) (-635.390) (-629.445) [-634.513] -- 0:00:19
673500 -- (-629.907) [-632.752] (-632.954) (-629.952) * (-631.116) (-631.157) [-629.220] (-638.979) -- 0:00:19
674000 -- (-630.792) (-632.484) [-632.679] (-630.346) * [-631.107] (-629.623) (-629.146) (-637.022) -- 0:00:19
674500 -- (-632.514) [-630.233] (-630.217) (-629.403) * [-630.318] (-630.113) (-631.794) (-629.319) -- 0:00:19
675000 -- (-632.489) (-630.782) (-632.182) [-629.574] * [-629.001] (-629.273) (-631.545) (-630.706) -- 0:00:19
Average standard deviation of split frequencies: 0.005951
675500 -- (-633.053) (-630.049) (-631.474) [-630.846] * (-630.344) (-630.144) [-634.133] (-634.441) -- 0:00:19
676000 -- (-635.019) (-630.171) [-635.713] (-631.969) * (-629.252) (-630.994) (-630.928) [-631.975] -- 0:00:19
676500 -- [-632.032] (-630.906) (-635.789) (-630.898) * [-633.680] (-632.513) (-630.567) (-631.074) -- 0:00:19
677000 -- (-634.874) (-629.587) [-629.310] (-637.437) * (-631.860) (-629.421) (-629.412) [-632.401] -- 0:00:19
677500 -- (-633.315) (-635.762) [-630.712] (-631.756) * (-629.462) [-632.498] (-628.653) (-630.346) -- 0:00:19
678000 -- (-631.026) [-632.227] (-632.357) (-631.604) * [-630.349] (-628.674) (-630.601) (-630.155) -- 0:00:19
678500 -- (-632.839) (-631.693) (-632.982) [-632.201] * (-629.855) [-629.795] (-634.776) (-631.340) -- 0:00:19
679000 -- (-637.904) (-631.374) [-630.317] (-636.203) * (-629.884) [-628.803] (-629.708) (-632.711) -- 0:00:19
679500 -- [-630.706] (-630.953) (-631.593) (-630.708) * (-630.558) (-634.079) [-629.626] (-630.008) -- 0:00:19
680000 -- (-633.220) (-630.698) [-631.402] (-629.971) * [-633.064] (-631.779) (-629.449) (-632.008) -- 0:00:19
Average standard deviation of split frequencies: 0.005633
680500 -- [-630.678] (-629.225) (-630.549) (-631.674) * (-632.776) (-633.744) (-630.312) [-631.106] -- 0:00:19
681000 -- [-630.998] (-629.229) (-630.606) (-630.369) * (-631.735) [-631.514] (-628.933) (-629.940) -- 0:00:19
681500 -- [-629.371] (-628.854) (-629.636) (-634.551) * (-630.227) (-629.827) [-631.226] (-630.383) -- 0:00:19
682000 -- (-631.486) (-631.228) [-631.239] (-630.407) * [-629.382] (-630.069) (-628.849) (-629.788) -- 0:00:19
682500 -- (-630.463) (-631.332) [-635.354] (-631.527) * (-630.695) [-631.511] (-630.162) (-630.795) -- 0:00:19
683000 -- (-631.079) (-631.262) (-633.062) [-632.241] * (-631.654) (-629.796) [-630.611] (-629.827) -- 0:00:19
683500 -- (-631.791) [-630.723] (-635.663) (-634.623) * (-630.427) (-630.405) (-630.992) [-629.500] -- 0:00:18
684000 -- [-629.468] (-638.068) (-633.127) (-631.276) * (-630.864) (-628.861) [-629.484] (-631.229) -- 0:00:18
684500 -- [-631.688] (-633.181) (-628.926) (-628.600) * [-630.456] (-629.177) (-631.628) (-630.274) -- 0:00:18
685000 -- (-632.280) (-631.015) [-631.584] (-630.370) * (-630.498) [-630.748] (-636.052) (-629.892) -- 0:00:18
Average standard deviation of split frequencies: 0.005772
685500 -- (-629.899) (-629.753) (-631.815) [-629.138] * (-635.968) (-629.252) (-631.797) [-632.469] -- 0:00:18
686000 -- [-629.639] (-634.653) (-631.218) (-635.176) * (-637.971) [-629.882] (-631.588) (-630.872) -- 0:00:18
686500 -- [-631.391] (-630.260) (-630.792) (-634.106) * (-633.605) (-629.771) [-629.430] (-629.596) -- 0:00:18
687000 -- (-634.609) (-628.702) [-630.393] (-632.619) * (-633.095) (-629.554) [-632.137] (-635.554) -- 0:00:18
687500 -- (-633.825) (-632.238) [-629.180] (-630.445) * (-632.963) [-629.132] (-629.755) (-629.757) -- 0:00:18
688000 -- (-630.956) (-632.281) [-629.189] (-629.647) * [-631.537] (-628.746) (-631.640) (-631.424) -- 0:00:18
688500 -- (-635.963) (-631.753) (-630.166) [-630.166] * (-630.077) (-629.268) [-630.088] (-630.007) -- 0:00:18
689000 -- (-634.405) (-633.325) [-630.870] (-630.736) * (-630.958) [-631.104] (-632.348) (-632.975) -- 0:00:18
689500 -- (-633.448) (-629.727) (-634.012) [-628.829] * [-630.273] (-631.373) (-631.757) (-630.556) -- 0:00:18
690000 -- (-629.836) [-629.685] (-632.027) (-628.902) * (-632.098) (-629.385) (-631.188) [-630.876] -- 0:00:18
Average standard deviation of split frequencies: 0.005870
690500 -- (-631.350) [-632.701] (-632.044) (-630.682) * (-629.820) (-629.688) [-630.533] (-628.943) -- 0:00:18
691000 -- [-633.635] (-635.721) (-631.693) (-629.210) * (-630.380) (-629.629) (-630.064) [-631.100] -- 0:00:18
691500 -- (-630.073) [-632.334] (-628.847) (-630.793) * (-630.236) (-630.428) (-632.452) [-632.512] -- 0:00:18
692000 -- (-628.999) (-632.302) [-632.685] (-629.878) * (-630.947) [-629.200] (-632.310) (-631.681) -- 0:00:18
692500 -- (-631.567) (-633.886) [-632.386] (-630.940) * (-630.536) (-629.939) (-630.287) [-630.763] -- 0:00:18
693000 -- (-632.546) (-629.788) (-630.929) [-630.272] * [-629.830] (-629.742) (-630.257) (-632.127) -- 0:00:18
693500 -- (-633.376) (-628.840) [-633.692] (-629.844) * [-631.024] (-632.720) (-633.472) (-633.433) -- 0:00:18
694000 -- (-629.083) [-632.752] (-630.851) (-631.209) * [-630.449] (-630.420) (-630.204) (-631.607) -- 0:00:18
694500 -- (-631.142) [-629.821] (-630.311) (-630.255) * (-632.132) (-629.001) (-629.092) [-628.937] -- 0:00:18
695000 -- (-633.411) (-629.693) [-630.281] (-630.240) * (-629.330) (-628.801) (-629.742) [-632.014] -- 0:00:18
Average standard deviation of split frequencies: 0.005735
695500 -- (-632.747) (-630.163) (-630.952) [-631.862] * (-637.981) [-629.631] (-632.447) (-636.798) -- 0:00:18
696000 -- (-634.792) (-631.076) [-631.443] (-631.337) * [-630.751] (-633.034) (-633.851) (-633.327) -- 0:00:18
696500 -- (-633.359) (-630.102) (-629.375) [-630.867] * (-629.248) (-635.159) [-630.418] (-630.030) -- 0:00:18
697000 -- (-632.607) [-631.267] (-633.645) (-632.747) * [-628.787] (-630.458) (-632.565) (-633.433) -- 0:00:18
697500 -- (-631.453) [-629.676] (-630.942) (-636.045) * [-629.679] (-630.027) (-630.806) (-632.884) -- 0:00:18
698000 -- (-630.843) [-629.696] (-631.125) (-631.194) * (-629.885) [-631.041] (-632.594) (-630.722) -- 0:00:18
698500 -- (-630.832) (-631.222) (-629.632) [-630.101] * (-629.229) [-632.004] (-631.774) (-631.509) -- 0:00:18
699000 -- (-633.987) (-632.115) (-629.983) [-631.199] * (-629.508) (-629.078) [-632.769] (-629.188) -- 0:00:18
699500 -- (-629.343) (-631.409) [-630.615] (-631.521) * (-630.330) [-630.075] (-630.925) (-629.581) -- 0:00:18
700000 -- (-631.597) [-630.880] (-635.450) (-632.556) * (-633.254) (-628.539) [-633.156] (-631.131) -- 0:00:18
Average standard deviation of split frequencies: 0.005921
700500 -- (-633.004) (-631.183) (-630.417) [-634.268] * [-632.142] (-629.086) (-631.643) (-630.798) -- 0:00:17
701000 -- (-633.690) (-629.780) (-631.589) [-633.091] * (-631.962) [-630.977] (-631.496) (-629.889) -- 0:00:17
701500 -- (-630.180) (-635.608) (-629.511) [-634.944] * (-632.386) (-629.257) (-633.426) [-628.571] -- 0:00:17
702000 -- (-629.261) (-629.325) [-634.846] (-630.880) * [-633.746] (-632.348) (-630.252) (-628.490) -- 0:00:17
702500 -- [-630.081] (-630.421) (-636.212) (-632.161) * [-635.335] (-630.959) (-629.541) (-628.543) -- 0:00:17
703000 -- (-631.004) [-631.159] (-636.483) (-634.077) * (-632.508) (-632.033) (-630.284) [-630.274] -- 0:00:17
703500 -- [-629.742] (-631.193) (-633.195) (-631.790) * (-632.418) [-630.658] (-630.857) (-632.141) -- 0:00:17
704000 -- (-631.709) [-629.738] (-633.862) (-631.772) * (-629.902) [-631.568] (-629.565) (-629.675) -- 0:00:17
704500 -- [-629.762] (-629.565) (-629.042) (-633.567) * (-630.399) (-632.071) (-628.751) [-629.192] -- 0:00:17
705000 -- (-629.724) [-631.987] (-631.215) (-633.670) * (-629.872) (-635.880) [-630.124] (-629.173) -- 0:00:17
Average standard deviation of split frequencies: 0.006009
705500 -- (-629.842) (-631.179) (-631.572) [-629.907] * [-631.082] (-630.185) (-631.538) (-629.754) -- 0:00:17
706000 -- [-629.310] (-630.851) (-632.517) (-631.273) * (-632.208) (-629.401) (-630.259) [-629.384] -- 0:00:17
706500 -- (-639.984) [-630.565] (-629.166) (-631.823) * [-630.680] (-633.038) (-631.808) (-630.617) -- 0:00:17
707000 -- (-634.731) (-630.709) [-631.050] (-632.820) * [-630.087] (-630.784) (-630.756) (-630.861) -- 0:00:17
707500 -- (-633.887) (-630.333) (-631.128) [-631.965] * (-630.995) [-630.636] (-634.636) (-629.230) -- 0:00:17
708000 -- (-628.557) (-629.476) (-630.719) [-630.181] * (-632.075) [-628.985] (-631.000) (-630.947) -- 0:00:17
708500 -- (-629.802) (-629.502) [-630.390] (-629.992) * (-631.620) [-628.613] (-634.905) (-634.435) -- 0:00:17
709000 -- (-628.975) [-631.366] (-629.040) (-628.863) * [-631.148] (-631.146) (-634.433) (-631.304) -- 0:00:17
709500 -- (-630.033) [-630.124] (-630.985) (-632.853) * [-633.135] (-631.311) (-630.005) (-631.381) -- 0:00:17
710000 -- (-629.947) (-629.602) (-629.847) [-632.447] * (-630.465) [-629.212] (-629.951) (-631.907) -- 0:00:17
Average standard deviation of split frequencies: 0.006279
710500 -- (-629.637) [-631.485] (-632.318) (-632.217) * (-633.085) (-630.017) [-631.378] (-631.157) -- 0:00:17
711000 -- (-630.852) (-633.687) [-632.959] (-636.096) * (-630.483) (-633.801) [-631.663] (-631.153) -- 0:00:17
711500 -- [-630.209] (-632.759) (-631.359) (-630.146) * (-631.596) (-633.206) [-635.616] (-632.315) -- 0:00:17
712000 -- (-631.894) (-630.774) [-631.150] (-631.809) * (-630.297) (-630.909) [-631.254] (-632.124) -- 0:00:17
712500 -- [-634.182] (-631.162) (-630.033) (-631.435) * (-630.575) [-629.457] (-631.125) (-630.072) -- 0:00:17
713000 -- (-630.820) (-629.564) [-632.574] (-632.683) * [-630.667] (-632.725) (-632.352) (-630.185) -- 0:00:17
713500 -- (-633.957) [-632.377] (-631.246) (-629.792) * (-631.150) (-629.827) (-631.086) [-629.132] -- 0:00:17
714000 -- (-628.636) (-634.687) [-629.535] (-630.827) * [-629.786] (-629.263) (-632.315) (-629.699) -- 0:00:17
714500 -- (-629.408) [-633.363] (-632.159) (-630.867) * (-632.390) [-630.900] (-629.904) (-633.777) -- 0:00:17
715000 -- [-630.809] (-634.061) (-632.588) (-631.269) * (-630.445) (-630.354) (-632.667) [-631.952] -- 0:00:17
Average standard deviation of split frequencies: 0.006496
715500 -- [-633.244] (-631.357) (-636.140) (-635.271) * (-633.397) [-629.946] (-637.928) (-632.227) -- 0:00:17
716000 -- [-631.173] (-632.249) (-632.228) (-629.057) * [-633.121] (-633.071) (-634.487) (-634.092) -- 0:00:17
716500 -- [-630.261] (-631.654) (-632.253) (-635.684) * (-630.994) [-632.964] (-630.922) (-630.428) -- 0:00:17
717000 -- (-630.403) (-630.446) (-630.521) [-632.318] * [-632.779] (-635.046) (-630.641) (-631.712) -- 0:00:16
717500 -- [-631.706] (-633.748) (-629.556) (-630.142) * (-629.755) [-631.075] (-629.435) (-629.380) -- 0:00:16
718000 -- [-631.266] (-632.852) (-630.687) (-629.452) * (-630.728) (-629.496) [-630.270] (-629.264) -- 0:00:16
718500 -- (-631.280) (-631.479) (-630.464) [-630.270] * (-629.775) (-630.594) (-630.014) [-632.128] -- 0:00:16
719000 -- (-632.873) (-631.879) [-630.367] (-631.729) * (-631.332) (-629.804) [-628.885] (-633.474) -- 0:00:16
719500 -- [-633.015] (-631.712) (-634.019) (-632.288) * (-629.897) (-630.703) [-632.231] (-634.196) -- 0:00:16
720000 -- (-630.945) [-631.789] (-632.886) (-632.721) * (-628.710) (-631.338) (-629.476) [-632.997] -- 0:00:16
Average standard deviation of split frequencies: 0.006323
720500 -- (-630.305) (-633.050) (-630.081) [-631.400] * [-629.926] (-629.007) (-629.179) (-629.690) -- 0:00:16
721000 -- (-629.734) [-628.797] (-634.896) (-634.453) * (-630.662) (-628.725) (-633.480) [-631.910] -- 0:00:16
721500 -- (-629.291) [-629.141] (-631.046) (-630.419) * [-628.679] (-629.799) (-630.741) (-631.845) -- 0:00:16
722000 -- (-637.911) (-633.452) [-629.653] (-634.666) * [-631.600] (-630.788) (-629.432) (-628.780) -- 0:00:16
722500 -- (-633.540) (-633.013) (-631.285) [-631.950] * (-628.488) (-635.482) [-630.189] (-634.298) -- 0:00:16
723000 -- (-630.316) (-629.623) (-630.003) [-629.996] * [-632.538] (-631.190) (-630.018) (-633.431) -- 0:00:16
723500 -- (-631.697) (-629.172) (-631.732) [-629.530] * [-631.968] (-631.770) (-631.571) (-634.673) -- 0:00:16
724000 -- [-631.578] (-630.498) (-630.563) (-634.095) * (-634.456) (-632.332) [-631.601] (-629.931) -- 0:00:16
724500 -- (-635.106) [-631.268] (-631.515) (-633.268) * (-631.998) (-634.102) [-630.474] (-635.369) -- 0:00:16
725000 -- (-630.425) (-630.826) (-629.398) [-631.810] * (-631.746) [-631.852] (-629.903) (-633.399) -- 0:00:16
Average standard deviation of split frequencies: 0.006363
725500 -- (-632.953) [-631.180] (-632.457) (-628.864) * (-630.964) (-635.145) [-630.283] (-628.804) -- 0:00:16
726000 -- [-629.749] (-633.878) (-634.174) (-630.922) * [-631.284] (-630.319) (-629.346) (-630.270) -- 0:00:16
726500 -- (-630.886) [-629.940] (-630.694) (-634.574) * (-629.795) [-629.240] (-631.555) (-632.092) -- 0:00:16
727000 -- (-629.640) [-630.258] (-629.591) (-629.062) * (-631.754) (-628.952) [-629.030] (-631.841) -- 0:00:16
727500 -- [-631.603] (-631.630) (-628.986) (-631.021) * (-629.405) (-633.332) (-628.608) [-630.089] -- 0:00:16
728000 -- (-629.941) (-630.707) (-632.997) [-630.549] * (-630.301) (-631.126) [-630.959] (-628.990) -- 0:00:16
728500 -- [-630.090] (-633.734) (-631.865) (-630.476) * (-633.456) (-631.081) (-632.343) [-630.292] -- 0:00:16
729000 -- (-630.575) (-633.683) (-631.020) [-629.770] * (-633.314) (-632.110) [-629.567] (-629.603) -- 0:00:16
729500 -- [-632.241] (-629.836) (-632.032) (-631.650) * (-630.202) (-630.695) (-631.070) [-630.589] -- 0:00:16
730000 -- (-632.947) (-629.624) (-632.842) [-630.500] * (-630.581) (-630.251) (-630.720) [-630.748] -- 0:00:16
Average standard deviation of split frequencies: 0.007011
730500 -- [-631.922] (-631.103) (-630.490) (-630.249) * (-632.355) [-630.722] (-631.264) (-631.401) -- 0:00:16
731000 -- (-633.117) (-630.077) (-630.947) [-629.732] * (-632.708) (-630.551) (-631.313) [-630.743] -- 0:00:16
731500 -- [-633.488] (-632.197) (-632.061) (-631.839) * (-631.600) [-629.471] (-634.542) (-628.981) -- 0:00:16
732000 -- (-631.925) (-631.561) [-629.772] (-628.971) * (-634.424) (-630.206) (-631.997) [-630.382] -- 0:00:16
732500 -- (-630.068) [-629.423] (-630.899) (-628.901) * [-637.603] (-630.077) (-631.963) (-631.586) -- 0:00:16
733000 -- [-631.040] (-631.143) (-634.905) (-630.437) * [-630.201] (-632.199) (-634.249) (-632.840) -- 0:00:16
733500 -- (-631.237) [-630.814] (-637.656) (-639.320) * (-630.968) [-629.476] (-631.620) (-631.333) -- 0:00:15
734000 -- [-634.538] (-634.487) (-632.842) (-634.033) * (-629.139) (-632.245) [-630.098] (-631.085) -- 0:00:15
734500 -- [-631.871] (-632.801) (-633.208) (-635.118) * (-632.627) [-637.695] (-630.221) (-631.128) -- 0:00:15
735000 -- (-630.745) (-630.179) [-632.256] (-633.867) * [-632.277] (-631.342) (-630.561) (-631.486) -- 0:00:15
Average standard deviation of split frequencies: 0.006960
735500 -- [-629.632] (-631.559) (-631.883) (-635.075) * (-631.166) (-633.508) [-630.781] (-632.686) -- 0:00:15
736000 -- [-632.201] (-631.616) (-631.397) (-633.976) * (-637.539) (-630.080) (-631.124) [-630.673] -- 0:00:15
736500 -- [-628.968] (-631.604) (-633.196) (-631.437) * (-631.762) [-629.267] (-630.809) (-630.120) -- 0:00:15
737000 -- (-630.382) [-630.284] (-633.524) (-631.519) * (-634.818) [-630.517] (-629.327) (-631.610) -- 0:00:15
737500 -- (-630.300) [-629.118] (-630.820) (-631.008) * (-631.706) (-632.619) [-630.638] (-630.856) -- 0:00:15
738000 -- (-632.327) [-630.264] (-632.655) (-630.872) * (-632.877) (-630.237) [-630.368] (-632.316) -- 0:00:15
738500 -- (-631.398) (-631.163) (-633.816) [-630.123] * (-630.529) (-629.637) [-631.215] (-632.585) -- 0:00:15
739000 -- [-629.533] (-631.752) (-630.122) (-631.113) * (-631.718) [-630.893] (-629.140) (-633.711) -- 0:00:15
739500 -- (-629.359) (-633.851) [-630.022] (-632.502) * [-630.838] (-629.400) (-630.116) (-632.207) -- 0:00:15
740000 -- (-634.154) (-634.674) [-630.783] (-633.869) * (-629.208) (-630.077) (-629.702) [-630.668] -- 0:00:15
Average standard deviation of split frequencies: 0.007553
740500 -- (-629.478) (-629.629) (-634.422) [-631.755] * (-630.367) (-628.738) [-629.039] (-629.546) -- 0:00:15
741000 -- (-629.364) (-633.203) (-630.958) [-630.011] * (-631.990) (-629.395) [-628.930] (-630.322) -- 0:00:15
741500 -- (-631.843) [-631.025] (-632.330) (-628.507) * (-635.805) (-630.968) (-633.913) [-632.712] -- 0:00:15
742000 -- (-631.211) [-631.497] (-629.053) (-631.970) * (-631.716) (-638.290) (-632.005) [-630.794] -- 0:00:15
742500 -- (-630.424) (-630.128) [-629.347] (-632.580) * (-632.981) (-633.810) (-630.413) [-631.639] -- 0:00:15
743000 -- [-630.237] (-631.347) (-630.929) (-633.340) * (-631.870) (-632.628) (-629.046) [-632.380] -- 0:00:15
743500 -- (-628.944) [-630.925] (-629.824) (-631.357) * [-628.928] (-632.591) (-633.301) (-630.422) -- 0:00:15
744000 -- [-630.485] (-631.874) (-637.632) (-629.657) * (-629.268) (-630.519) [-630.543] (-628.570) -- 0:00:15
744500 -- (-634.994) [-629.850] (-629.504) (-629.851) * (-634.833) (-630.922) [-629.345] (-631.482) -- 0:00:15
745000 -- (-634.395) (-632.429) [-629.998] (-630.186) * [-633.302] (-632.113) (-629.216) (-631.740) -- 0:00:15
Average standard deviation of split frequencies: 0.007035
745500 -- (-632.342) [-630.072] (-629.654) (-630.184) * (-629.645) (-629.806) [-630.666] (-632.835) -- 0:00:15
746000 -- (-634.678) (-629.712) [-630.115] (-631.669) * (-632.376) [-629.457] (-630.678) (-629.074) -- 0:00:15
746500 -- (-631.342) (-631.003) [-630.374] (-631.432) * (-630.132) (-629.865) [-634.740] (-629.530) -- 0:00:15
747000 -- (-630.119) (-633.633) (-630.972) [-629.812] * (-628.884) (-630.194) [-630.447] (-634.652) -- 0:00:15
747500 -- [-630.925] (-629.478) (-631.928) (-633.026) * (-630.887) (-632.689) (-632.382) [-629.782] -- 0:00:15
748000 -- (-629.616) (-629.661) (-630.861) [-630.496] * (-630.812) (-630.272) (-630.924) [-629.899] -- 0:00:15
748500 -- [-630.766] (-634.490) (-631.385) (-631.729) * [-631.079] (-630.423) (-632.415) (-628.819) -- 0:00:15
749000 -- (-629.294) (-633.959) [-630.774] (-634.734) * (-630.385) (-629.522) (-629.814) [-629.950] -- 0:00:15
749500 -- (-629.974) (-629.600) (-632.053) [-630.830] * [-630.802] (-632.683) (-628.908) (-631.462) -- 0:00:15
750000 -- (-629.626) (-633.015) [-630.996] (-630.413) * (-631.826) (-630.971) (-629.687) [-631.214] -- 0:00:15
Average standard deviation of split frequencies: 0.006698
750500 -- (-628.900) (-629.850) (-633.408) [-629.574] * [-629.223] (-632.202) (-631.131) (-634.220) -- 0:00:14
751000 -- (-629.049) (-632.017) [-631.638] (-630.574) * (-631.030) (-633.096) [-630.242] (-636.813) -- 0:00:14
751500 -- [-628.626] (-629.673) (-630.391) (-635.971) * (-629.675) (-633.313) (-633.775) [-634.784] -- 0:00:14
752000 -- (-628.737) [-628.717] (-630.379) (-631.559) * [-631.218] (-631.505) (-629.777) (-630.192) -- 0:00:14
752500 -- [-632.058] (-633.437) (-630.863) (-635.657) * (-629.711) (-633.576) [-634.667] (-629.166) -- 0:00:14
753000 -- (-633.048) (-629.925) [-630.603] (-630.354) * [-630.724] (-629.428) (-632.864) (-630.289) -- 0:00:14
753500 -- (-631.296) [-629.536] (-631.489) (-630.095) * (-631.048) (-629.510) (-630.809) [-630.247] -- 0:00:14
754000 -- (-629.375) (-631.135) [-629.426] (-629.091) * (-635.769) (-634.016) (-630.683) [-630.107] -- 0:00:14
754500 -- [-629.311] (-635.143) (-629.521) (-631.996) * [-631.308] (-633.320) (-633.577) (-628.731) -- 0:00:14
755000 -- [-629.334] (-634.744) (-629.975) (-630.102) * (-632.648) (-629.491) [-629.637] (-631.975) -- 0:00:14
Average standard deviation of split frequencies: 0.007108
755500 -- (-629.284) (-634.637) [-630.900] (-634.716) * [-629.736] (-631.992) (-639.269) (-632.810) -- 0:00:14
756000 -- (-633.584) (-632.259) [-629.290] (-629.160) * (-633.977) (-631.712) (-633.204) [-629.324] -- 0:00:14
756500 -- (-629.867) (-630.552) (-629.653) [-631.456] * (-629.038) (-635.041) [-632.945] (-630.056) -- 0:00:14
757000 -- [-629.607] (-630.889) (-630.565) (-630.900) * (-630.237) (-630.083) [-630.230] (-630.910) -- 0:00:14
757500 -- [-630.140] (-630.419) (-631.468) (-629.908) * [-630.907] (-630.450) (-629.870) (-629.422) -- 0:00:14
758000 -- [-630.117] (-633.246) (-633.101) (-628.667) * (-630.992) [-629.490] (-630.960) (-631.492) -- 0:00:14
758500 -- [-631.097] (-630.460) (-631.981) (-630.986) * (-633.519) (-630.465) (-632.797) [-629.907] -- 0:00:14
759000 -- (-639.008) [-630.179] (-629.763) (-630.073) * (-630.681) [-631.095] (-632.529) (-633.074) -- 0:00:14
759500 -- [-630.630] (-631.937) (-628.915) (-629.017) * (-632.318) (-628.689) (-631.267) [-628.980] -- 0:00:14
760000 -- (-630.936) (-632.841) [-630.452] (-630.164) * (-631.297) (-631.512) (-631.570) [-632.808] -- 0:00:14
Average standard deviation of split frequencies: 0.007395
760500 -- (-632.754) (-631.051) [-628.667] (-630.809) * (-630.648) [-630.954] (-630.111) (-632.111) -- 0:00:14
761000 -- [-630.821] (-630.176) (-633.366) (-629.383) * (-628.995) [-630.116] (-630.024) (-632.487) -- 0:00:14
761500 -- (-629.940) [-633.285] (-634.367) (-631.643) * (-630.085) (-628.718) (-631.479) [-631.534] -- 0:00:14
762000 -- (-629.235) [-630.420] (-631.668) (-629.573) * (-631.940) (-629.646) [-629.953] (-630.775) -- 0:00:14
762500 -- (-631.343) (-633.146) [-628.955] (-630.123) * (-631.556) [-631.990] (-631.512) (-639.166) -- 0:00:14
763000 -- (-634.425) (-632.065) (-631.960) [-631.538] * (-630.341) (-631.185) (-632.314) [-629.806] -- 0:00:14
763500 -- (-634.301) (-630.450) [-632.937] (-632.010) * (-634.054) (-631.007) (-629.416) [-629.693] -- 0:00:14
764000 -- (-632.718) (-630.673) [-631.819] (-630.139) * (-631.089) (-630.384) [-630.858] (-633.030) -- 0:00:14
764500 -- (-632.229) (-635.175) [-629.581] (-630.264) * (-632.062) (-632.519) [-629.561] (-631.811) -- 0:00:14
765000 -- (-629.689) (-632.337) (-630.152) [-629.709] * [-630.248] (-631.564) (-631.965) (-631.860) -- 0:00:14
Average standard deviation of split frequencies: 0.008616
765500 -- (-633.243) [-630.328] (-632.339) (-630.474) * (-635.433) (-632.898) (-630.146) [-630.952] -- 0:00:14
766000 -- (-630.042) (-630.305) (-629.829) [-629.233] * (-629.759) (-634.295) (-629.252) [-632.483] -- 0:00:14
766500 -- (-629.585) [-632.008] (-631.274) (-631.713) * (-632.404) (-634.364) (-629.327) [-631.413] -- 0:00:14
767000 -- (-630.922) (-629.638) [-631.476] (-631.770) * (-629.552) (-635.654) (-629.634) [-630.553] -- 0:00:13
767500 -- (-633.661) [-630.084] (-633.420) (-629.427) * [-630.643] (-634.494) (-630.131) (-631.965) -- 0:00:13
768000 -- (-629.785) (-632.340) (-634.270) [-629.938] * (-631.870) (-632.079) [-630.800] (-630.480) -- 0:00:13
768500 -- (-630.351) (-631.706) [-632.110] (-629.941) * [-632.378] (-632.319) (-629.472) (-636.307) -- 0:00:13
769000 -- (-630.918) [-631.718] (-630.063) (-629.682) * (-632.122) (-629.982) (-632.195) [-629.754] -- 0:00:13
769500 -- (-630.657) [-631.845] (-628.809) (-628.974) * (-631.804) (-634.586) [-632.311] (-630.414) -- 0:00:13
770000 -- (-632.023) (-630.589) (-631.826) [-629.193] * [-630.568] (-628.975) (-631.137) (-629.509) -- 0:00:13
Average standard deviation of split frequencies: 0.008411
770500 -- [-629.460] (-631.381) (-631.969) (-631.032) * (-631.509) [-628.888] (-629.001) (-638.435) -- 0:00:13
771000 -- (-637.152) [-629.907] (-637.027) (-634.308) * (-632.969) [-629.420] (-631.224) (-629.786) -- 0:00:13
771500 -- (-630.214) (-629.394) (-633.678) [-632.013] * (-631.083) (-629.698) (-630.699) [-630.172] -- 0:00:13
772000 -- (-631.486) (-631.348) [-628.769] (-630.643) * (-639.427) (-633.298) (-633.180) [-633.089] -- 0:00:13
772500 -- (-633.072) (-633.903) (-631.111) [-629.619] * (-629.638) (-629.485) [-630.076] (-630.034) -- 0:00:13
773000 -- (-632.328) [-630.566] (-633.560) (-630.444) * (-634.048) (-629.912) (-630.985) [-630.964] -- 0:00:13
773500 -- (-629.606) [-630.200] (-629.860) (-630.079) * (-629.658) (-632.440) (-632.160) [-630.964] -- 0:00:13
774000 -- (-634.395) (-633.898) [-630.134] (-630.169) * (-631.923) (-629.897) [-631.844] (-629.988) -- 0:00:13
774500 -- (-633.442) [-628.952] (-629.280) (-634.665) * [-630.021] (-633.024) (-631.585) (-631.019) -- 0:00:13
775000 -- (-633.290) (-631.371) (-631.204) [-631.651] * (-631.705) (-631.658) [-631.233] (-637.168) -- 0:00:13
Average standard deviation of split frequencies: 0.007897
775500 -- (-634.287) (-632.357) (-629.943) [-631.969] * (-629.999) (-631.846) (-631.459) [-632.392] -- 0:00:13
776000 -- (-629.923) (-637.846) [-632.092] (-631.299) * (-629.841) [-631.617] (-631.536) (-630.952) -- 0:00:13
776500 -- (-631.297) (-631.669) (-629.288) [-630.487] * (-629.492) (-630.916) (-631.874) [-629.147] -- 0:00:13
777000 -- (-630.573) (-632.944) (-632.678) [-631.105] * (-630.489) [-631.642] (-629.265) (-633.483) -- 0:00:13
777500 -- (-632.839) (-631.081) (-632.440) [-633.600] * [-632.442] (-632.547) (-629.231) (-631.488) -- 0:00:13
778000 -- (-629.334) (-636.324) [-633.720] (-632.254) * (-634.559) [-633.534] (-630.971) (-631.302) -- 0:00:13
778500 -- (-631.336) [-631.751] (-628.770) (-632.500) * (-632.234) (-631.417) (-631.323) [-630.760] -- 0:00:13
779000 -- (-629.984) (-629.276) (-629.433) [-631.266] * (-630.885) [-629.500] (-631.296) (-631.189) -- 0:00:13
779500 -- (-631.367) (-633.639) (-630.961) [-632.793] * [-630.191] (-629.310) (-630.282) (-634.596) -- 0:00:13
780000 -- (-631.003) (-630.083) [-629.834] (-635.399) * (-632.270) [-631.720] (-630.915) (-630.120) -- 0:00:13
Average standard deviation of split frequencies: 0.007850
780500 -- (-629.414) (-630.798) [-629.420] (-635.822) * [-633.285] (-632.665) (-630.687) (-630.350) -- 0:00:13
781000 -- (-628.905) [-632.232] (-631.770) (-631.016) * (-631.831) (-630.356) [-628.693] (-630.943) -- 0:00:13
781500 -- [-631.693] (-630.184) (-631.021) (-632.679) * (-630.628) [-633.282] (-629.739) (-630.155) -- 0:00:13
782000 -- (-632.947) (-629.782) (-631.238) [-630.106] * (-630.265) (-632.311) [-630.787] (-629.526) -- 0:00:13
782500 -- [-629.055] (-630.244) (-632.260) (-630.123) * (-632.405) (-632.927) [-631.188] (-631.302) -- 0:00:13
783000 -- [-629.269] (-631.825) (-630.423) (-634.174) * [-632.918] (-632.964) (-630.667) (-630.650) -- 0:00:13
783500 -- (-630.364) (-638.616) (-631.453) [-632.677] * (-630.993) (-629.814) [-630.541] (-629.450) -- 0:00:12
784000 -- [-630.005] (-634.814) (-639.810) (-631.079) * (-629.786) (-630.077) [-630.538] (-630.909) -- 0:00:12
784500 -- (-634.197) (-633.062) [-633.749] (-630.171) * (-629.359) (-632.558) [-631.524] (-630.867) -- 0:00:12
785000 -- (-629.794) [-631.856] (-630.003) (-631.212) * (-631.956) [-628.907] (-630.667) (-632.657) -- 0:00:12
Average standard deviation of split frequencies: 0.008959
785500 -- [-628.803] (-634.882) (-628.802) (-630.994) * (-628.784) (-630.054) [-630.313] (-630.264) -- 0:00:12
786000 -- [-629.113] (-633.256) (-632.044) (-630.788) * [-629.595] (-632.133) (-631.222) (-631.428) -- 0:00:12
786500 -- (-631.366) [-632.475] (-630.759) (-631.896) * (-632.333) (-630.553) (-633.280) [-632.366] -- 0:00:12
787000 -- (-632.226) [-628.605] (-630.074) (-632.305) * (-630.776) (-630.935) (-629.431) [-631.035] -- 0:00:12
787500 -- (-632.272) (-631.474) [-629.760] (-631.304) * (-630.168) (-631.426) [-629.470] (-632.690) -- 0:00:12
788000 -- (-631.594) [-631.020] (-631.999) (-633.939) * (-628.781) [-630.176] (-629.269) (-634.497) -- 0:00:12
788500 -- [-629.659] (-634.524) (-631.387) (-629.968) * [-628.872] (-630.052) (-636.722) (-635.462) -- 0:00:12
789000 -- (-633.686) [-629.967] (-629.759) (-635.842) * [-629.455] (-630.626) (-630.961) (-630.483) -- 0:00:12
789500 -- (-630.714) (-631.564) (-630.079) [-632.947] * (-630.566) [-629.267] (-630.721) (-629.203) -- 0:00:12
790000 -- [-632.417] (-629.030) (-628.926) (-629.714) * [-634.666] (-631.534) (-630.476) (-632.910) -- 0:00:12
Average standard deviation of split frequencies: 0.008188
790500 -- [-632.664] (-630.113) (-633.965) (-631.622) * (-630.388) (-629.136) (-631.828) [-630.866] -- 0:00:12
791000 -- (-629.453) (-629.768) (-630.001) [-630.205] * (-630.593) [-629.439] (-629.226) (-630.997) -- 0:00:12
791500 -- (-631.369) [-632.303] (-631.185) (-629.207) * [-631.760] (-630.850) (-630.662) (-629.226) -- 0:00:12
792000 -- (-630.404) (-631.562) [-630.509] (-629.027) * (-631.001) [-630.849] (-633.350) (-630.984) -- 0:00:12
792500 -- (-628.982) (-630.200) (-629.694) [-632.738] * (-632.659) [-629.317] (-630.855) (-629.796) -- 0:00:12
793000 -- (-631.912) [-631.894] (-629.720) (-630.019) * (-631.010) [-629.365] (-629.752) (-628.876) -- 0:00:12
793500 -- (-633.127) (-630.036) (-629.185) [-631.062] * [-629.891] (-632.410) (-629.172) (-629.665) -- 0:00:12
794000 -- [-631.947] (-630.296) (-638.216) (-631.210) * [-629.958] (-633.022) (-629.920) (-631.817) -- 0:00:12
794500 -- (-632.617) [-633.143] (-631.035) (-633.461) * [-630.610] (-631.479) (-630.133) (-634.833) -- 0:00:12
795000 -- (-629.578) [-631.615] (-630.872) (-631.366) * (-628.876) [-629.971] (-634.216) (-629.885) -- 0:00:12
Average standard deviation of split frequencies: 0.009216
795500 -- (-630.030) (-630.843) [-629.510] (-630.774) * [-632.572] (-628.760) (-631.264) (-631.962) -- 0:00:12
796000 -- (-630.203) [-629.657] (-629.816) (-630.281) * [-629.647] (-634.151) (-632.157) (-630.647) -- 0:00:12
796500 -- (-629.028) (-629.981) [-631.962] (-634.750) * (-630.207) (-629.766) (-629.602) [-629.265] -- 0:00:12
797000 -- [-629.891] (-631.161) (-630.095) (-630.288) * (-630.208) [-630.643] (-634.567) (-630.995) -- 0:00:12
797500 -- (-630.488) [-630.001] (-632.804) (-629.384) * (-629.398) [-628.966] (-632.603) (-632.298) -- 0:00:12
798000 -- [-630.361] (-630.594) (-632.123) (-631.945) * (-630.455) [-629.387] (-633.494) (-631.483) -- 0:00:12
798500 -- (-632.066) (-632.166) (-628.617) [-631.976] * (-631.617) (-632.160) [-629.976] (-629.574) -- 0:00:12
799000 -- (-630.213) (-632.748) (-631.042) [-630.969] * (-632.891) [-631.227] (-630.402) (-628.738) -- 0:00:12
799500 -- (-631.365) (-630.447) [-629.787] (-632.656) * (-632.322) [-631.745] (-629.423) (-631.100) -- 0:00:12
800000 -- (-633.025) [-635.429] (-630.554) (-632.828) * (-634.421) (-634.657) [-631.194] (-632.255) -- 0:00:12
Average standard deviation of split frequencies: 0.008243
800500 -- (-629.838) [-633.772] (-631.976) (-629.151) * (-633.440) (-634.138) [-629.931] (-631.451) -- 0:00:11
801000 -- (-630.789) (-629.508) [-629.993] (-629.492) * (-632.269) (-635.050) [-631.091] (-637.621) -- 0:00:11
801500 -- (-630.748) (-632.119) [-629.931] (-629.872) * (-632.583) [-629.694] (-632.617) (-632.834) -- 0:00:11
802000 -- (-631.114) [-631.050] (-631.056) (-630.370) * (-630.075) [-630.148] (-635.745) (-634.024) -- 0:00:11
802500 -- (-628.766) [-630.798] (-631.769) (-633.957) * (-630.896) (-633.095) (-634.494) [-634.714] -- 0:00:11
803000 -- [-631.807] (-630.859) (-632.350) (-632.282) * (-630.090) (-632.251) (-632.649) [-629.780] -- 0:00:11
803500 -- [-631.745] (-630.115) (-631.399) (-631.691) * (-632.101) (-631.815) (-629.807) [-630.969] -- 0:00:11
804000 -- [-629.634] (-629.646) (-630.325) (-629.856) * (-629.209) (-631.005) (-632.162) [-629.533] -- 0:00:11
804500 -- (-633.608) (-632.490) [-632.094] (-631.481) * (-630.624) (-631.601) (-630.527) [-629.884] -- 0:00:11
805000 -- [-633.511] (-633.138) (-632.500) (-630.640) * (-629.819) (-630.889) (-630.664) [-628.796] -- 0:00:11
Average standard deviation of split frequencies: 0.008736
805500 -- [-632.291] (-630.283) (-630.001) (-630.254) * [-628.834] (-628.840) (-631.219) (-628.973) -- 0:00:11
806000 -- (-630.109) (-635.787) [-631.116] (-631.358) * (-629.452) [-632.855] (-630.585) (-630.413) -- 0:00:11
806500 -- [-629.349] (-629.215) (-631.365) (-630.828) * (-632.178) (-633.439) [-629.541] (-629.734) -- 0:00:11
807000 -- (-628.769) (-629.489) (-632.964) [-633.315] * (-629.889) [-628.655] (-630.065) (-631.021) -- 0:00:11
807500 -- (-629.747) (-630.966) (-630.674) [-630.729] * (-629.787) [-630.783] (-631.465) (-628.733) -- 0:00:11
808000 -- (-631.771) [-630.489] (-629.631) (-632.838) * [-628.823] (-629.284) (-629.534) (-630.150) -- 0:00:11
808500 -- (-629.100) (-632.084) [-629.655] (-629.761) * (-633.899) (-631.361) (-629.506) [-630.669] -- 0:00:11
809000 -- [-630.493] (-631.809) (-629.746) (-630.283) * (-629.638) (-630.869) (-633.494) [-630.250] -- 0:00:11
809500 -- (-629.415) (-631.032) [-631.710] (-633.261) * (-632.451) [-629.164] (-631.968) (-632.525) -- 0:00:11
810000 -- (-635.690) (-631.771) (-631.471) [-633.531] * (-630.430) (-630.154) (-628.636) [-631.093] -- 0:00:11
Average standard deviation of split frequencies: 0.008483
810500 -- (-632.399) [-630.059] (-633.544) (-629.929) * (-635.134) (-631.380) [-630.245] (-632.354) -- 0:00:11
811000 -- (-632.229) (-631.262) (-630.349) [-633.171] * (-636.506) [-630.379] (-629.841) (-629.345) -- 0:00:11
811500 -- [-630.874] (-631.789) (-630.940) (-634.289) * (-637.497) [-629.721] (-629.902) (-629.721) -- 0:00:11
812000 -- (-630.118) (-630.778) [-630.132] (-630.918) * (-630.810) (-630.385) [-629.923] (-630.976) -- 0:00:11
812500 -- [-631.615] (-632.972) (-630.173) (-635.833) * (-632.778) (-632.630) [-632.845] (-632.524) -- 0:00:11
813000 -- (-628.835) (-631.913) [-628.978] (-631.130) * (-630.821) [-630.156] (-630.653) (-629.369) -- 0:00:11
813500 -- (-630.193) (-631.042) [-628.558] (-629.286) * (-629.490) (-631.391) [-632.795] (-633.414) -- 0:00:11
814000 -- (-631.875) [-630.805] (-629.238) (-631.390) * [-629.490] (-631.314) (-630.940) (-634.188) -- 0:00:11
814500 -- (-630.059) [-629.776] (-636.001) (-632.026) * [-630.844] (-632.982) (-632.394) (-631.981) -- 0:00:11
815000 -- (-630.109) (-629.592) (-631.478) [-629.277] * (-630.898) (-633.209) (-635.192) [-630.015] -- 0:00:11
Average standard deviation of split frequencies: 0.008196
815500 -- (-630.548) (-628.785) [-630.018] (-629.513) * (-631.192) (-630.947) (-629.754) [-628.983] -- 0:00:11
816000 -- (-631.768) (-631.906) (-633.263) [-629.535] * (-630.493) (-635.466) (-631.457) [-635.187] -- 0:00:11
816500 -- (-634.430) (-630.559) (-630.094) [-630.368] * (-630.078) [-629.813] (-631.844) (-631.580) -- 0:00:11
817000 -- (-632.303) (-630.067) (-631.069) [-629.763] * (-630.233) (-629.676) (-632.708) [-630.140] -- 0:00:10
817500 -- (-632.451) (-635.839) (-630.850) [-629.256] * (-632.214) (-629.536) [-630.059] (-629.519) -- 0:00:10
818000 -- (-631.515) (-632.923) [-630.905] (-631.242) * (-634.199) [-630.691] (-628.993) (-628.911) -- 0:00:10
818500 -- (-629.290) (-631.245) [-634.243] (-631.227) * (-631.554) (-631.184) [-631.461] (-631.819) -- 0:00:10
819000 -- (-629.200) [-631.265] (-630.117) (-630.712) * [-631.313] (-630.998) (-631.183) (-630.924) -- 0:00:10
819500 -- [-631.404] (-633.225) (-632.382) (-629.401) * (-629.470) (-630.969) (-632.249) [-629.253] -- 0:00:10
820000 -- (-631.784) (-631.820) [-631.224] (-629.134) * (-629.333) (-631.158) (-630.994) [-632.826] -- 0:00:10
Average standard deviation of split frequencies: 0.008221
820500 -- (-631.699) (-629.071) (-632.241) [-628.999] * (-632.918) [-634.025] (-631.798) (-633.098) -- 0:00:10
821000 -- (-629.444) (-629.314) [-629.739] (-629.922) * (-629.974) (-628.974) [-633.659] (-630.046) -- 0:00:10
821500 -- (-629.378) (-628.703) (-637.723) [-631.407] * (-630.199) [-629.804] (-631.522) (-630.466) -- 0:00:10
822000 -- (-628.638) (-628.954) [-631.412] (-631.067) * (-630.645) [-629.794] (-630.506) (-629.410) -- 0:00:10
822500 -- (-628.680) (-631.481) [-630.933] (-630.832) * (-629.626) [-630.028] (-634.407) (-629.597) -- 0:00:10
823000 -- [-631.592] (-630.387) (-633.410) (-629.455) * (-629.658) (-629.989) [-632.763] (-630.359) -- 0:00:10
823500 -- (-629.439) [-630.600] (-629.653) (-628.653) * (-633.104) (-633.426) [-629.987] (-631.722) -- 0:00:10
824000 -- [-632.953] (-630.267) (-633.247) (-628.668) * (-628.998) [-629.260] (-629.815) (-633.766) -- 0:00:10
824500 -- [-629.337] (-631.011) (-632.833) (-633.155) * (-634.031) [-631.556] (-631.209) (-633.041) -- 0:00:10
825000 -- (-629.330) [-631.528] (-632.087) (-631.553) * (-631.502) (-630.766) (-631.798) [-629.471] -- 0:00:10
Average standard deviation of split frequencies: 0.007954
825500 -- [-631.197] (-632.071) (-631.990) (-629.843) * (-631.747) (-631.722) [-630.088] (-630.549) -- 0:00:10
826000 -- (-631.293) [-635.842] (-631.279) (-630.745) * [-630.763] (-629.877) (-634.174) (-631.916) -- 0:00:10
826500 -- [-629.871] (-634.938) (-630.387) (-632.365) * (-634.543) (-630.364) (-632.123) [-634.254] -- 0:00:10
827000 -- [-634.678] (-632.686) (-630.741) (-633.316) * (-629.209) (-636.769) (-631.717) [-630.619] -- 0:00:10
827500 -- [-630.416] (-632.474) (-632.597) (-630.300) * [-629.391] (-632.260) (-630.167) (-629.949) -- 0:00:10
828000 -- (-630.661) [-629.334] (-630.638) (-630.411) * [-632.767] (-633.028) (-631.878) (-631.846) -- 0:00:10
828500 -- (-630.264) (-630.075) (-634.533) [-630.563] * (-631.056) (-632.709) (-632.176) [-633.786] -- 0:00:10
829000 -- (-631.569) [-629.696] (-633.088) (-632.863) * (-632.892) (-636.292) [-628.984] (-634.927) -- 0:00:10
829500 -- (-634.576) [-629.665] (-631.723) (-631.005) * [-631.101] (-630.464) (-628.759) (-634.579) -- 0:00:10
830000 -- (-636.774) (-630.381) (-631.672) [-629.097] * (-631.760) [-629.691] (-632.339) (-631.964) -- 0:00:10
Average standard deviation of split frequencies: 0.008371
830500 -- [-633.863] (-630.022) (-634.757) (-631.644) * (-631.925) (-629.357) (-630.050) [-628.805] -- 0:00:10
831000 -- [-630.792] (-632.786) (-635.081) (-628.654) * [-629.602] (-630.396) (-629.461) (-631.338) -- 0:00:10
831500 -- (-629.807) [-630.057] (-630.072) (-628.995) * (-629.832) (-631.113) (-629.920) [-632.608] -- 0:00:10
832000 -- [-628.950] (-629.875) (-629.841) (-630.517) * [-630.572] (-632.047) (-630.802) (-632.379) -- 0:00:10
832500 -- [-631.017] (-629.534) (-629.685) (-632.711) * [-630.901] (-634.600) (-631.452) (-629.617) -- 0:00:10
833000 -- (-630.493) (-629.753) (-630.268) [-631.321] * (-631.861) (-634.301) [-630.120] (-629.829) -- 0:00:10
833500 -- (-630.316) (-632.883) [-631.037] (-633.143) * [-629.433] (-631.257) (-631.957) (-631.458) -- 0:00:09
834000 -- (-630.034) [-629.167] (-630.734) (-631.264) * (-630.839) [-632.813] (-631.639) (-628.869) -- 0:00:09
834500 -- (-629.600) (-632.312) (-631.513) [-633.729] * (-633.193) (-631.840) [-630.604] (-629.173) -- 0:00:09
835000 -- (-630.759) [-633.417] (-629.218) (-633.037) * (-630.575) (-632.393) [-635.657] (-629.556) -- 0:00:09
Average standard deviation of split frequencies: 0.008670
835500 -- (-630.782) (-631.148) [-634.975] (-633.769) * (-629.369) [-631.678] (-629.673) (-629.824) -- 0:00:09
836000 -- (-633.119) [-630.798] (-632.519) (-631.727) * (-633.450) (-630.307) (-629.992) [-631.434] -- 0:00:09
836500 -- [-630.578] (-630.257) (-631.060) (-629.715) * (-631.026) [-628.796] (-631.675) (-630.042) -- 0:00:09
837000 -- [-630.800] (-629.845) (-632.652) (-634.612) * [-631.819] (-633.643) (-634.063) (-629.771) -- 0:00:09
837500 -- (-628.506) [-631.848] (-629.927) (-631.835) * (-632.533) (-630.301) [-631.294] (-630.504) -- 0:00:09
838000 -- (-629.773) (-631.819) (-632.606) [-629.154] * (-628.945) [-631.226] (-632.823) (-633.258) -- 0:00:09
838500 -- (-630.127) (-632.282) [-632.173] (-630.016) * (-633.281) (-638.987) (-632.108) [-634.434] -- 0:00:09
839000 -- (-630.119) (-629.010) (-631.762) [-631.505] * (-631.918) [-631.870] (-629.963) (-630.156) -- 0:00:09
839500 -- (-629.386) [-630.628] (-631.898) (-637.341) * [-633.042] (-633.778) (-633.841) (-631.325) -- 0:00:09
840000 -- (-631.194) [-631.824] (-630.634) (-629.884) * (-628.527) [-630.830] (-631.245) (-630.966) -- 0:00:09
Average standard deviation of split frequencies: 0.008586
840500 -- [-631.268] (-635.383) (-629.788) (-630.719) * [-630.399] (-631.566) (-632.093) (-629.857) -- 0:00:09
841000 -- (-629.674) (-630.367) [-631.176] (-630.715) * (-630.316) [-630.131] (-630.308) (-630.504) -- 0:00:09
841500 -- (-628.989) [-629.933] (-630.612) (-633.071) * (-630.448) [-632.308] (-629.065) (-634.458) -- 0:00:09
842000 -- (-629.970) (-632.683) [-631.743] (-631.198) * (-631.999) (-629.630) (-632.988) [-633.164] -- 0:00:09
842500 -- (-628.745) [-629.836] (-630.196) (-631.614) * [-629.214] (-637.390) (-632.056) (-632.229) -- 0:00:09
843000 -- [-630.724] (-630.327) (-629.264) (-632.554) * (-630.482) (-630.127) [-631.003] (-630.335) -- 0:00:09
843500 -- [-630.733] (-630.159) (-630.929) (-633.540) * [-630.463] (-629.358) (-629.223) (-635.892) -- 0:00:09
844000 -- (-632.084) [-630.536] (-634.307) (-635.628) * (-629.292) (-628.582) [-629.991] (-631.125) -- 0:00:09
844500 -- (-630.530) [-633.172] (-630.624) (-636.453) * (-629.805) (-628.684) (-630.053) [-633.243] -- 0:00:09
845000 -- [-630.682] (-629.773) (-634.378) (-632.734) * (-634.549) [-632.478] (-632.507) (-635.158) -- 0:00:09
Average standard deviation of split frequencies: 0.008555
845500 -- (-631.375) [-630.227] (-630.136) (-630.317) * (-629.801) (-630.150) [-628.976] (-634.312) -- 0:00:09
846000 -- (-633.065) (-630.061) (-633.928) [-629.438] * (-629.191) [-630.667] (-632.953) (-631.598) -- 0:00:09
846500 -- (-630.138) [-628.771] (-632.102) (-632.627) * (-630.846) (-635.344) [-630.856] (-634.008) -- 0:00:09
847000 -- [-629.783] (-628.880) (-633.363) (-636.657) * [-633.472] (-631.775) (-631.346) (-632.296) -- 0:00:09
847500 -- (-633.115) [-632.156] (-631.032) (-632.476) * [-629.899] (-631.343) (-630.229) (-637.076) -- 0:00:09
848000 -- (-634.591) (-629.405) (-633.706) [-635.524] * (-633.741) (-628.770) (-634.249) [-629.560] -- 0:00:09
848500 -- (-629.077) (-634.858) (-631.535) [-628.660] * (-629.678) (-629.115) (-633.958) [-629.673] -- 0:00:09
849000 -- [-630.044] (-630.388) (-628.774) (-630.397) * (-636.890) (-631.479) (-630.691) [-629.502] -- 0:00:09
849500 -- (-631.852) (-630.404) [-630.232] (-633.401) * [-630.750] (-629.845) (-634.740) (-630.968) -- 0:00:09
850000 -- [-630.563] (-631.060) (-629.820) (-634.559) * (-630.124) (-631.461) [-635.536] (-632.975) -- 0:00:09
Average standard deviation of split frequencies: 0.008932
850500 -- [-631.223] (-630.555) (-629.777) (-631.553) * (-629.691) [-630.152] (-631.467) (-630.311) -- 0:00:08
851000 -- (-633.174) [-629.661] (-629.503) (-634.382) * [-629.777] (-632.313) (-630.437) (-629.270) -- 0:00:08
851500 -- (-634.477) [-629.542] (-628.854) (-635.954) * [-632.154] (-634.249) (-630.224) (-630.337) -- 0:00:08
852000 -- [-630.719] (-631.820) (-632.107) (-630.240) * (-633.460) (-633.097) [-629.773] (-630.889) -- 0:00:08
852500 -- (-635.550) (-632.548) [-632.476] (-629.854) * [-633.985] (-629.219) (-631.986) (-632.422) -- 0:00:08
853000 -- [-631.368] (-629.657) (-632.038) (-629.975) * (-631.690) (-630.250) (-629.705) [-629.797] -- 0:00:08
853500 -- (-632.412) (-633.967) [-630.262] (-629.194) * (-630.622) (-630.604) [-630.068] (-628.743) -- 0:00:08
854000 -- (-631.678) (-632.168) (-629.283) [-632.149] * [-629.585] (-628.998) (-633.954) (-630.397) -- 0:00:08
854500 -- (-629.115) (-630.656) [-630.218] (-635.137) * [-629.589] (-635.377) (-631.147) (-630.205) -- 0:00:08
855000 -- (-633.698) [-630.049] (-630.055) (-630.997) * (-633.263) (-629.619) [-629.513] (-629.000) -- 0:00:08
Average standard deviation of split frequencies: 0.008364
855500 -- (-632.588) (-630.515) (-630.165) [-631.522] * (-630.545) (-633.168) (-629.512) [-629.271] -- 0:00:08
856000 -- (-630.940) (-629.972) (-632.024) [-630.958] * (-632.987) [-632.280] (-630.263) (-630.730) -- 0:00:08
856500 -- (-630.149) (-631.445) [-629.964] (-629.822) * (-632.261) (-629.920) [-631.415] (-632.174) -- 0:00:08
857000 -- (-631.928) (-629.941) (-633.505) [-629.918] * (-630.552) (-630.017) [-633.114] (-631.338) -- 0:00:08
857500 -- [-630.332] (-630.058) (-632.484) (-631.359) * (-629.234) [-631.720] (-632.396) (-632.224) -- 0:00:08
858000 -- [-630.467] (-630.659) (-631.081) (-635.638) * (-630.437) (-635.256) [-630.362] (-637.846) -- 0:00:08
858500 -- [-630.198] (-633.114) (-631.401) (-630.978) * [-633.629] (-630.836) (-629.347) (-633.883) -- 0:00:08
859000 -- (-629.850) (-633.237) [-633.389] (-631.437) * (-631.311) [-630.322] (-630.648) (-633.454) -- 0:00:08
859500 -- (-636.218) (-628.761) (-630.326) [-631.447] * (-632.313) (-630.214) (-633.356) [-632.584] -- 0:00:08
860000 -- [-629.218] (-631.387) (-631.608) (-629.879) * (-630.061) (-628.788) (-631.046) [-628.641] -- 0:00:08
Average standard deviation of split frequencies: 0.007412
860500 -- [-630.388] (-631.057) (-635.238) (-628.821) * (-631.741) (-631.377) [-630.384] (-628.907) -- 0:00:08
861000 -- (-633.355) (-630.013) (-630.145) [-632.134] * (-630.123) [-629.756] (-631.168) (-630.138) -- 0:00:08
861500 -- (-632.275) (-631.851) [-629.740] (-630.950) * [-629.710] (-632.125) (-634.255) (-630.192) -- 0:00:08
862000 -- (-631.189) [-635.863] (-630.100) (-630.691) * (-630.649) (-629.591) [-631.786] (-633.674) -- 0:00:08
862500 -- (-631.192) [-633.804] (-632.163) (-631.096) * (-629.563) (-630.352) (-632.289) [-632.553] -- 0:00:08
863000 -- (-630.915) [-630.258] (-631.988) (-632.965) * (-631.469) [-629.632] (-631.214) (-633.063) -- 0:00:08
863500 -- (-631.167) [-634.490] (-632.890) (-631.235) * [-629.192] (-631.323) (-628.743) (-632.394) -- 0:00:08
864000 -- (-631.555) (-636.181) (-631.701) [-630.953] * (-629.636) (-629.430) [-629.317] (-629.955) -- 0:00:08
864500 -- [-633.011] (-636.633) (-631.923) (-632.507) * (-630.503) [-629.936] (-631.596) (-634.084) -- 0:00:08
865000 -- (-632.002) (-629.415) [-630.072] (-638.596) * (-629.483) (-630.422) [-629.893] (-630.008) -- 0:00:08
Average standard deviation of split frequencies: 0.007113
865500 -- (-631.231) (-630.104) (-630.076) [-632.724] * (-629.234) [-630.782] (-631.949) (-629.415) -- 0:00:08
866000 -- [-632.224] (-629.290) (-632.365) (-631.149) * (-630.840) (-630.790) (-631.650) [-629.197] -- 0:00:08
866500 -- (-632.784) (-631.575) [-630.954] (-631.772) * (-629.055) (-632.594) (-629.051) [-629.601] -- 0:00:08
867000 -- (-631.725) [-629.323] (-631.048) (-630.846) * (-630.520) (-629.649) [-634.013] (-632.446) -- 0:00:07
867500 -- (-629.261) (-629.143) (-630.843) [-632.052] * [-631.349] (-629.225) (-633.288) (-631.216) -- 0:00:07
868000 -- (-630.514) (-630.052) [-632.887] (-630.046) * [-630.442] (-629.688) (-632.205) (-630.163) -- 0:00:07
868500 -- (-630.071) (-629.994) (-633.247) [-629.579] * (-630.886) [-630.353] (-629.940) (-632.476) -- 0:00:07
869000 -- [-630.348] (-631.157) (-631.536) (-630.725) * (-631.021) (-636.283) [-629.439] (-632.107) -- 0:00:07
869500 -- [-630.458] (-635.318) (-629.980) (-632.284) * [-632.404] (-634.514) (-629.762) (-631.207) -- 0:00:07
870000 -- (-630.915) (-631.163) [-631.441] (-630.339) * (-629.915) (-634.754) [-631.222] (-629.846) -- 0:00:07
Average standard deviation of split frequencies: 0.007219
870500 -- (-630.648) (-631.503) [-630.308] (-632.431) * (-633.997) (-630.554) [-631.920] (-630.858) -- 0:00:07
871000 -- (-629.452) (-631.249) (-629.307) [-632.084] * [-630.390] (-632.905) (-633.347) (-633.650) -- 0:00:07
871500 -- (-630.188) (-630.449) [-630.298] (-629.406) * (-635.727) (-632.431) [-631.134] (-629.289) -- 0:00:07
872000 -- [-629.620] (-629.532) (-630.984) (-629.873) * [-635.141] (-632.713) (-629.236) (-630.405) -- 0:00:07
872500 -- (-636.894) (-629.805) (-630.017) [-630.671] * [-631.234] (-633.792) (-631.084) (-632.098) -- 0:00:07
873000 -- (-637.725) [-630.542] (-629.765) (-631.056) * (-634.311) (-631.594) (-629.475) [-630.104] -- 0:00:07
873500 -- (-638.787) (-630.547) (-628.574) [-631.508] * (-629.329) [-631.985] (-630.749) (-631.205) -- 0:00:07
874000 -- [-631.237] (-630.507) (-628.758) (-630.092) * [-632.785] (-634.019) (-631.035) (-630.618) -- 0:00:07
874500 -- (-629.928) [-628.871] (-628.718) (-633.844) * (-629.098) (-638.619) (-630.498) [-632.580] -- 0:00:07
875000 -- (-632.898) [-629.740] (-630.535) (-629.768) * (-632.380) (-633.816) [-630.139] (-630.728) -- 0:00:07
Average standard deviation of split frequencies: 0.007283
875500 -- (-631.034) [-629.514] (-635.198) (-629.891) * (-634.617) [-631.091] (-630.083) (-630.517) -- 0:00:07
876000 -- (-629.689) (-631.911) [-630.606] (-630.225) * (-629.822) [-632.074] (-630.092) (-629.566) -- 0:00:07
876500 -- (-635.328) [-629.515] (-638.161) (-629.248) * (-630.375) [-629.470] (-635.646) (-633.004) -- 0:00:07
877000 -- (-630.836) (-628.796) (-629.987) [-629.396] * [-628.897] (-629.279) (-629.936) (-631.929) -- 0:00:07
877500 -- [-630.930] (-632.597) (-629.572) (-629.905) * (-628.798) (-629.616) [-631.830] (-629.636) -- 0:00:07
878000 -- [-631.050] (-639.506) (-630.106) (-629.408) * (-629.537) (-630.319) (-630.802) [-630.175] -- 0:00:07
878500 -- (-629.315) (-631.171) (-629.592) [-630.387] * [-629.433] (-631.491) (-631.875) (-629.438) -- 0:00:07
879000 -- (-631.870) (-633.076) [-630.203] (-633.009) * (-629.633) (-629.052) (-634.650) [-631.344] -- 0:00:07
879500 -- (-637.103) [-637.279] (-631.206) (-632.696) * (-629.639) [-628.981] (-633.427) (-629.083) -- 0:00:07
880000 -- (-640.840) [-630.627] (-630.345) (-633.740) * [-628.781] (-629.268) (-633.080) (-630.003) -- 0:00:07
Average standard deviation of split frequencies: 0.007101
880500 -- (-633.051) (-628.996) [-629.219] (-634.468) * (-628.971) (-631.184) [-630.887] (-631.775) -- 0:00:07
881000 -- (-630.790) (-629.136) (-630.708) [-631.554] * (-631.817) (-635.660) (-630.577) [-631.724] -- 0:00:07
881500 -- (-631.148) [-629.651] (-633.537) (-631.360) * (-631.893) [-631.444] (-632.755) (-630.724) -- 0:00:07
882000 -- (-629.408) (-629.665) (-633.077) [-633.417] * (-631.640) (-629.941) (-632.697) [-629.246] -- 0:00:07
882500 -- [-629.447] (-631.790) (-632.162) (-633.031) * (-631.334) (-630.176) (-632.025) [-634.905] -- 0:00:07
883000 -- (-630.673) (-629.001) (-629.660) [-629.967] * (-631.224) (-629.110) [-634.766] (-630.609) -- 0:00:07
883500 -- (-630.835) [-629.115] (-635.322) (-630.285) * [-630.921] (-631.110) (-628.706) (-631.981) -- 0:00:06
884000 -- (-637.102) (-633.987) (-630.490) [-631.541] * [-633.157] (-634.173) (-638.822) (-629.899) -- 0:00:06
884500 -- (-629.851) (-631.924) [-630.370] (-629.667) * (-629.925) (-630.029) (-636.823) [-630.266] -- 0:00:06
885000 -- (-630.557) [-630.740] (-630.315) (-631.678) * [-630.080] (-630.531) (-632.649) (-633.859) -- 0:00:06
Average standard deviation of split frequencies: 0.008114
885500 -- (-632.283) (-635.036) [-631.666] (-629.188) * (-630.239) (-630.866) [-631.278] (-630.102) -- 0:00:06
886000 -- (-629.542) (-634.819) (-632.149) [-631.525] * (-631.038) [-631.449] (-630.893) (-632.037) -- 0:00:06
886500 -- (-633.193) (-629.313) [-630.102] (-633.657) * (-629.668) [-632.007] (-630.654) (-629.946) -- 0:00:06
887000 -- (-634.163) (-629.302) [-628.840] (-631.711) * [-631.625] (-630.686) (-629.925) (-629.672) -- 0:00:06
887500 -- (-631.315) (-630.302) [-628.821] (-630.692) * (-631.065) (-634.651) [-631.865] (-629.405) -- 0:00:06
888000 -- (-630.552) [-633.764] (-633.177) (-631.957) * (-631.657) (-633.554) [-630.686] (-629.865) -- 0:00:06
888500 -- (-629.162) (-629.451) [-629.524] (-636.647) * (-630.327) (-633.027) [-633.738] (-630.404) -- 0:00:06
889000 -- [-629.149] (-631.325) (-630.661) (-629.720) * [-629.697] (-631.564) (-636.282) (-631.008) -- 0:00:06
889500 -- (-629.756) [-630.791] (-630.756) (-630.047) * (-629.664) (-631.827) (-630.049) [-629.495] -- 0:00:06
890000 -- (-630.569) (-629.858) (-630.131) [-630.855] * (-630.068) (-631.656) [-631.709] (-632.246) -- 0:00:06
Average standard deviation of split frequencies: 0.007873
890500 -- [-629.078] (-629.722) (-630.221) (-629.056) * (-629.742) (-630.305) [-632.727] (-631.507) -- 0:00:06
891000 -- (-628.902) [-632.330] (-632.692) (-628.950) * (-629.471) (-633.645) (-630.786) [-632.801] -- 0:00:06
891500 -- [-630.368] (-631.661) (-630.755) (-630.742) * (-629.632) (-631.370) [-631.500] (-633.907) -- 0:00:06
892000 -- (-631.591) (-630.923) (-632.762) [-630.340] * [-630.620] (-631.087) (-636.326) (-633.333) -- 0:00:06
892500 -- (-631.776) (-629.637) (-628.715) [-628.999] * (-629.868) [-631.748] (-631.929) (-632.270) -- 0:00:06
893000 -- (-632.779) (-629.618) (-629.718) [-629.850] * [-630.556] (-632.060) (-629.966) (-629.873) -- 0:00:06
893500 -- (-632.392) (-632.222) [-631.321] (-630.495) * [-629.824] (-629.656) (-632.182) (-632.985) -- 0:00:06
894000 -- (-629.124) (-630.324) (-629.502) [-631.323] * (-631.602) (-632.670) (-631.914) [-632.521] -- 0:00:06
894500 -- [-629.225] (-629.757) (-629.680) (-632.435) * [-630.784] (-632.862) (-634.632) (-631.513) -- 0:00:06
895000 -- (-630.998) (-628.840) [-629.629] (-632.430) * (-630.797) (-630.908) (-629.937) [-631.418] -- 0:00:06
Average standard deviation of split frequencies: 0.007760
895500 -- (-633.457) (-632.616) [-631.488] (-634.053) * (-636.485) (-632.376) [-629.243] (-638.582) -- 0:00:06
896000 -- (-629.846) (-629.036) (-630.856) [-630.489] * (-631.903) [-629.749] (-628.544) (-635.782) -- 0:00:06
896500 -- (-633.708) (-629.138) (-630.550) [-628.728] * (-632.364) (-629.864) [-628.770] (-631.095) -- 0:00:06
897000 -- (-629.469) [-629.138] (-635.703) (-630.660) * (-633.448) (-632.259) (-629.746) [-632.013] -- 0:00:06
897500 -- (-630.785) (-629.152) (-630.956) [-629.501] * (-630.427) (-629.521) [-629.423] (-630.408) -- 0:00:06
898000 -- [-631.613] (-630.363) (-634.002) (-631.867) * [-631.000] (-635.628) (-630.237) (-634.516) -- 0:00:06
898500 -- [-631.421] (-630.470) (-634.027) (-630.767) * (-629.785) (-635.038) [-634.105] (-631.963) -- 0:00:06
899000 -- (-638.252) [-629.373] (-632.918) (-629.869) * (-629.678) (-633.411) [-630.790] (-632.450) -- 0:00:06
899500 -- (-631.467) [-629.654] (-632.010) (-634.283) * (-634.181) [-629.442] (-629.902) (-631.222) -- 0:00:06
900000 -- (-629.340) [-631.750] (-630.788) (-635.066) * (-630.924) (-629.234) (-629.464) [-630.119] -- 0:00:06
Average standard deviation of split frequencies: 0.006839
900500 -- [-629.418] (-631.632) (-631.457) (-630.083) * (-632.693) (-630.559) [-631.808] (-630.529) -- 0:00:05
901000 -- (-633.099) (-633.232) (-630.205) [-629.650] * [-629.530] (-631.138) (-628.825) (-629.406) -- 0:00:05
901500 -- (-632.262) [-633.576] (-629.864) (-632.736) * (-629.370) [-630.063] (-629.260) (-630.896) -- 0:00:05
902000 -- (-631.475) [-631.402] (-629.775) (-635.554) * (-634.331) [-630.855] (-630.644) (-629.734) -- 0:00:05
902500 -- [-633.897] (-631.871) (-631.785) (-629.917) * (-635.136) (-630.398) [-630.948] (-629.241) -- 0:00:05
903000 -- (-631.716) (-632.016) [-629.553] (-635.706) * (-630.619) (-629.559) (-632.709) [-631.354] -- 0:00:05
903500 -- (-631.649) [-631.041] (-630.826) (-633.261) * (-632.834) (-630.179) (-630.551) [-629.577] -- 0:00:05
904000 -- (-634.410) (-630.787) (-630.282) [-629.885] * (-631.335) (-629.734) (-630.360) [-629.572] -- 0:00:05
904500 -- (-630.956) (-631.668) [-633.025] (-629.713) * (-629.854) (-629.754) [-631.557] (-632.671) -- 0:00:05
905000 -- (-630.725) (-630.445) [-630.448] (-634.248) * [-630.715] (-630.534) (-631.597) (-630.019) -- 0:00:05
Average standard deviation of split frequencies: 0.006625
905500 -- [-632.775] (-632.756) (-631.443) (-629.974) * (-629.814) (-630.811) [-630.703] (-634.625) -- 0:00:05
906000 -- (-630.425) (-632.959) [-630.648] (-631.041) * (-630.671) (-630.847) [-630.954] (-632.667) -- 0:00:05
906500 -- (-635.424) [-632.675] (-631.482) (-631.463) * (-631.944) [-631.178] (-629.650) (-635.175) -- 0:00:05
907000 -- (-634.901) [-632.772] (-634.634) (-629.093) * (-632.436) (-631.342) [-630.174] (-634.589) -- 0:00:05
907500 -- (-634.400) [-632.759] (-629.609) (-631.122) * [-630.224] (-629.940) (-630.390) (-632.409) -- 0:00:05
908000 -- [-630.303] (-631.475) (-630.508) (-634.338) * (-629.936) (-630.561) [-631.088] (-631.527) -- 0:00:05
908500 -- (-636.111) (-632.934) (-632.291) [-630.335] * [-630.364] (-636.202) (-638.118) (-633.070) -- 0:00:05
909000 -- (-631.375) (-631.501) [-629.456] (-630.252) * [-629.485] (-633.706) (-630.945) (-630.760) -- 0:00:05
909500 -- (-630.863) [-630.251] (-633.184) (-628.960) * (-634.216) [-632.248] (-628.629) (-631.550) -- 0:00:05
910000 -- (-629.179) (-632.802) [-630.176] (-629.193) * (-630.325) [-631.859] (-628.734) (-629.589) -- 0:00:05
Average standard deviation of split frequencies: 0.007005
910500 -- (-628.647) [-632.348] (-632.797) (-630.942) * [-628.781] (-632.664) (-630.333) (-630.412) -- 0:00:05
911000 -- (-629.342) [-629.637] (-632.494) (-631.104) * [-629.578] (-630.079) (-630.621) (-629.090) -- 0:00:05
911500 -- (-629.365) [-629.981] (-629.990) (-631.393) * (-628.757) [-633.226] (-633.969) (-629.081) -- 0:00:05
912000 -- (-630.822) (-631.821) [-629.448] (-632.735) * (-631.574) (-630.991) (-636.346) [-632.468] -- 0:00:05
912500 -- (-630.342) (-631.946) [-629.522] (-632.228) * [-630.244] (-631.763) (-629.661) (-631.466) -- 0:00:05
913000 -- (-633.121) (-630.142) (-630.261) [-636.391] * [-629.158] (-629.819) (-629.161) (-633.052) -- 0:00:05
913500 -- (-631.857) [-630.298] (-628.907) (-637.699) * (-629.101) [-629.748] (-629.921) (-630.443) -- 0:00:05
914000 -- (-631.651) (-630.280) (-630.587) [-631.217] * (-629.882) (-630.600) (-631.180) [-629.853] -- 0:00:05
914500 -- (-632.285) [-630.162] (-629.798) (-630.424) * (-631.726) (-633.174) [-633.386] (-629.366) -- 0:00:05
915000 -- (-629.323) (-632.128) (-628.672) [-629.790] * (-634.562) [-629.890] (-631.256) (-631.563) -- 0:00:05
Average standard deviation of split frequencies: 0.007342
915500 -- (-630.527) (-631.891) (-630.700) [-630.698] * (-632.485) (-629.478) [-632.037] (-630.167) -- 0:00:05
916000 -- [-632.685] (-631.944) (-632.587) (-631.368) * [-631.398] (-629.743) (-629.109) (-629.144) -- 0:00:05
916500 -- (-630.415) (-631.654) [-633.361] (-631.852) * [-632.106] (-630.479) (-628.476) (-629.517) -- 0:00:05
917000 -- [-629.951] (-631.423) (-636.360) (-633.077) * (-634.056) (-629.993) [-629.906] (-631.054) -- 0:00:04
917500 -- (-629.517) (-629.134) (-629.431) [-630.335] * (-634.290) (-630.165) (-628.719) [-629.500] -- 0:00:04
918000 -- [-630.608] (-631.214) (-629.750) (-630.022) * (-633.247) (-630.262) (-630.018) [-629.201] -- 0:00:04
918500 -- (-633.922) [-629.533] (-630.390) (-630.632) * (-630.591) (-629.074) [-632.115] (-630.123) -- 0:00:04
919000 -- [-630.339] (-629.349) (-633.238) (-631.280) * (-630.725) (-631.096) (-630.351) [-628.986] -- 0:00:04
919500 -- (-629.495) (-629.810) [-630.156] (-632.710) * (-631.230) (-630.230) (-629.600) [-628.939] -- 0:00:04
920000 -- (-629.001) (-630.886) [-630.171] (-634.968) * (-629.435) [-631.116] (-629.011) (-629.299) -- 0:00:04
Average standard deviation of split frequencies: 0.007407
920500 -- (-630.258) (-628.759) [-630.809] (-632.310) * (-632.338) (-631.629) (-631.200) [-629.294] -- 0:00:04
921000 -- (-631.804) (-630.196) (-633.819) [-633.427] * [-630.396] (-632.346) (-630.581) (-630.670) -- 0:00:04
921500 -- (-629.562) (-629.579) [-631.739] (-632.168) * (-632.905) (-634.378) (-630.869) [-630.229] -- 0:00:04
922000 -- (-629.921) (-637.252) [-629.957] (-630.372) * (-630.492) (-632.099) (-630.661) [-632.102] -- 0:00:04
922500 -- (-631.246) (-629.472) (-630.844) [-631.896] * (-629.228) (-631.311) [-630.765] (-631.850) -- 0:00:04
923000 -- [-632.766] (-629.899) (-630.238) (-630.732) * [-629.410] (-634.606) (-634.262) (-628.911) -- 0:00:04
923500 -- (-629.398) (-629.619) [-634.582] (-630.432) * (-631.518) (-636.195) (-630.933) [-630.683] -- 0:00:04
924000 -- (-632.040) (-630.223) (-635.279) [-629.999] * (-631.713) (-632.422) (-632.339) [-633.391] -- 0:00:04
924500 -- [-631.111] (-631.975) (-632.506) (-628.556) * (-629.348) (-633.714) (-629.971) [-628.973] -- 0:00:04
925000 -- (-631.417) (-631.719) [-638.018] (-629.001) * (-631.314) (-630.131) [-630.121] (-629.509) -- 0:00:04
Average standard deviation of split frequencies: 0.007297
925500 -- (-630.777) [-634.351] (-628.937) (-628.846) * (-631.317) (-629.560) (-629.603) [-630.934] -- 0:00:04
926000 -- [-629.890] (-630.710) (-629.510) (-631.716) * [-630.241] (-629.903) (-629.629) (-629.727) -- 0:00:04
926500 -- (-630.517) (-630.828) [-629.973] (-629.625) * (-630.259) (-632.471) (-629.113) [-629.663] -- 0:00:04
927000 -- (-630.438) [-631.309] (-628.931) (-628.927) * (-629.370) (-633.367) (-629.359) [-630.487] -- 0:00:04
927500 -- (-635.059) (-632.007) [-629.348] (-631.427) * (-633.131) (-630.584) (-629.016) [-633.834] -- 0:00:04
928000 -- (-637.067) (-632.820) [-629.309] (-630.256) * (-630.769) (-629.588) [-629.016] (-635.846) -- 0:00:04
928500 -- (-635.588) (-630.217) [-630.688] (-632.402) * (-630.807) [-630.153] (-629.434) (-634.809) -- 0:00:04
929000 -- (-636.757) (-633.923) (-634.742) [-633.254] * [-630.103] (-633.970) (-630.209) (-634.498) -- 0:00:04
929500 -- (-636.235) (-630.529) (-630.791) [-629.778] * (-633.231) [-631.031] (-629.673) (-635.364) -- 0:00:04
930000 -- (-630.647) (-630.647) (-629.611) [-632.370] * (-631.032) (-632.309) (-633.050) [-633.828] -- 0:00:04
Average standard deviation of split frequencies: 0.007699
930500 -- (-631.613) (-629.009) (-629.865) [-628.868] * (-635.509) [-631.928] (-632.348) (-633.387) -- 0:00:04
931000 -- (-632.759) (-629.007) [-628.868] (-629.865) * (-629.707) (-628.887) (-632.012) [-630.523] -- 0:00:04
931500 -- (-630.691) (-629.011) (-630.081) [-628.799] * (-630.755) (-629.787) (-631.107) [-631.072] -- 0:00:04
932000 -- (-629.159) (-630.324) (-631.440) [-628.804] * (-631.718) (-630.584) (-629.988) [-629.526] -- 0:00:04
932500 -- (-631.145) (-630.603) (-630.641) [-630.210] * (-630.869) (-631.963) (-632.688) [-629.431] -- 0:00:04
933000 -- (-631.127) (-633.032) (-630.757) [-629.635] * [-631.491] (-630.179) (-629.572) (-629.221) -- 0:00:04
933500 -- (-630.460) [-634.595] (-632.662) (-628.703) * (-630.089) [-629.645] (-631.429) (-634.505) -- 0:00:03
934000 -- (-629.557) (-630.640) (-632.211) [-629.858] * (-633.146) [-632.078] (-631.897) (-631.254) -- 0:00:03
934500 -- (-630.429) [-630.191] (-632.128) (-630.390) * (-631.019) (-629.848) (-630.356) [-634.598] -- 0:00:03
935000 -- (-631.669) (-632.353) [-630.455] (-635.086) * (-633.205) (-629.319) [-629.176] (-631.669) -- 0:00:03
Average standard deviation of split frequencies: 0.007924
935500 -- (-636.622) (-631.038) [-629.677] (-629.211) * (-631.602) [-630.257] (-631.033) (-629.110) -- 0:00:03
936000 -- (-631.525) (-630.587) [-630.420] (-628.959) * (-630.692) [-629.708] (-631.676) (-630.014) -- 0:00:03
936500 -- (-631.103) (-629.874) [-632.771] (-632.159) * (-632.092) [-633.331] (-630.030) (-629.836) -- 0:00:03
937000 -- (-629.031) [-629.865] (-633.090) (-632.292) * [-630.408] (-630.127) (-632.319) (-633.110) -- 0:00:03
937500 -- (-628.667) [-633.108] (-633.538) (-629.287) * (-633.509) (-631.131) [-631.652] (-632.679) -- 0:00:03
938000 -- (-628.658) [-631.155] (-629.092) (-632.175) * (-634.649) (-634.701) (-630.560) [-630.803] -- 0:00:03
938500 -- (-629.841) (-629.942) (-632.224) [-629.485] * (-629.717) (-633.638) [-629.253] (-629.981) -- 0:00:03
939000 -- (-629.387) (-629.512) [-630.168] (-632.383) * (-632.850) [-632.876] (-629.481) (-629.389) -- 0:00:03
939500 -- (-629.829) (-631.834) [-629.140] (-630.568) * (-629.688) (-630.197) [-628.934] (-628.968) -- 0:00:03
940000 -- (-629.936) (-631.212) (-631.735) [-629.909] * (-629.175) (-631.377) [-629.335] (-629.272) -- 0:00:03
Average standard deviation of split frequencies: 0.008419
940500 -- (-632.092) (-630.722) [-629.529] (-630.557) * (-629.803) (-632.269) [-630.374] (-629.589) -- 0:00:03
941000 -- [-633.949] (-631.450) (-631.934) (-635.564) * [-629.784] (-630.953) (-630.643) (-631.298) -- 0:00:03
941500 -- [-631.964] (-635.156) (-632.281) (-632.493) * (-630.771) [-633.290] (-630.237) (-629.661) -- 0:00:03
942000 -- [-634.174] (-631.470) (-628.905) (-631.606) * (-632.032) (-632.880) [-629.075] (-630.183) -- 0:00:03
942500 -- (-632.102) [-631.345] (-630.038) (-630.830) * (-634.285) (-629.755) [-630.474] (-630.625) -- 0:00:03
943000 -- (-636.776) (-635.805) (-635.234) [-629.779] * (-629.097) (-631.167) [-631.735] (-630.960) -- 0:00:03
943500 -- [-631.283] (-633.024) (-631.524) (-630.077) * (-630.391) (-635.335) [-629.097] (-631.064) -- 0:00:03
944000 -- (-629.972) (-628.576) [-631.724] (-629.591) * (-629.710) [-628.709] (-630.404) (-629.744) -- 0:00:03
944500 -- (-631.017) (-631.538) (-629.462) [-630.518] * [-632.145] (-630.192) (-629.665) (-633.206) -- 0:00:03
945000 -- (-632.801) (-631.836) [-630.330] (-631.654) * (-628.781) (-631.592) [-629.649] (-631.361) -- 0:00:03
Average standard deviation of split frequencies: 0.008073
945500 -- [-628.844] (-632.352) (-633.272) (-633.621) * (-628.644) [-632.075] (-631.479) (-630.001) -- 0:00:03
946000 -- [-631.420] (-631.904) (-631.553) (-632.877) * (-630.123) (-629.073) (-630.273) [-629.722] -- 0:00:03
946500 -- (-633.294) [-632.481] (-633.971) (-631.267) * (-629.302) (-632.159) (-630.043) [-629.121] -- 0:00:03
947000 -- (-631.110) (-630.208) [-630.353] (-631.592) * (-631.414) (-631.214) [-630.280] (-631.457) -- 0:00:03
947500 -- [-629.846] (-632.195) (-629.657) (-634.548) * (-632.480) (-632.108) [-628.988] (-631.066) -- 0:00:03
948000 -- (-631.319) [-633.193] (-631.790) (-629.192) * (-630.992) [-630.704] (-633.175) (-630.212) -- 0:00:03
948500 -- (-629.815) (-633.418) [-630.959] (-630.188) * (-633.372) (-629.930) (-632.212) [-630.145] -- 0:00:03
949000 -- [-630.762] (-631.362) (-630.653) (-632.456) * (-631.258) (-629.016) (-630.834) [-630.194] -- 0:00:03
949500 -- (-630.370) (-630.710) (-631.703) [-633.011] * (-630.659) [-629.512] (-630.560) (-630.586) -- 0:00:03
950000 -- (-631.609) (-629.524) (-638.108) [-632.094] * (-636.642) [-631.246] (-630.164) (-630.327) -- 0:00:03
Average standard deviation of split frequencies: 0.007901
950500 -- (-630.835) (-629.392) (-632.111) [-630.604] * (-633.588) (-632.450) (-631.481) [-629.954] -- 0:00:02
951000 -- [-632.738] (-630.951) (-632.164) (-630.315) * (-630.973) (-630.346) (-633.310) [-630.734] -- 0:00:02
951500 -- (-633.707) (-631.604) (-630.786) [-629.865] * (-636.115) (-630.227) [-630.934] (-630.189) -- 0:00:02
952000 -- (-633.222) (-629.510) (-630.330) [-631.584] * [-631.825] (-632.195) (-631.371) (-628.884) -- 0:00:02
952500 -- (-629.153) (-632.472) [-632.419] (-635.591) * [-631.094] (-634.478) (-629.876) (-632.542) -- 0:00:02
953000 -- [-629.579] (-631.762) (-631.550) (-635.014) * [-629.378] (-631.510) (-630.466) (-632.010) -- 0:00:02
953500 -- (-630.250) (-630.264) [-633.224] (-633.011) * (-629.877) (-629.901) (-630.361) [-630.671] -- 0:00:02
954000 -- (-630.954) (-629.383) (-635.941) [-630.149] * (-632.076) [-629.796] (-630.527) (-632.142) -- 0:00:02
954500 -- [-630.519] (-630.157) (-632.044) (-629.932) * (-635.645) (-629.105) (-630.631) [-630.284] -- 0:00:02
955000 -- (-632.990) (-630.258) [-629.412] (-634.102) * (-633.762) [-629.231] (-633.864) (-629.084) -- 0:00:02
Average standard deviation of split frequencies: 0.007495
955500 -- (-630.677) (-631.801) [-630.754] (-630.107) * (-633.710) (-630.523) (-640.222) [-628.771] -- 0:00:02
956000 -- (-629.699) (-629.870) [-630.740] (-628.675) * (-636.778) [-631.126] (-631.901) (-638.251) -- 0:00:02
956500 -- [-629.100] (-630.640) (-631.413) (-630.277) * (-629.486) [-631.117] (-635.093) (-630.980) -- 0:00:02
957000 -- (-629.212) [-630.702] (-630.295) (-629.957) * (-637.538) (-630.647) (-636.979) [-629.660] -- 0:00:02
957500 -- [-629.940] (-631.939) (-631.237) (-629.105) * (-628.786) (-629.320) (-630.568) [-630.510] -- 0:00:02
958000 -- [-629.519] (-633.934) (-632.272) (-629.063) * (-631.253) (-628.940) (-630.605) [-629.081] -- 0:00:02
958500 -- (-631.288) [-634.352] (-630.827) (-632.364) * (-629.714) (-631.079) [-629.729] (-630.964) -- 0:00:02
959000 -- [-631.497] (-635.221) (-632.267) (-630.930) * (-629.711) [-629.060] (-630.945) (-630.473) -- 0:00:02
959500 -- [-630.071] (-633.230) (-632.244) (-630.001) * (-629.253) (-630.042) (-633.201) [-629.453] -- 0:00:02
960000 -- (-632.660) (-631.769) [-634.319] (-631.789) * (-634.311) (-629.775) [-631.850] (-631.459) -- 0:00:02
Average standard deviation of split frequencies: 0.007459
960500 -- (-633.493) (-629.235) [-630.185] (-632.588) * (-630.623) (-633.165) (-632.171) [-630.036] -- 0:00:02
961000 -- (-632.153) [-629.471] (-631.784) (-635.742) * [-631.823] (-634.060) (-631.465) (-632.846) -- 0:00:02
961500 -- (-635.168) [-631.677] (-634.315) (-632.924) * (-632.930) (-628.912) (-630.927) [-630.657] -- 0:00:02
962000 -- (-632.343) (-628.777) [-630.898] (-634.114) * [-634.252] (-629.826) (-630.351) (-633.223) -- 0:00:02
962500 -- [-629.237] (-631.133) (-629.203) (-629.798) * [-635.090] (-630.964) (-630.506) (-630.170) -- 0:00:02
963000 -- (-632.135) [-629.820] (-631.730) (-629.557) * [-632.995] (-631.527) (-628.540) (-629.911) -- 0:00:02
963500 -- (-629.914) [-629.980] (-630.197) (-631.484) * (-631.229) (-630.780) (-628.462) [-629.761] -- 0:00:02
964000 -- (-630.183) (-630.998) (-635.192) [-629.763] * [-629.395] (-629.912) (-629.434) (-630.116) -- 0:00:02
964500 -- (-631.165) (-635.342) (-633.564) [-629.605] * (-632.217) (-631.721) (-633.259) [-629.024] -- 0:00:02
965000 -- (-633.841) (-630.340) [-631.435] (-629.870) * [-629.375] (-630.115) (-629.857) (-629.149) -- 0:00:02
Average standard deviation of split frequencies: 0.007613
965500 -- (-634.937) (-635.139) (-629.826) [-630.603] * (-630.403) (-631.601) (-632.567) [-630.668] -- 0:00:02
966000 -- [-633.678] (-630.518) (-632.040) (-630.629) * (-638.049) (-631.243) (-632.019) [-630.997] -- 0:00:02
966500 -- (-633.587) (-632.298) (-630.097) [-630.657] * (-630.756) (-630.394) (-630.918) [-631.393] -- 0:00:02
967000 -- (-630.669) [-629.420] (-630.301) (-631.867) * (-629.258) (-633.587) [-630.302] (-633.282) -- 0:00:01
967500 -- (-630.704) (-630.962) [-630.683] (-630.619) * [-629.474] (-634.644) (-637.853) (-631.694) -- 0:00:01
968000 -- (-630.695) [-631.434] (-629.623) (-630.862) * [-629.061] (-632.414) (-631.074) (-629.874) -- 0:00:01
968500 -- (-630.077) (-630.690) (-631.977) [-632.865] * [-629.134] (-630.309) (-634.654) (-630.663) -- 0:00:01
969000 -- [-632.156] (-632.217) (-630.827) (-629.373) * (-629.578) (-628.945) [-629.152] (-629.999) -- 0:00:01
969500 -- (-631.207) (-631.353) (-631.121) [-631.446] * [-631.342] (-633.376) (-631.354) (-629.625) -- 0:00:01
970000 -- (-629.846) (-629.727) [-632.272] (-633.092) * (-636.191) [-633.244] (-629.550) (-630.008) -- 0:00:01
Average standard deviation of split frequencies: 0.007285
970500 -- (-632.204) (-630.808) (-631.600) [-629.437] * (-630.321) (-632.407) [-634.950] (-633.007) -- 0:00:01
971000 -- (-630.290) (-629.769) (-631.358) [-630.699] * (-630.700) [-631.019] (-629.845) (-631.343) -- 0:00:01
971500 -- (-631.484) (-629.779) (-628.778) [-629.256] * (-633.957) (-632.185) (-629.432) [-631.278] -- 0:00:01
972000 -- (-633.295) (-639.964) [-629.279] (-633.076) * [-632.096] (-632.766) (-630.792) (-632.822) -- 0:00:01
972500 -- [-631.218] (-630.902) (-629.880) (-638.703) * [-631.404] (-631.979) (-634.526) (-629.262) -- 0:00:01
973000 -- (-633.150) (-630.062) [-630.628] (-632.864) * [-629.031] (-630.970) (-636.469) (-631.659) -- 0:00:01
973500 -- (-631.532) (-631.288) [-630.800] (-634.000) * (-630.514) (-631.456) (-631.245) [-631.615] -- 0:00:01
974000 -- (-630.305) (-632.993) [-628.624] (-631.349) * [-632.395] (-628.969) (-632.296) (-629.992) -- 0:00:01
974500 -- (-631.917) [-632.800] (-628.704) (-633.829) * (-629.759) [-634.483] (-630.958) (-630.250) -- 0:00:01
975000 -- (-631.538) [-634.228] (-628.877) (-633.190) * (-630.723) (-634.762) (-632.805) [-630.188] -- 0:00:01
Average standard deviation of split frequencies: 0.007535
975500 -- (-632.069) (-632.650) [-634.309] (-633.316) * (-629.044) (-634.936) (-634.810) [-629.080] -- 0:00:01
976000 -- (-629.875) [-631.458] (-629.595) (-633.360) * (-629.250) (-630.063) [-631.072] (-628.819) -- 0:00:01
976500 -- (-628.884) [-630.428] (-630.598) (-636.231) * (-630.980) [-633.726] (-629.835) (-628.805) -- 0:00:01
977000 -- (-636.229) (-631.747) (-631.769) [-631.181] * (-629.564) (-634.265) [-633.062] (-634.075) -- 0:00:01
977500 -- [-629.585] (-631.308) (-633.649) (-636.170) * (-633.105) [-634.420] (-633.380) (-632.410) -- 0:00:01
978000 -- [-630.410] (-633.610) (-630.620) (-633.423) * (-634.528) (-629.941) (-631.074) [-630.027] -- 0:00:01
978500 -- (-632.025) [-630.500] (-629.852) (-630.199) * (-629.154) (-628.835) (-630.512) [-632.651] -- 0:00:01
979000 -- (-631.020) [-632.000] (-634.484) (-629.069) * (-632.217) (-628.510) (-630.282) [-629.038] -- 0:00:01
979500 -- (-630.838) [-630.642] (-631.723) (-631.998) * (-632.335) (-629.805) (-632.954) [-630.152] -- 0:00:01
980000 -- [-629.955] (-633.582) (-629.773) (-633.133) * (-632.078) (-630.798) [-634.202] (-631.573) -- 0:00:01
Average standard deviation of split frequencies: 0.007915
980500 -- [-631.234] (-631.393) (-632.894) (-635.862) * [-629.610] (-631.113) (-632.121) (-634.145) -- 0:00:01
981000 -- [-630.840] (-629.458) (-628.900) (-632.992) * (-633.413) [-633.387] (-632.667) (-630.639) -- 0:00:01
981500 -- (-632.860) (-631.633) (-630.519) [-633.829] * (-628.874) (-631.101) (-630.264) [-629.148] -- 0:00:01
982000 -- (-634.150) (-631.471) [-632.841] (-629.823) * (-629.004) (-633.331) [-629.045] (-629.475) -- 0:00:01
982500 -- (-631.839) (-629.653) (-630.772) [-629.615] * (-629.363) (-631.375) (-631.548) [-629.427] -- 0:00:01
983000 -- (-630.459) [-632.021] (-631.070) (-630.542) * (-631.146) (-629.240) (-630.432) [-629.931] -- 0:00:01
983500 -- [-633.953] (-631.105) (-631.158) (-629.751) * [-628.725] (-628.681) (-630.247) (-631.024) -- 0:00:00
984000 -- (-633.005) (-633.333) (-633.938) [-629.076] * (-632.621) [-629.034] (-630.599) (-633.066) -- 0:00:00
984500 -- (-636.353) (-631.499) [-635.009] (-629.494) * [-629.598] (-629.922) (-630.018) (-630.969) -- 0:00:00
985000 -- (-638.020) (-633.289) [-632.958] (-629.664) * (-630.287) [-629.869] (-628.917) (-632.161) -- 0:00:00
Average standard deviation of split frequencies: 0.007713
985500 -- (-631.251) [-631.017] (-629.513) (-631.556) * [-630.831] (-628.702) (-629.311) (-632.486) -- 0:00:00
986000 -- (-631.095) (-630.600) (-634.120) [-628.992] * (-629.714) (-630.412) [-631.920] (-633.641) -- 0:00:00
986500 -- [-628.941] (-632.832) (-630.094) (-628.784) * (-633.667) (-633.860) (-629.031) [-631.595] -- 0:00:00
987000 -- [-630.061] (-630.223) (-629.716) (-630.216) * (-630.541) [-631.218] (-630.482) (-631.378) -- 0:00:00
987500 -- (-630.509) [-630.830] (-631.516) (-630.567) * (-630.405) [-631.921] (-632.712) (-628.589) -- 0:00:00
988000 -- [-629.897] (-631.560) (-639.964) (-633.684) * (-630.370) (-631.288) (-631.066) [-628.814] -- 0:00:00
988500 -- (-630.531) [-630.261] (-635.176) (-630.197) * (-633.418) (-631.284) [-631.272] (-630.641) -- 0:00:00
989000 -- (-630.247) (-634.061) (-635.123) [-631.071] * [-631.605] (-630.207) (-630.578) (-630.791) -- 0:00:00
989500 -- (-634.873) (-629.253) [-630.250] (-634.545) * (-632.387) [-630.365] (-634.055) (-629.692) -- 0:00:00
990000 -- [-632.784] (-630.098) (-628.934) (-628.927) * (-629.985) (-631.979) (-632.205) [-632.348] -- 0:00:00
Average standard deviation of split frequencies: 0.007740
990500 -- (-634.761) [-629.389] (-628.760) (-633.381) * (-630.017) (-630.050) (-628.591) [-630.887] -- 0:00:00
991000 -- (-633.277) [-629.517] (-630.550) (-629.859) * (-630.963) [-629.220] (-629.683) (-632.725) -- 0:00:00
991500 -- (-630.188) [-631.566] (-632.531) (-630.451) * (-631.442) (-638.644) [-633.270] (-632.656) -- 0:00:00
992000 -- (-631.088) [-631.808] (-632.623) (-630.132) * (-630.411) (-633.219) [-630.091] (-633.154) -- 0:00:00
992500 -- (-630.594) [-631.546] (-630.327) (-628.963) * (-629.664) [-633.666] (-629.103) (-632.079) -- 0:00:00
993000 -- (-632.313) (-631.749) [-630.632] (-631.124) * (-630.285) (-632.491) [-630.420] (-634.204) -- 0:00:00
993500 -- (-628.829) (-630.562) (-628.819) [-630.409] * [-628.677] (-629.420) (-630.572) (-630.891) -- 0:00:00
994000 -- [-628.896] (-629.151) (-629.790) (-629.215) * [-629.114] (-630.949) (-629.584) (-634.043) -- 0:00:00
994500 -- (-629.039) [-630.447] (-632.909) (-630.129) * (-629.954) [-630.059] (-631.737) (-633.368) -- 0:00:00
995000 -- [-629.347] (-631.015) (-632.744) (-630.441) * (-629.135) [-630.096] (-631.338) (-631.133) -- 0:00:00
Average standard deviation of split frequencies: 0.007194
995500 -- (-629.164) (-629.545) [-629.564] (-631.330) * [-629.343] (-629.708) (-635.298) (-629.562) -- 0:00:00
996000 -- [-629.102] (-631.975) (-628.776) (-633.317) * (-630.735) (-631.748) (-635.234) [-631.080] -- 0:00:00
996500 -- (-632.359) (-632.857) [-631.365] (-632.415) * [-630.666] (-629.790) (-632.239) (-634.200) -- 0:00:00
997000 -- (-629.292) (-633.251) [-631.433] (-632.218) * (-630.086) (-631.146) [-635.895] (-630.052) -- 0:00:00
997500 -- (-630.578) (-630.045) [-632.172] (-633.899) * (-632.390) [-630.765] (-632.083) (-631.230) -- 0:00:00
998000 -- (-632.496) (-631.615) [-628.801] (-636.471) * (-629.924) (-633.229) (-632.697) [-631.275] -- 0:00:00
998500 -- [-631.236] (-631.478) (-628.856) (-631.831) * (-635.882) [-630.059] (-642.384) (-629.827) -- 0:00:00
999000 -- (-630.574) (-630.493) (-631.001) [-633.073] * (-634.519) (-630.445) [-632.944] (-632.587) -- 0:00:00
999500 -- (-631.062) [-629.848] (-631.448) (-631.301) * (-630.065) (-631.970) [-628.815] (-631.150) -- 0:00:00
1000000 -- (-630.625) (-632.398) [-630.147] (-632.474) * (-630.869) (-629.002) [-630.083] (-637.940) -- 0:00:00
Average standard deviation of split frequencies: 0.007161
Analysis completed in 60 seconds
Analysis used 58.04 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -628.40
Likelihood of best state for "cold" chain of run 2 was -628.40
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.2 % ( 69 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
32.8 % ( 32 %) Dirichlet(Pi{all})
32.8 % ( 24 %) Slider(Pi{all})
78.0 % ( 53 %) Multiplier(Alpha{1,2})
77.8 % ( 44 %) Multiplier(Alpha{3})
23.8 % ( 27 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.2 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 87 %) ParsSPR(Tau{all},V{all})
28.2 % ( 25 %) Multiplier(V{all})
97.3 % ( 94 %) Nodeslider(V{all})
30.3 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.8 % ( 73 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
32.6 % ( 28 %) Dirichlet(Pi{all})
33.5 % ( 23 %) Slider(Pi{all})
78.6 % ( 63 %) Multiplier(Alpha{1,2})
77.7 % ( 47 %) Multiplier(Alpha{3})
24.3 % ( 28 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
69.9 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 91 %) ParsSPR(Tau{all},V{all})
28.1 % ( 22 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.7 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166661 0.82 0.67
3 | 166944 166591 0.84
4 | 166989 166603 166212
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166212 0.82 0.67
3 | 166800 167055 0.84
4 | 166539 166912 166482
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -630.22
| 1 1 1 22 1 |
| 1 22 1 2 |
| 2 2 2 2 1 2 |
| 2 12 11 2 1 2 1|
|2 1 1 1 |
| 2 2 11 2 1 2 2 2 1 |
| 1 121 2 2 11 1* 2 2 1 1 22|
| 1 2 2 1 2 * 1 2 |
|1 1 22 2 2 2 1 1 21 2 2222 1 |
| 2 1 2 1 1 1 22 1 2 2 1 1 2 |
| 12 2 1 * 1 |
| 12 12 1 2 1 11 1 1 |
| 2 1 |
| 1 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -631.64
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -630.17 -632.94
2 -630.12 -632.87
--------------------------------------
TOTAL -630.15 -632.91
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895467 0.088758 0.341366 1.458674 0.865281 1371.67 1436.33 1.000
r(A<->C){all} 0.168815 0.019752 0.000048 0.439890 0.135987 92.72 211.62 1.002
r(A<->G){all} 0.167028 0.020190 0.000055 0.448200 0.131661 152.12 315.77 1.010
r(A<->T){all} 0.162905 0.018367 0.000034 0.425846 0.128373 267.07 337.72 1.001
r(C<->G){all} 0.173965 0.021164 0.000216 0.469932 0.136393 167.91 245.76 1.000
r(C<->T){all} 0.157300 0.018560 0.000003 0.431754 0.116613 134.70 200.52 1.006
r(G<->T){all} 0.169986 0.021863 0.000025 0.476445 0.128026 161.91 195.43 1.000
pi(A){all} 0.191936 0.000340 0.155658 0.227444 0.191417 1176.67 1332.13 1.000
pi(C){all} 0.296358 0.000458 0.254796 0.337559 0.295432 1206.21 1248.07 1.000
pi(G){all} 0.293977 0.000431 0.255530 0.336018 0.293590 1052.50 1153.57 1.000
pi(T){all} 0.217729 0.000372 0.180788 0.254163 0.217399 1113.18 1147.97 1.000
alpha{1,2} 0.411589 0.218317 0.000171 1.348548 0.238010 1238.73 1321.94 1.000
alpha{3} 0.460934 0.256817 0.000111 1.492665 0.297549 940.95 1119.12 1.000
pinvar{all} 0.996692 0.000014 0.989332 0.999996 0.997910 1138.48 1237.35 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*..*
8 -- ...**.
9 -- .**.**
10 -- .*...*
11 -- .*.***
12 -- ...*.*
13 -- .***.*
14 -- .*..*.
15 -- .**...
16 -- .*.*..
17 -- ..****
18 -- ....**
19 -- .****.
20 -- ..*.*.
21 -- ..**..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 450 0.149900 0.012248 0.141239 0.158561 2
8 445 0.148235 0.003298 0.145903 0.150566 2
9 440 0.146569 0.006595 0.141905 0.151233 2
10 439 0.146236 0.000471 0.145903 0.146569 2
11 436 0.145237 0.013191 0.135909 0.154564 2
12 434 0.144570 0.003769 0.141905 0.147235 2
13 433 0.144237 0.003298 0.141905 0.146569 2
14 430 0.143238 0.007537 0.137908 0.148568 2
15 429 0.142905 0.013662 0.133245 0.152565 2
16 429 0.142905 0.007066 0.137908 0.147901 2
17 426 0.141905 0.003769 0.139241 0.144570 2
18 422 0.140573 0.012248 0.131912 0.149234 2
19 419 0.139574 0.005182 0.135909 0.143238 2
20 404 0.134577 0.007537 0.129247 0.139907 2
21 398 0.132578 0.007537 0.127249 0.137908 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.101812 0.010174 0.000002 0.301160 0.070560 1.000 2
length{all}[2] 0.097005 0.008840 0.000015 0.291525 0.068210 1.000 2
length{all}[3] 0.099287 0.010355 0.000037 0.307099 0.067155 1.001 2
length{all}[4] 0.098262 0.009777 0.000003 0.308661 0.066446 1.000 2
length{all}[5] 0.101103 0.010110 0.000004 0.302458 0.070770 1.000 2
length{all}[6] 0.100572 0.009827 0.000058 0.307730 0.072000 1.000 2
length{all}[7] 0.091895 0.007545 0.000390 0.265337 0.068535 1.001 2
length{all}[8] 0.104270 0.010684 0.000037 0.310103 0.071502 1.002 2
length{all}[9] 0.087397 0.007346 0.000204 0.235844 0.061953 0.999 2
length{all}[10] 0.095682 0.009148 0.000285 0.282694 0.065595 1.000 2
length{all}[11] 0.101276 0.010231 0.000042 0.290913 0.068972 0.999 2
length{all}[12] 0.098417 0.009847 0.000105 0.284849 0.067129 0.998 2
length{all}[13] 0.099911 0.009624 0.000285 0.269729 0.072651 1.000 2
length{all}[14] 0.097457 0.009491 0.000006 0.287405 0.071208 0.998 2
length{all}[15] 0.111495 0.012483 0.000031 0.339665 0.076306 0.998 2
length{all}[16] 0.098413 0.010786 0.000275 0.303717 0.063085 1.001 2
length{all}[17] 0.104305 0.010849 0.000014 0.302389 0.069836 0.999 2
length{all}[18] 0.098428 0.010835 0.000202 0.304376 0.065724 0.998 2
length{all}[19] 0.098876 0.010241 0.000067 0.318371 0.066536 1.002 2
length{all}[20] 0.095364 0.009437 0.000976 0.292458 0.067362 1.003 2
length{all}[21] 0.097003 0.010773 0.000110 0.287591 0.064126 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007161
Maximum standard deviation of split frequencies = 0.013662
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.003
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|-------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------ C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 459
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 50 patterns at 153 / 153 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 50 patterns at 153 / 153 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
48800 bytes for conP
4400 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.073322 0.071959 0.035346 0.014090 0.073959 0.107067 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -659.746502
Iterating by ming2
Initial: fx= 659.746502
x= 0.07332 0.07196 0.03535 0.01409 0.07396 0.10707 0.30000 1.30000
1 h-m-p 0.0000 0.0001 369.1146 ++ 647.105060 m 0.0001 13 | 1/8
2 h-m-p 0.0006 0.0249 52.4773 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 337.2105 ++ 631.113066 m 0.0001 44 | 2/8
4 h-m-p 0.0010 0.0295 44.4178 -----------.. | 2/8
5 h-m-p 0.0000 0.0002 302.2524 +++ 608.806202 m 0.0002 76 | 3/8
6 h-m-p 0.0017 0.0356 37.6280 ------------.. | 3/8
7 h-m-p 0.0000 0.0000 263.3232 ++ 608.177746 m 0.0000 108 | 4/8
8 h-m-p 0.0001 0.0464 30.0471 ---------.. | 4/8
9 h-m-p 0.0000 0.0000 214.8342 ++ 607.982058 m 0.0000 137 | 5/8
10 h-m-p 0.0001 0.0703 19.6674 ----------.. | 5/8
11 h-m-p 0.0000 0.0002 151.4764 +++ 602.884912 m 0.0002 168 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 602.884912 m 8.0000 179 | 6/8
13 h-m-p 0.2163 8.0000 0.0002 +++ 602.884912 m 8.0000 193 | 6/8
14 h-m-p 0.0160 8.0000 1.0005 +++++ 602.884889 m 8.0000 209 | 6/8
15 h-m-p 1.6000 8.0000 2.6740 ++ 602.884877 m 8.0000 220 | 6/8
16 h-m-p 1.6000 8.0000 6.1982 ++ 602.884873 m 8.0000 231 | 6/8
17 h-m-p 1.6000 8.0000 18.1943 ++ 602.884871 m 8.0000 242 | 6/8
18 h-m-p 1.6000 8.0000 6.3544 ++ 602.884870 m 8.0000 253 | 6/8
19 h-m-p 0.6119 3.3185 83.0761 -----------Y 602.884870 0 0.0000 275 | 6/8
20 h-m-p 1.6000 8.0000 0.0000 --------Y 602.884870 0 0.0000 294 | 6/8
21 h-m-p 1.6000 8.0000 0.0000 C 602.884870 0 0.4000 307
Out..
lnL = -602.884870
308 lfun, 308 eigenQcodon, 1848 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.023843 0.015267 0.025665 0.048844 0.046351 0.069061 262.603093 0.699645 0.159523
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.118690
np = 9
lnL0 = -635.691628
Iterating by ming2
Initial: fx= 635.691628
x= 0.02384 0.01527 0.02566 0.04884 0.04635 0.06906 262.60309 0.69964 0.15952
1 h-m-p 0.0000 0.0001 336.5147 ++ 623.074375 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0007 102.3290 ++ 616.403283 m 0.0007 26 | 2/9
3 h-m-p 0.0000 0.0000 2712.7562 ++ 615.468672 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 13810.1768 ++ 610.450883 m 0.0000 50 | 4/9
5 h-m-p 0.0002 0.0011 32.8157 ++ 609.604322 m 0.0011 62 | 5/9
6 h-m-p 0.0001 0.0005 54.7422 ++ 608.346977 m 0.0005 74 | 6/9
7 h-m-p 0.0062 1.1227 2.1621 ------------.. | 6/9
8 h-m-p 0.0000 0.0003 142.3111 +++ 602.884864 m 0.0003 109 | 7/9
9 h-m-p 1.6000 8.0000 0.0000 Y 602.884864 0 0.4000 121 | 7/9
10 h-m-p 0.0160 8.0000 0.0000 -------Y 602.884864 0 0.0000 142
Out..
lnL = -602.884864
143 lfun, 429 eigenQcodon, 1716 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.049146 0.078931 0.033420 0.028235 0.015440 0.031024 262.603094 1.595085 0.470776 0.194861 100.452852
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.006480
np = 11
lnL0 = -620.015204
Iterating by ming2
Initial: fx= 620.015204
x= 0.04915 0.07893 0.03342 0.02824 0.01544 0.03102 262.60309 1.59509 0.47078 0.19486 100.45285
1 h-m-p 0.0000 0.0004 85.0746 +++ 616.254363 m 0.0004 17 | 1/11
2 h-m-p 0.0029 0.0250 10.9726 ++ 613.113698 m 0.0250 31 | 2/11
3 h-m-p 0.0004 0.0022 24.9540 ++ 608.124221 m 0.0022 45 | 3/11
4 h-m-p 0.0001 0.0003 788.9425 ++ 605.850167 m 0.0003 59 | 4/11
5 h-m-p 0.0007 0.0037 14.6189 ++ 605.653394 m 0.0037 73 | 5/11
6 h-m-p 0.0398 2.9612 1.3407 --------------.. | 5/11
7 h-m-p 0.0000 0.0002 109.5272 +++ 602.884870 m 0.0002 114 | 6/11
8 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 6/11
9 h-m-p 0.0160 8.0000 0.0000 -----C 602.884870 0 0.0000 166 | 6/11
10 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/11
11 h-m-p 0.0160 8.0000 0.0000 ------------- | 6/11
12 h-m-p 0.0160 8.0000 0.0000 -------------
Out..
lnL = -602.884870
257 lfun, 1028 eigenQcodon, 4626 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -602.882226 S = -602.881393 -0.000318
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 50 patterns 0:03
did 20 / 50 patterns 0:03
did 30 / 50 patterns 0:03
did 40 / 50 patterns 0:03
did 50 / 50 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.037695 0.075922 0.064782 0.069716 0.031259 0.069932 262.603099 0.847560 1.318549
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.122134
np = 9
lnL0 = -653.052840
Iterating by ming2
Initial: fx= 653.052840
x= 0.03769 0.07592 0.06478 0.06972 0.03126 0.06993 262.60310 0.84756 1.31855
1 h-m-p 0.0000 0.0002 336.9870 +++ 627.054852 m 0.0002 24 | 1/9
2 h-m-p 0.0030 0.0367 22.9959 ++ 625.591672 m 0.0367 45 | 2/9
3 h-m-p 0.0005 0.0050 83.7614 ++ 608.389209 m 0.0050 65 | 3/9
4 h-m-p 0.0000 0.0002 59.4580 ++ 607.874968 m 0.0002 84 | 4/9
5 h-m-p 0.0001 0.0011 159.5596 +++ 607.003457 m 0.0011 103 | 5/9
6 h-m-p 0.0001 0.0004 1560.0557 ++ 603.357506 m 0.0004 120 | 6/9
7 h-m-p 0.0193 3.0783 31.8559 -------------.. | 6/9
8 h-m-p 0.0000 0.0000 149.4895 ++ 602.884860 m 0.0000 162 | 7/9
9 h-m-p 0.0334 8.0000 0.0000 Y 602.884860 0 0.0104 177 | 7/9
10 h-m-p 0.6996 8.0000 0.0000 Y 602.884860 0 0.6996 191
Out..
lnL = -602.884860
192 lfun, 2112 eigenQcodon, 11520 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.097435 0.088449 0.076139 0.081480 0.049930 0.036789 262.602878 0.900000 1.041986 1.124220 85.127409
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.009779
np = 11
lnL0 = -622.986632
Iterating by ming2
Initial: fx= 622.986632
x= 0.09744 0.08845 0.07614 0.08148 0.04993 0.03679 262.60288 0.90000 1.04199 1.12422 85.12741
1 h-m-p 0.0000 0.0013 89.2653 +++YYCYCCCCC 618.820112 8 0.0008 43 | 0/11
2 h-m-p 0.0001 0.0004 119.7724 ++ 615.170360 m 0.0004 68 | 1/11
3 h-m-p 0.0077 0.0610 6.1901 ++ 613.505412 m 0.0610 93 | 2/11
4 h-m-p 0.0000 0.0002 1991.0459 ++ 611.957843 m 0.0002 117 | 3/11
5 h-m-p 0.0003 0.0013 582.6910 ++ 607.733784 m 0.0013 140 | 4/11
6 h-m-p 0.0000 0.0000 52840.6296 ++ 606.037618 m 0.0000 162 | 5/11
7 h-m-p 0.0003 0.0017 186.4210 ++ 602.884867 m 0.0017 183 | 6/11
8 h-m-p 1.6000 8.0000 0.0000 ++ 602.884867 m 8.0000 203 | 6/11
9 h-m-p 0.0051 2.5317 0.7421 ---------Y 602.884867 0 0.0000 231 | 6/11
10 h-m-p 0.0160 8.0000 0.0000 +++++ 602.884867 m 8.0000 253 | 6/11
11 h-m-p 0.0025 1.2585 1.5072 ---------N 602.884867 0 0.0000 281 | 6/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 602.884867 m 8.0000 303 | 6/11
13 h-m-p 0.0003 0.1311 4.4003 +++++ 602.884861 m 0.1311 325 | 6/11
14 h-m-p 1.1489 5.7447 0.4339 --Y 602.884860 0 0.0334 346 | 6/11
15 h-m-p 1.6000 8.0000 0.0012 C 602.884860 0 1.2959 365 | 6/11
16 h-m-p 1.6000 8.0000 0.0000 ---C 602.884860 0 0.0063 387
Out..
lnL = -602.884860
388 lfun, 4656 eigenQcodon, 25608 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -602.911609 S = -602.884673 -0.011867
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 50 patterns 0:13
did 20 / 50 patterns 0:13
did 30 / 50 patterns 0:13
did 40 / 50 patterns 0:14
did 50 / 50 patterns 0:14
Time used: 0:14
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=153
NC_011896_1_WP_010907882_1_732_MLBR_RS03460 VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
NC_002677_1_NP_301558_1_430_sdhC VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
NZ_LVXE01000001_1_WP_010907882_1_117_A3216_RS00570 VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
NZ_LYPH01000001_1_WP_010907882_1_106_A8144_RS00520 VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
NZ_CP029543_1_WP_010907882_1_751_sdhC VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
NZ_AP014567_1_WP_010907882_1_764_sdhC VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF
**************************************************
NC_011896_1_WP_010907882_1_732_MLBR_RS03460 FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
NC_002677_1_NP_301558_1_430_sdhC FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
NZ_LVXE01000001_1_WP_010907882_1_117_A3216_RS00570 FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
NZ_LYPH01000001_1_WP_010907882_1_106_A8144_RS00520 FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
NZ_CP029543_1_WP_010907882_1_751_sdhC FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
NZ_AP014567_1_WP_010907882_1_764_sdhC FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG
**************************************************
NC_011896_1_WP_010907882_1_732_MLBR_RS03460 IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
NC_002677_1_NP_301558_1_430_sdhC IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
NZ_LVXE01000001_1_WP_010907882_1_117_A3216_RS00570 IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
NZ_LYPH01000001_1_WP_010907882_1_106_A8144_RS00520 IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
NZ_CP029543_1_WP_010907882_1_751_sdhC IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
NZ_AP014567_1_WP_010907882_1_764_sdhC IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE
**************************************************
NC_011896_1_WP_010907882_1_732_MLBR_RS03460 HFR
NC_002677_1_NP_301558_1_430_sdhC HFR
NZ_LVXE01000001_1_WP_010907882_1_117_A3216_RS00570 HFR
NZ_LYPH01000001_1_WP_010907882_1_106_A8144_RS00520 HFR
NZ_CP029543_1_WP_010907882_1_751_sdhC HFR
NZ_AP014567_1_WP_010907882_1_764_sdhC HFR
***
>NC_011896_1_WP_010907882_1_732_MLBR_RS03460 GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG CACTTCCGA >NC_002677_1_NP_301558_1_430_sdhC GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG CACTTCCGA >NZ_LVXE01000001_1_WP_010907882_1_117_A3216_RS00570 GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG CACTTCCGA >NZ_LYPH01000001_1_WP_010907882_1_106_A8144_RS00520 GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG CACTTCCGA >NZ_CP029543_1_WP_010907882_1_751_sdhC GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG CACTTCCGA >NZ_AP014567_1_WP_010907882_1_764_sdhC GTGAGGACAACGGCGACACCCGCGAATCCGGCTACATCGAGACCAGTAGC AGCATCATCGCGCAGACGGCGACCACCCACGACCACATACCGGGGAGATC CCGGTATGTGGTCGTGGGTGCTGCATCGTATCAGCGGCGCGACCATTTTC TTCTTCCTATTCGTCCACGTACTGGACGCTGCGATGTTGCGAGTGAACCC GCAGACCTACAACGCGGTGCTTTCTACCTACAAGGCCCCGATCGTCGGCT TCATGGAGTATGGCCTGGTGGCCGCGGTGGGATTCCACGGGTTGAACGGG ATCCGGGTCATCCTGATCGACTTCTGGTCTGAAGGCCCCCGCCACCAGCG GTTGATGCTGTGGATCATCAGCGTCATCTTCTTGCTGCTCTTGGTCCCAG CCGGAGTGGTAATTGGCATACACATGTGGGAACACTTCCGAATGTGGGAG CACTTCCGA
>NC_011896_1_WP_010907882_1_732_MLBR_RS03460 VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE HFR >NC_002677_1_NP_301558_1_430_sdhC VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE HFR >NZ_LVXE01000001_1_WP_010907882_1_117_A3216_RS00570 VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE HFR >NZ_LYPH01000001_1_WP_010907882_1_106_A8144_RS00520 VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE HFR >NZ_CP029543_1_WP_010907882_1_751_sdhC VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE HFR >NZ_AP014567_1_WP_010907882_1_764_sdhC VRTTATPANPATSRPVAASSRRRRPPTTTYRGDPGMWSWVLHRISGATIF FFLFVHVLDAAMLRVNPQTYNAVLSTYKAPIVGFMEYGLVAAVGFHGLNG IRVILIDFWSEGPRHQRLMLWIISVIFLLLLVPAGVVIGIHMWEHFRMWE HFR
#NEXUS
[ID: 0673915379]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907882_1_732_MLBR_RS03460
NC_002677_1_NP_301558_1_430_sdhC
NZ_LVXE01000001_1_WP_010907882_1_117_A3216_RS00570
NZ_LYPH01000001_1_WP_010907882_1_106_A8144_RS00520
NZ_CP029543_1_WP_010907882_1_751_sdhC
NZ_AP014567_1_WP_010907882_1_764_sdhC
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907882_1_732_MLBR_RS03460,
2 NC_002677_1_NP_301558_1_430_sdhC,
3 NZ_LVXE01000001_1_WP_010907882_1_117_A3216_RS00570,
4 NZ_LYPH01000001_1_WP_010907882_1_106_A8144_RS00520,
5 NZ_CP029543_1_WP_010907882_1_751_sdhC,
6 NZ_AP014567_1_WP_010907882_1_764_sdhC
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07055986,2:0.06821046,3:0.0671548,4:0.06644567,5:0.07076973,6:0.07199989);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07055986,2:0.06821046,3:0.0671548,4:0.06644567,5:0.07076973,6:0.07199989);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -630.17 -632.94
2 -630.12 -632.87
--------------------------------------
TOTAL -630.15 -632.91
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/sdhC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895467 0.088758 0.341366 1.458674 0.865281 1371.67 1436.33 1.000
r(A<->C){all} 0.168815 0.019752 0.000048 0.439890 0.135987 92.72 211.62 1.002
r(A<->G){all} 0.167028 0.020190 0.000055 0.448200 0.131661 152.12 315.77 1.010
r(A<->T){all} 0.162905 0.018367 0.000034 0.425846 0.128373 267.07 337.72 1.001
r(C<->G){all} 0.173965 0.021164 0.000216 0.469932 0.136393 167.91 245.76 1.000
r(C<->T){all} 0.157300 0.018560 0.000003 0.431754 0.116613 134.70 200.52 1.006
r(G<->T){all} 0.169986 0.021863 0.000025 0.476445 0.128026 161.91 195.43 1.000
pi(A){all} 0.191936 0.000340 0.155658 0.227444 0.191417 1176.67 1332.13 1.000
pi(C){all} 0.296358 0.000458 0.254796 0.337559 0.295432 1206.21 1248.07 1.000
pi(G){all} 0.293977 0.000431 0.255530 0.336018 0.293590 1052.50 1153.57 1.000
pi(T){all} 0.217729 0.000372 0.180788 0.254163 0.217399 1113.18 1147.97 1.000
alpha{1,2} 0.411589 0.218317 0.000171 1.348548 0.238010 1238.73 1321.94 1.000
alpha{3} 0.460934 0.256817 0.000111 1.492665 0.297549 940.95 1119.12 1.000
pinvar{all} 0.996692 0.000014 0.989332 0.999996 0.997910 1138.48 1237.35 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/12res/sdhC/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 153
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 10 10 10 10 10 10 | TCC 0 0 0 0 0 0 | TAC 3 3 3 3 3 3 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 5 5 5 5 5 5 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 1 1 1 1 1 1
CTC 1 1 1 1 1 1 | CCC 4 4 4 4 4 4 | CAC 6 6 6 6 6 6 | CGC 2 2 2 2 2 2
CTA 1 1 1 1 1 1 | CCA 3 3 3 3 3 3 | Gln CAA 0 0 0 0 0 0 | CGA 4 4 4 4 4 4
CTG 6 6 6 6 6 6 | CCG 3 3 3 3 3 3 | CAG 2 2 2 2 2 2 | CGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 0 0 0 0 0 0 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 8 8 8 8 8 8 | ACC 4 4 4 4 4 4 | AAC 3 3 3 3 3 3 | AGC 2 2 2 2 2 2
ATA 1 1 1 1 1 1 | ACA 4 4 4 4 4 4 | Lys AAA 0 0 0 0 0 0 | Arg AGA 2 2 2 2 2 2
Met ATG 6 6 6 6 6 6 | ACG 2 2 2 2 2 2 | AAG 1 1 1 1 1 1 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 2 2 2 2 2 2 | Asp GAT 1 1 1 1 1 1 | Gly GGT 1 1 1 1 1 1
GTC 5 5 5 5 5 5 | GCC 3 3 3 3 3 3 | GAC 2 2 2 2 2 2 | GGC 5 5 5 5 5 5
GTA 3 3 3 3 3 3 | GCA 2 2 2 2 2 2 | Glu GAA 2 2 2 2 2 2 | GGA 3 3 3 3 3 3
GTG 7 7 7 7 7 7 | GCG 6 6 6 6 6 6 | GAG 2 2 2 2 2 2 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907882_1_732_MLBR_RS03460
position 1: T:0.20261 C:0.25490 A:0.24183 G:0.30065
position 2: T:0.36601 C:0.25490 A:0.16340 G:0.21569
position 3: T:0.08497 C:0.37908 A:0.16993 G:0.36601
Average T:0.21786 C:0.29630 A:0.19172 G:0.29412
#2: NC_002677_1_NP_301558_1_430_sdhC
position 1: T:0.20261 C:0.25490 A:0.24183 G:0.30065
position 2: T:0.36601 C:0.25490 A:0.16340 G:0.21569
position 3: T:0.08497 C:0.37908 A:0.16993 G:0.36601
Average T:0.21786 C:0.29630 A:0.19172 G:0.29412
#3: NZ_LVXE01000001_1_WP_010907882_1_117_A3216_RS00570
position 1: T:0.20261 C:0.25490 A:0.24183 G:0.30065
position 2: T:0.36601 C:0.25490 A:0.16340 G:0.21569
position 3: T:0.08497 C:0.37908 A:0.16993 G:0.36601
Average T:0.21786 C:0.29630 A:0.19172 G:0.29412
#4: NZ_LYPH01000001_1_WP_010907882_1_106_A8144_RS00520
position 1: T:0.20261 C:0.25490 A:0.24183 G:0.30065
position 2: T:0.36601 C:0.25490 A:0.16340 G:0.21569
position 3: T:0.08497 C:0.37908 A:0.16993 G:0.36601
Average T:0.21786 C:0.29630 A:0.19172 G:0.29412
#5: NZ_CP029543_1_WP_010907882_1_751_sdhC
position 1: T:0.20261 C:0.25490 A:0.24183 G:0.30065
position 2: T:0.36601 C:0.25490 A:0.16340 G:0.21569
position 3: T:0.08497 C:0.37908 A:0.16993 G:0.36601
Average T:0.21786 C:0.29630 A:0.19172 G:0.29412
#6: NZ_AP014567_1_WP_010907882_1_764_sdhC
position 1: T:0.20261 C:0.25490 A:0.24183 G:0.30065
position 2: T:0.36601 C:0.25490 A:0.16340 G:0.21569
position 3: T:0.08497 C:0.37908 A:0.16993 G:0.36601
Average T:0.21786 C:0.29630 A:0.19172 G:0.29412
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 12 | Tyr Y TAT 6 | Cys C TGT 0
TTC 60 | TCC 0 | TAC 18 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 30 | TCG 18 | TAG 0 | Trp W TGG 36
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 6
CTC 6 | CCC 24 | CAC 36 | CGC 12
CTA 6 | CCA 18 | Gln Q CAA 0 | CGA 24
CTG 36 | CCG 18 | CAG 12 | CGG 24
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 0 | Asn N AAT 6 | Ser S AGT 0
ATC 48 | ACC 24 | AAC 18 | AGC 12
ATA 6 | ACA 24 | Lys K AAA 0 | Arg R AGA 12
Met M ATG 36 | ACG 12 | AAG 6 | AGG 6
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 12 | Asp D GAT 6 | Gly G GGT 6
GTC 30 | GCC 18 | GAC 12 | GGC 30
GTA 18 | GCA 12 | Glu E GAA 12 | GGA 18
GTG 42 | GCG 36 | GAG 12 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.20261 C:0.25490 A:0.24183 G:0.30065
position 2: T:0.36601 C:0.25490 A:0.16340 G:0.21569
position 3: T:0.08497 C:0.37908 A:0.16993 G:0.36601
Average T:0.21786 C:0.29630 A:0.19172 G:0.29412
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -602.884870 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 262.603093 85.127409
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907882_1_732_MLBR_RS03460: 0.000004, NC_002677_1_NP_301558_1_430_sdhC: 0.000004, NZ_LVXE01000001_1_WP_010907882_1_117_A3216_RS00570: 0.000004, NZ_LYPH01000001_1_WP_010907882_1_106_A8144_RS00520: 0.000004, NZ_CP029543_1_WP_010907882_1_751_sdhC: 0.000004, NZ_AP014567_1_WP_010907882_1_764_sdhC: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 262.60309
omega (dN/dS) = 85.12741
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 338.9 120.1 85.1274 0.0000 0.0000 0.0 0.0
7..2 0.000 338.9 120.1 85.1274 0.0000 0.0000 0.0 0.0
7..3 0.000 338.9 120.1 85.1274 0.0000 0.0000 0.0 0.0
7..4 0.000 338.9 120.1 85.1274 0.0000 0.0000 0.0 0.0
7..5 0.000 338.9 120.1 85.1274 0.0000 0.0000 0.0 0.0
7..6 0.000 338.9 120.1 85.1274 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -602.884864 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 262.603094 0.708149 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907882_1_732_MLBR_RS03460: 0.000004, NC_002677_1_NP_301558_1_430_sdhC: 0.000004, NZ_LVXE01000001_1_WP_010907882_1_117_A3216_RS00570: 0.000004, NZ_LYPH01000001_1_WP_010907882_1_106_A8144_RS00520: 0.000004, NZ_CP029543_1_WP_010907882_1_751_sdhC: 0.000004, NZ_AP014567_1_WP_010907882_1_764_sdhC: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 262.60309
MLEs of dN/dS (w) for site classes (K=2)
p: 0.70815 0.29185
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 338.9 120.1 0.2919 0.0000 0.0000 0.0 0.0
7..2 0.000 338.9 120.1 0.2919 0.0000 0.0000 0.0 0.0
7..3 0.000 338.9 120.1 0.2919 0.0000 0.0000 0.0 0.0
7..4 0.000 338.9 120.1 0.2919 0.0000 0.0000 0.0 0.0
7..5 0.000 338.9 120.1 0.2919 0.0000 0.0000 0.0 0.0
7..6 0.000 338.9 120.1 0.2919 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
check convergence..
lnL(ntime: 6 np: 11): -602.884870 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 262.603099 0.724356 0.175768 0.086689 100.453879
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907882_1_732_MLBR_RS03460: 0.000004, NC_002677_1_NP_301558_1_430_sdhC: 0.000004, NZ_LVXE01000001_1_WP_010907882_1_117_A3216_RS00570: 0.000004, NZ_LYPH01000001_1_WP_010907882_1_106_A8144_RS00520: 0.000004, NZ_CP029543_1_WP_010907882_1_751_sdhC: 0.000004, NZ_AP014567_1_WP_010907882_1_764_sdhC: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 262.60310
MLEs of dN/dS (w) for site classes (K=3)
p: 0.72436 0.17577 0.09988
w: 0.08669 1.00000 100.45388
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 338.9 120.1 10.2715 0.0000 0.0000 0.0 0.0
7..2 0.000 338.9 120.1 10.2715 0.0000 0.0000 0.0 0.0
7..3 0.000 338.9 120.1 10.2715 0.0000 0.0000 0.0 0.0
7..4 0.000 338.9 120.1 10.2715 0.0000 0.0000 0.0 0.0
7..5 0.000 338.9 120.1 10.2715 0.0000 0.0000 0.0 0.0
7..6 0.000 338.9 120.1 10.2715 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907882_1_732_MLBR_RS03460)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907882_1_732_MLBR_RS03460)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -602.884860 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 262.602878 0.005000 0.962239
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907882_1_732_MLBR_RS03460: 0.000004, NC_002677_1_NP_301558_1_430_sdhC: 0.000004, NZ_LVXE01000001_1_WP_010907882_1_117_A3216_RS00570: 0.000004, NZ_LYPH01000001_1_WP_010907882_1_106_A8144_RS00520: 0.000004, NZ_CP029543_1_WP_010907882_1_751_sdhC: 0.000004, NZ_AP014567_1_WP_010907882_1_764_sdhC: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 262.60288
Parameters in M7 (beta):
p = 0.00500 q = 0.96224
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00004
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 338.9 120.1 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 338.9 120.1 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 338.9 120.1 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 338.9 120.1 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 338.9 120.1 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 338.9 120.1 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -602.884860 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 262.633249 0.999589 0.105304 2.347059 85.167670
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907882_1_732_MLBR_RS03460: 0.000004, NC_002677_1_NP_301558_1_430_sdhC: 0.000004, NZ_LVXE01000001_1_WP_010907882_1_117_A3216_RS00570: 0.000004, NZ_LYPH01000001_1_WP_010907882_1_106_A8144_RS00520: 0.000004, NZ_CP029543_1_WP_010907882_1_751_sdhC: 0.000004, NZ_AP014567_1_WP_010907882_1_764_sdhC: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 262.63325
Parameters in M8 (beta&w>1):
p0 = 0.99959 p = 0.10530 q = 2.34706
(p1 = 0.00041) w = 85.16767
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09996 0.09996 0.09996 0.09996 0.09996 0.09996 0.09996 0.09996 0.09996 0.09996 0.00041
w: 0.00000 0.00000 0.00000 0.00001 0.00016 0.00109 0.00534 0.02121 0.07424 0.27040 85.16767
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 338.9 120.1 0.0722 0.0000 0.0000 0.0 0.0
7..2 0.000 338.9 120.1 0.0722 0.0000 0.0000 0.0 0.0
7..3 0.000 338.9 120.1 0.0722 0.0000 0.0000 0.0 0.0
7..4 0.000 338.9 120.1 0.0722 0.0000 0.0000 0.0 0.0
7..5 0.000 338.9 120.1 0.0722 0.0000 0.0000 0.0 0.0
7..6 0.000 338.9 120.1 0.0722 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907882_1_732_MLBR_RS03460)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.098 0.099 0.099 0.100 0.100 0.101 0.101 0.102 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.101 0.101 0.101 0.100 0.100 0.099 0.099 0.099 0.098
Time used: 0:14
Model 1: NearlyNeutral -602.884864 Model 2: PositiveSelection -602.88487 Model 0: one-ratio -602.88487 Model 7: beta -602.88486 Model 8: beta&w>1 -602.88486 Model 0 vs 1 1.1999999969702912E-5 Model 2 vs 1 1.1999999969702912E-5 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
