--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:17:39 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/secE/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -601.53 -605.37
2 -601.59 -605.91
--------------------------------------
TOTAL -601.56 -605.68
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.886563 0.089662 0.354160 1.461404 0.849453 1049.55 1210.64 1.000
r(A<->C){all} 0.156241 0.017958 0.000003 0.429621 0.118311 157.23 284.13 1.001
r(A<->G){all} 0.181389 0.022563 0.000043 0.478846 0.139931 186.83 291.04 1.000
r(A<->T){all} 0.171006 0.018833 0.000048 0.441819 0.140652 152.57 210.38 1.000
r(C<->G){all} 0.170506 0.022866 0.000070 0.479111 0.128981 97.26 119.55 1.005
r(C<->T){all} 0.158667 0.018525 0.000065 0.447954 0.122132 138.00 154.87 1.001
r(G<->T){all} 0.162191 0.018837 0.000183 0.445299 0.123893 241.03 251.08 1.000
pi(A){all} 0.219847 0.000386 0.182063 0.258193 0.219455 1111.18 1306.09 1.001
pi(C){all} 0.262723 0.000434 0.223421 0.303635 0.262276 1237.51 1353.83 1.000
pi(G){all} 0.318872 0.000491 0.278141 0.364499 0.318591 1283.12 1298.97 1.000
pi(T){all} 0.198557 0.000369 0.164891 0.239683 0.198101 1217.96 1313.06 1.000
alpha{1,2} 0.406443 0.215752 0.000156 1.369227 0.242433 1302.79 1401.90 1.001
alpha{3} 0.456536 0.232722 0.000128 1.424201 0.307486 1133.55 1224.74 1.000
pinvar{all} 0.996269 0.000021 0.987772 0.999998 0.997700 1276.75 1353.15 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -579.957426
Model 2: PositiveSelection -579.957381
Model 0: one-ratio -579.957418
Model 7: beta -579.957465
Model 8: beta&w>1 -579.95738
Model 0 vs 1 1.600000018697756E-5
Model 2 vs 1 9.000000000014552E-5
Model 8 vs 7 1.700000000255386E-4
>C1
VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
>C2
VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
>C3
VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
>C4
VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
>C5
VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
>C6
VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=146
C1 VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
C2 VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
C3 VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
C4 VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
C5 VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
C6 VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
**************************************************
C1 NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
C2 NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
C3 NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
C4 NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
C5 NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
C6 NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
**************************************************
C1 MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
C2 MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
C3 MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
C4 MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
C5 MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
C6 MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
**********************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4380]--->[4380]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.456 Mb, Max= 30.669 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
C2 VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
C3 VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
C4 VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
C5 VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
C6 VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
**************************************************
C1 NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
C2 NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
C3 NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
C4 NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
C5 NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
C6 NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
**************************************************
C1 MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
C2 MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
C3 MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
C4 MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
C5 MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
C6 MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
**********************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG
C2 GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG
C3 GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG
C4 GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG
C5 GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG
C6 GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG
**************************************************
C1 TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC
C2 TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC
C3 TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC
C4 TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC
C5 TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC
C6 TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC
**************************************************
C1 CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG
C2 CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG
C3 CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG
C4 CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG
C5 CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG
C6 CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG
**************************************************
C1 AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT
C2 AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT
C3 AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT
C4 AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT
C5 AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT
C6 AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT
**************************************************
C1 TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG
C2 TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG
C3 TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG
C4 TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG
C5 TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG
C6 TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG
**************************************************
C1 CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG
C2 CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG
C3 CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG
C4 CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG
C5 CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG
C6 CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG
**************************************************
C1 ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC
C2 ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC
C3 ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC
C4 ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC
C5 ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC
C6 ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC
**************************************************
C1 AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG
C2 AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG
C3 AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG
C4 AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG
C5 AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG
C6 AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG
**************************************************
C1 ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC
C2 ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC
C3 ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC
C4 ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC
C5 ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC
C6 ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC
**************************************
>C1
GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG
TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC
CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG
AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT
TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG
CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG
ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC
AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG
ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC
>C2
GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG
TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC
CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG
AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT
TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG
CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG
ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC
AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG
ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC
>C3
GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG
TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC
CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG
AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT
TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG
CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG
ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC
AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG
ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC
>C4
GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG
TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC
CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG
AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT
TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG
CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG
ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC
AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG
ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC
>C5
GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG
TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC
CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG
AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT
TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG
CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG
ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC
AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG
ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC
>C6
GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG
TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC
CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG
AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT
TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG
CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG
ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC
AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG
ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC
>C1
VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
>C2
VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
>C3
VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
>C4
VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
>C5
VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
>C6
VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 438 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579788980
Setting output file names to "/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 2063391820
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0120562606
Seed = 2029700465
Swapseed = 1579788980
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -980.264998 -- -24.965149
Chain 2 -- -980.264998 -- -24.965149
Chain 3 -- -980.264848 -- -24.965149
Chain 4 -- -980.264998 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -980.264941 -- -24.965149
Chain 2 -- -980.264941 -- -24.965149
Chain 3 -- -980.264998 -- -24.965149
Chain 4 -- -980.264998 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-980.265] (-980.265) (-980.265) (-980.265) * [-980.265] (-980.265) (-980.265) (-980.265)
500 -- (-615.492) [-611.479] (-608.488) (-615.700) * (-611.106) [-613.252] (-618.272) (-610.434) -- 0:00:00
1000 -- (-611.103) [-605.480] (-611.733) (-606.942) * (-609.836) (-610.083) (-616.827) [-609.246] -- 0:00:00
1500 -- (-611.622) (-618.990) (-608.732) [-606.195] * [-609.187] (-618.778) (-623.157) (-609.042) -- 0:00:00
2000 -- (-605.930) (-612.523) (-611.126) [-605.142] * (-610.803) (-618.609) (-624.300) [-610.987] -- 0:00:00
2500 -- (-614.218) (-618.282) (-608.425) [-612.202] * (-613.260) (-613.125) [-609.426] (-609.471) -- 0:00:00
3000 -- (-615.288) [-608.237] (-613.226) (-615.809) * (-618.616) (-610.844) [-605.609] (-608.151) -- 0:00:00
3500 -- (-609.017) (-617.622) (-611.874) [-608.903] * [-608.908] (-615.854) (-615.898) (-609.185) -- 0:00:00
4000 -- [-612.569] (-617.958) (-614.124) (-620.074) * (-611.378) (-608.213) [-605.323] (-609.837) -- 0:00:00
4500 -- [-610.308] (-618.354) (-618.955) (-614.137) * (-611.989) (-611.879) [-610.062] (-611.772) -- 0:00:00
5000 -- (-616.535) [-608.958] (-613.551) (-611.388) * [-605.046] (-610.960) (-611.422) (-612.083) -- 0:00:00
Average standard deviation of split frequencies: 0.078567
5500 -- (-624.324) (-611.083) (-616.798) [-616.497] * (-614.645) [-610.495] (-610.824) (-610.192) -- 0:03:00
6000 -- (-624.852) [-606.405] (-615.591) (-616.392) * (-608.424) (-621.631) [-610.908] (-629.557) -- 0:02:45
6500 -- [-607.880] (-612.898) (-613.643) (-609.336) * (-610.324) (-610.736) [-612.234] (-615.593) -- 0:02:32
7000 -- (-616.381) [-605.824] (-617.653) (-613.869) * (-614.145) (-611.874) [-605.661] (-619.394) -- 0:02:21
7500 -- (-611.333) (-618.422) (-618.131) [-620.256] * (-611.327) (-608.156) (-612.764) [-606.771] -- 0:02:12
8000 -- (-608.253) [-616.987] (-617.857) (-610.843) * (-607.567) (-614.920) [-617.818] (-612.203) -- 0:02:04
8500 -- (-613.994) (-607.165) [-608.084] (-611.823) * [-608.431] (-615.787) (-604.894) (-613.298) -- 0:01:56
9000 -- (-616.267) (-614.401) [-603.677] (-609.688) * [-609.963] (-608.435) (-621.552) (-613.696) -- 0:01:50
9500 -- [-611.286] (-615.533) (-614.533) (-612.512) * (-609.690) (-613.458) (-621.266) [-609.603] -- 0:01:44
10000 -- (-619.366) (-615.620) (-612.044) [-609.603] * (-615.971) (-610.697) (-612.822) [-610.087] -- 0:01:39
Average standard deviation of split frequencies: 0.072920
10500 -- [-605.865] (-608.447) (-609.012) (-615.003) * (-608.658) (-605.139) [-610.180] (-615.621) -- 0:01:34
11000 -- (-612.658) (-613.692) [-613.597] (-607.336) * (-630.684) (-612.346) [-610.093] (-609.960) -- 0:01:29
11500 -- (-617.539) (-612.445) (-613.652) [-610.280] * (-619.904) (-615.775) [-611.800] (-609.800) -- 0:01:25
12000 -- (-611.569) (-612.779) (-604.067) [-612.282] * (-614.080) (-610.623) [-622.534] (-611.495) -- 0:01:22
12500 -- (-614.812) (-617.654) [-611.867] (-609.042) * (-609.236) (-616.361) [-610.652] (-611.488) -- 0:01:19
13000 -- [-612.085] (-610.330) (-613.745) (-612.530) * (-624.019) (-607.526) [-611.248] (-616.995) -- 0:01:15
13500 -- (-606.201) [-606.289] (-614.419) (-610.384) * (-605.466) (-614.601) [-606.584] (-616.677) -- 0:01:13
14000 -- (-614.905) [-605.394] (-611.599) (-609.365) * (-614.651) (-608.563) (-609.442) [-608.037] -- 0:01:10
14500 -- (-617.248) [-617.179] (-611.261) (-614.986) * (-612.685) (-618.642) (-616.433) [-611.203] -- 0:01:07
15000 -- (-611.081) (-609.797) [-608.553] (-618.558) * [-606.961] (-607.916) (-610.763) (-621.392) -- 0:01:05
Average standard deviation of split frequencies: 0.061872
15500 -- (-611.363) (-614.603) [-610.642] (-615.139) * (-629.311) [-610.883] (-609.079) (-611.303) -- 0:01:03
16000 -- (-608.414) [-612.929] (-608.325) (-612.967) * (-612.614) [-614.155] (-607.916) (-606.805) -- 0:01:01
16500 -- (-609.072) (-606.399) (-613.153) [-610.548] * (-603.074) (-616.006) [-604.097] (-614.237) -- 0:00:59
17000 -- (-611.495) (-620.428) [-611.594] (-612.388) * [-602.377] (-614.084) (-607.366) (-610.576) -- 0:00:57
17500 -- (-614.052) (-617.622) (-610.434) [-607.641] * (-601.268) (-613.964) [-609.861] (-609.903) -- 0:00:56
18000 -- [-610.950] (-616.061) (-610.266) (-611.708) * (-603.897) (-614.250) [-606.540] (-605.855) -- 0:00:54
18500 -- (-608.855) (-612.640) [-611.461] (-618.750) * (-600.300) [-609.649] (-615.346) (-605.082) -- 0:00:53
19000 -- (-600.846) [-600.669] (-614.410) (-607.370) * (-601.903) (-613.603) [-608.746] (-618.060) -- 0:00:51
19500 -- (-602.405) [-601.163] (-619.213) (-614.810) * (-601.374) (-616.490) [-607.086] (-610.330) -- 0:00:50
20000 -- (-603.139) [-604.042] (-612.641) (-611.110) * (-603.300) (-620.663) (-605.787) [-610.593] -- 0:00:49
Average standard deviation of split frequencies: 0.062094
20500 -- (-601.321) (-603.895) (-617.478) [-608.717] * [-601.778] (-614.374) (-612.955) (-610.127) -- 0:00:47
21000 -- (-600.622) [-601.414] (-613.463) (-609.534) * [-602.157] (-604.746) (-608.407) (-610.971) -- 0:01:33
21500 -- (-602.805) [-603.580] (-600.288) (-608.718) * (-600.250) (-607.734) [-612.457] (-617.327) -- 0:01:31
22000 -- (-602.608) (-600.910) (-605.963) [-614.211] * [-600.959] (-612.177) (-618.307) (-616.957) -- 0:01:28
22500 -- (-600.940) (-606.870) (-603.530) [-610.488] * (-603.064) (-623.054) [-618.200] (-607.223) -- 0:01:26
23000 -- [-603.532] (-602.615) (-600.807) (-624.389) * (-604.174) (-616.598) (-616.772) [-611.923] -- 0:01:24
23500 -- [-602.109] (-603.958) (-600.702) (-612.191) * (-604.804) [-611.583] (-609.787) (-615.587) -- 0:01:23
24000 -- (-601.090) [-600.914] (-602.853) (-606.580) * [-602.642] (-613.462) (-618.646) (-607.308) -- 0:01:21
24500 -- (-602.395) (-601.677) [-602.865] (-602.302) * (-603.438) (-608.547) (-611.421) [-612.108] -- 0:01:19
25000 -- (-600.749) (-601.617) (-602.014) [-600.449] * [-602.486] (-610.324) (-617.677) (-617.824) -- 0:01:18
Average standard deviation of split frequencies: 0.051920
25500 -- (-600.253) (-601.339) [-601.765] (-600.872) * (-601.635) (-626.756) [-607.613] (-607.787) -- 0:01:16
26000 -- [-603.535] (-601.022) (-603.833) (-605.369) * (-605.284) (-609.907) (-615.267) [-609.350] -- 0:01:14
26500 -- [-602.163] (-601.179) (-606.750) (-601.745) * (-605.957) [-607.563] (-615.468) (-612.048) -- 0:01:13
27000 -- (-603.515) (-602.372) (-602.784) [-603.179] * (-601.523) [-605.185] (-611.064) (-612.250) -- 0:01:12
27500 -- (-603.566) (-608.425) (-604.658) [-601.362] * (-605.118) (-603.492) (-608.595) [-607.209] -- 0:01:10
28000 -- (-602.157) (-602.707) [-600.790] (-601.961) * (-600.953) (-600.435) [-609.989] (-614.938) -- 0:01:09
28500 -- [-601.369] (-603.873) (-601.580) (-603.426) * (-603.122) (-600.850) (-606.316) [-607.519] -- 0:01:08
29000 -- (-604.614) (-602.587) (-600.863) [-601.296] * (-605.117) (-600.538) [-613.345] (-619.655) -- 0:01:06
29500 -- [-602.122] (-603.696) (-603.597) (-601.938) * (-604.068) (-601.733) (-616.733) [-609.911] -- 0:01:05
30000 -- [-601.746] (-602.969) (-604.269) (-602.614) * [-604.600] (-600.634) (-614.913) (-615.545) -- 0:01:04
Average standard deviation of split frequencies: 0.045417
30500 -- (-602.502) (-601.190) [-601.631] (-602.469) * (-602.583) [-600.410] (-617.551) (-618.298) -- 0:01:03
31000 -- (-603.235) [-601.122] (-602.151) (-602.689) * [-603.836] (-602.613) (-617.937) (-618.476) -- 0:01:02
31500 -- (-604.730) [-601.662] (-602.089) (-602.696) * (-601.526) [-602.982] (-607.212) (-606.680) -- 0:01:01
32000 -- (-604.069) [-601.863] (-601.314) (-603.363) * (-603.002) (-603.223) (-613.836) [-609.721] -- 0:01:00
32500 -- (-604.287) [-603.831] (-601.079) (-601.933) * (-600.735) [-601.323] (-608.411) (-612.147) -- 0:00:59
33000 -- (-605.231) (-602.268) [-601.047] (-602.409) * (-601.077) (-600.099) (-615.900) [-612.229] -- 0:00:58
33500 -- (-602.579) (-607.117) [-600.509] (-602.648) * (-601.667) [-599.989] (-607.840) (-614.808) -- 0:00:57
34000 -- [-602.523] (-607.505) (-605.735) (-602.038) * (-607.374) (-603.336) [-616.170] (-617.402) -- 0:00:56
34500 -- (-600.555) (-610.964) [-605.518] (-600.737) * (-603.711) (-601.600) (-613.094) [-617.144] -- 0:00:55
35000 -- (-601.169) (-608.098) [-600.132] (-601.194) * (-603.933) [-600.396] (-616.095) (-608.456) -- 0:01:22
Average standard deviation of split frequencies: 0.045831
35500 -- (-602.014) (-601.162) [-602.925] (-600.501) * [-600.630] (-601.273) (-613.134) (-609.536) -- 0:01:21
36000 -- (-601.023) [-601.950] (-601.231) (-602.524) * (-602.449) (-601.733) [-610.719] (-606.267) -- 0:01:20
36500 -- (-602.984) (-601.130) [-602.210] (-605.642) * (-604.578) (-600.612) (-610.112) [-611.245] -- 0:01:19
37000 -- (-601.259) [-602.428] (-606.799) (-602.159) * (-603.940) (-600.963) (-614.965) [-610.712] -- 0:01:18
37500 -- (-603.700) (-601.727) [-601.326] (-601.913) * (-603.876) (-601.952) (-614.928) [-605.004] -- 0:01:17
38000 -- (-601.139) (-603.937) (-602.516) [-602.456] * (-601.826) (-601.960) [-602.524] (-608.573) -- 0:01:15
38500 -- (-601.481) (-602.103) [-600.628] (-602.820) * (-602.741) (-602.195) [-600.765] (-612.200) -- 0:01:14
39000 -- (-603.127) (-603.433) [-600.539] (-600.683) * (-602.101) [-601.287] (-601.385) (-623.161) -- 0:01:13
39500 -- (-605.204) [-603.685] (-600.347) (-601.213) * (-601.192) (-601.568) [-601.699] (-615.356) -- 0:01:12
40000 -- (-603.498) (-602.191) (-601.897) [-604.239] * (-600.591) [-600.643] (-602.031) (-606.253) -- 0:01:12
Average standard deviation of split frequencies: 0.046368
40500 -- (-604.659) (-601.990) (-605.214) [-601.927] * [-600.539] (-605.089) (-603.488) (-601.635) -- 0:01:11
41000 -- (-603.001) [-600.731] (-603.408) (-602.496) * (-600.332) (-602.497) [-603.236] (-600.555) -- 0:01:10
41500 -- (-601.632) [-600.834] (-600.746) (-603.394) * (-600.699) [-600.639] (-605.026) (-602.655) -- 0:01:09
42000 -- (-604.356) (-600.687) (-602.474) [-602.615] * (-603.430) (-602.221) (-601.529) [-602.150] -- 0:01:08
42500 -- (-602.343) (-604.119) (-604.725) [-601.810] * (-602.214) (-604.530) [-601.858] (-602.825) -- 0:01:07
43000 -- (-607.969) (-604.118) (-603.134) [-602.263] * [-602.035] (-601.453) (-602.058) (-603.098) -- 0:01:06
43500 -- (-605.870) (-602.793) (-601.286) [-603.762] * (-601.659) [-601.265] (-602.234) (-602.053) -- 0:01:05
44000 -- [-604.081] (-601.343) (-603.644) (-604.317) * [-600.322] (-601.800) (-603.896) (-604.286) -- 0:01:05
44500 -- (-600.333) (-603.719) (-604.399) [-603.804] * (-601.443) (-602.274) (-600.923) [-602.631] -- 0:01:04
45000 -- (-600.278) (-600.985) [-601.995] (-603.899) * [-600.310] (-601.009) (-600.936) (-600.459) -- 0:01:03
Average standard deviation of split frequencies: 0.044718
45500 -- (-600.233) (-607.582) (-601.758) [-601.494] * (-601.872) (-601.911) [-601.967] (-600.190) -- 0:01:02
46000 -- (-601.679) (-600.562) (-601.684) [-602.417] * (-600.554) (-611.218) [-604.154] (-601.018) -- 0:01:02
46500 -- (-601.309) (-602.228) [-601.522] (-606.862) * [-602.356] (-604.102) (-600.207) (-600.259) -- 0:01:01
47000 -- (-600.387) [-605.044] (-603.997) (-603.882) * (-602.909) (-602.132) [-604.573] (-601.067) -- 0:01:00
47500 -- (-602.399) (-607.121) [-606.769] (-600.377) * (-603.747) [-601.189] (-605.384) (-600.575) -- 0:01:00
48000 -- (-602.936) (-607.647) (-602.490) [-602.449] * (-604.956) (-601.059) [-605.007] (-601.852) -- 0:00:59
48500 -- (-601.482) [-601.209] (-603.698) (-601.660) * (-605.685) [-601.301] (-602.916) (-608.522) -- 0:00:58
49000 -- (-601.286) (-602.593) (-601.838) [-601.379] * (-602.741) (-601.991) (-601.923) [-600.992] -- 0:00:58
49500 -- (-601.744) [-603.787] (-603.038) (-603.713) * [-603.810] (-602.548) (-604.072) (-600.682) -- 0:00:57
50000 -- (-603.465) (-602.260) (-603.009) [-602.535] * [-605.149] (-604.306) (-603.379) (-600.663) -- 0:00:57
Average standard deviation of split frequencies: 0.046030
50500 -- [-600.828] (-603.173) (-601.783) (-601.059) * [-601.652] (-603.212) (-602.525) (-602.599) -- 0:00:56
51000 -- [-601.053] (-602.027) (-602.287) (-601.002) * [-604.135] (-603.664) (-604.044) (-601.139) -- 0:00:55
51500 -- (-601.682) [-603.360] (-601.230) (-602.342) * (-603.455) (-604.890) (-602.001) [-601.487] -- 0:01:13
52000 -- (-600.834) (-602.785) [-604.233] (-601.046) * (-600.882) (-604.430) [-600.566] (-601.065) -- 0:01:12
52500 -- [-600.251] (-601.374) (-604.589) (-603.648) * (-611.381) (-603.148) [-602.697] (-600.293) -- 0:01:12
53000 -- [-602.954] (-600.790) (-601.643) (-601.330) * (-603.935) (-601.805) [-601.255] (-600.820) -- 0:01:11
53500 -- (-602.963) (-603.420) [-600.729] (-600.452) * [-600.714] (-601.402) (-601.806) (-601.614) -- 0:01:10
54000 -- (-601.921) [-604.513] (-601.530) (-600.152) * [-600.899] (-603.663) (-601.356) (-605.113) -- 0:01:10
54500 -- (-603.709) (-606.452) (-605.785) [-601.624] * (-602.085) [-600.839] (-603.552) (-611.100) -- 0:01:09
55000 -- [-603.357] (-602.183) (-603.341) (-600.728) * [-601.516] (-602.629) (-603.443) (-611.705) -- 0:01:08
Average standard deviation of split frequencies: 0.039564
55500 -- (-600.391) (-602.745) [-600.495] (-601.693) * (-601.540) (-601.177) (-606.736) [-602.557] -- 0:01:08
56000 -- [-601.635] (-602.099) (-600.504) (-600.506) * [-600.881] (-602.688) (-604.435) (-604.651) -- 0:01:07
56500 -- (-605.751) (-601.560) [-601.117] (-600.488) * (-601.829) (-605.407) [-602.282] (-601.101) -- 0:01:06
57000 -- [-604.812] (-603.582) (-601.007) (-601.139) * (-603.724) (-605.241) (-601.628) [-601.938] -- 0:01:06
57500 -- (-604.234) [-605.874] (-602.188) (-600.822) * (-605.133) [-603.432] (-600.552) (-602.796) -- 0:01:05
58000 -- (-603.023) [-603.256] (-603.164) (-602.395) * [-601.551] (-602.948) (-602.705) (-604.396) -- 0:01:04
58500 -- (-602.739) [-602.954] (-600.769) (-601.585) * (-601.986) (-600.301) (-600.157) [-600.132] -- 0:01:04
59000 -- (-602.208) (-601.358) (-600.686) [-600.733] * (-601.496) (-603.106) (-600.876) [-603.129] -- 0:01:03
59500 -- [-602.493] (-603.099) (-600.382) (-601.804) * (-601.983) [-605.173] (-603.813) (-604.552) -- 0:01:03
60000 -- (-600.764) [-602.492] (-601.573) (-601.516) * (-602.740) (-600.628) [-600.374] (-604.723) -- 0:01:02
Average standard deviation of split frequencies: 0.040018
60500 -- [-600.551] (-606.162) (-605.797) (-601.476) * (-605.947) [-600.891] (-603.090) (-605.132) -- 0:01:02
61000 -- (-603.131) (-601.682) [-601.899] (-602.404) * (-600.528) (-607.633) (-601.951) [-602.180] -- 0:01:01
61500 -- [-602.243] (-603.799) (-600.185) (-605.206) * (-600.660) (-606.251) [-601.165] (-601.737) -- 0:01:01
62000 -- (-602.592) (-602.279) (-600.700) [-606.424] * (-601.717) (-607.959) [-603.608] (-601.578) -- 0:01:00
62500 -- (-601.505) [-601.376] (-601.966) (-609.139) * (-601.143) (-604.132) [-600.153] (-603.115) -- 0:01:00
63000 -- (-602.208) (-603.280) (-601.428) [-603.998] * (-603.489) [-603.114] (-602.216) (-600.223) -- 0:00:59
63500 -- (-601.278) (-603.510) [-602.308] (-603.628) * (-604.884) (-602.150) [-603.951] (-601.228) -- 0:00:58
64000 -- (-601.269) [-603.979] (-603.431) (-600.974) * (-604.007) (-602.205) (-601.566) [-601.449] -- 0:00:58
64500 -- [-603.533] (-608.868) (-601.178) (-602.090) * (-607.047) (-601.846) [-602.329] (-603.090) -- 0:00:58
65000 -- (-602.234) (-600.841) (-600.718) [-604.668] * (-602.863) (-602.950) (-602.644) [-602.649] -- 0:00:57
Average standard deviation of split frequencies: 0.033570
65500 -- (-603.005) [-603.144] (-603.987) (-601.579) * (-603.563) (-604.036) (-601.962) [-600.864] -- 0:00:57
66000 -- (-603.036) [-602.081] (-602.194) (-602.409) * [-602.309] (-601.564) (-603.873) (-600.995) -- 0:00:56
66500 -- (-605.189) (-602.113) (-606.375) [-600.662] * (-602.832) (-602.173) (-603.292) [-601.645] -- 0:00:56
67000 -- (-603.162) (-602.787) (-603.550) [-600.678] * (-602.636) (-602.477) [-603.369] (-603.671) -- 0:00:55
67500 -- [-604.222] (-601.094) (-603.858) (-601.048) * (-600.509) (-602.571) [-606.440] (-601.177) -- 0:01:09
68000 -- (-602.766) (-603.930) [-601.360] (-602.685) * (-601.194) [-603.712] (-603.680) (-605.387) -- 0:01:08
68500 -- (-603.022) [-604.673] (-601.412) (-602.462) * [-602.183] (-600.560) (-604.486) (-605.261) -- 0:01:07
69000 -- (-603.659) (-604.200) (-602.195) [-602.651] * (-601.780) [-601.045] (-601.646) (-602.140) -- 0:01:07
69500 -- (-603.344) (-602.733) [-603.660] (-602.071) * (-603.040) (-603.409) (-602.465) [-601.539] -- 0:01:06
70000 -- (-600.712) (-602.887) (-601.245) [-603.080] * (-602.991) [-602.706] (-603.920) (-600.471) -- 0:01:06
Average standard deviation of split frequencies: 0.031019
70500 -- (-601.561) (-601.142) (-600.503) [-601.703] * (-602.652) [-601.058] (-604.803) (-602.959) -- 0:01:05
71000 -- (-602.486) (-602.247) (-601.469) [-600.733] * (-602.066) [-600.262] (-601.645) (-602.969) -- 0:01:05
71500 -- [-600.490] (-605.036) (-601.798) (-601.926) * [-604.616] (-607.260) (-602.009) (-602.171) -- 0:01:04
72000 -- (-601.529) (-601.278) [-602.270] (-603.214) * [-600.595] (-607.233) (-600.971) (-604.726) -- 0:01:04
72500 -- [-601.369] (-602.744) (-604.477) (-602.374) * [-601.046] (-604.674) (-600.782) (-602.981) -- 0:01:03
73000 -- (-600.906) (-603.659) (-601.688) [-605.952] * (-604.912) [-603.044] (-601.804) (-601.097) -- 0:01:03
73500 -- [-600.321] (-605.507) (-603.016) (-603.886) * (-603.022) (-604.883) (-601.777) [-604.646] -- 0:01:03
74000 -- (-602.499) (-603.070) [-601.566] (-604.200) * (-602.523) (-603.299) [-602.473] (-601.707) -- 0:01:02
74500 -- (-602.472) (-603.569) (-603.288) [-607.536] * (-603.117) [-604.600] (-602.731) (-603.941) -- 0:01:02
75000 -- (-601.145) [-602.766] (-603.097) (-607.297) * (-603.702) (-602.465) [-602.232] (-602.671) -- 0:01:01
Average standard deviation of split frequencies: 0.031309
75500 -- (-600.715) (-604.838) [-602.065] (-602.485) * (-603.583) (-603.545) [-600.435] (-605.518) -- 0:01:01
76000 -- (-601.185) (-600.632) (-602.202) [-600.784] * [-602.524] (-601.216) (-602.391) (-601.593) -- 0:01:00
76500 -- (-600.718) [-606.985] (-603.251) (-600.891) * (-601.496) (-601.446) [-602.788] (-600.641) -- 0:01:00
77000 -- [-604.001] (-603.809) (-602.598) (-602.054) * (-602.136) [-602.225] (-602.269) (-603.017) -- 0:00:59
77500 -- (-603.719) (-602.406) [-602.847] (-604.866) * (-602.628) (-603.146) [-603.725] (-607.320) -- 0:00:59
78000 -- (-602.238) (-603.726) (-604.760) [-602.939] * (-601.239) (-606.482) [-600.961] (-603.397) -- 0:00:59
78500 -- (-604.762) (-601.300) (-605.152) [-601.746] * (-605.861) (-605.238) (-601.797) [-601.214] -- 0:00:58
79000 -- (-604.200) (-600.964) (-606.070) [-601.470] * (-604.210) (-608.410) [-601.909] (-600.876) -- 0:00:58
79500 -- (-602.127) (-606.188) (-602.950) [-600.275] * (-602.644) [-600.901] (-602.821) (-601.671) -- 0:00:57
80000 -- (-601.495) (-603.025) (-609.456) [-600.755] * [-600.757] (-601.559) (-603.658) (-601.789) -- 0:00:57
Average standard deviation of split frequencies: 0.029751
80500 -- (-604.268) (-602.800) (-603.864) [-602.189] * [-600.479] (-601.870) (-606.021) (-601.608) -- 0:00:57
81000 -- [-602.814] (-606.307) (-604.835) (-605.670) * (-602.133) (-603.438) (-605.567) [-601.884] -- 0:00:56
81500 -- (-602.817) [-601.358] (-604.528) (-600.574) * (-602.924) [-606.475] (-602.119) (-602.145) -- 0:00:56
82000 -- (-602.377) [-604.569] (-602.910) (-601.527) * (-606.409) (-601.816) (-600.883) [-603.432] -- 0:00:55
82500 -- [-610.767] (-605.595) (-600.799) (-601.546) * (-602.757) (-602.568) (-601.820) [-602.771] -- 0:00:55
83000 -- (-600.309) (-605.408) (-601.723) [-601.800] * (-605.286) [-601.131] (-604.270) (-601.666) -- 0:00:55
83500 -- [-603.851] (-604.427) (-602.638) (-601.410) * (-607.646) (-601.934) (-601.391) [-602.527] -- 0:00:54
84000 -- (-605.091) (-601.877) [-602.374] (-602.041) * [-601.230] (-601.036) (-605.155) (-600.745) -- 0:00:54
84500 -- (-601.917) (-602.089) [-600.299] (-604.101) * [-605.245] (-600.868) (-601.851) (-603.175) -- 0:01:05
85000 -- (-600.552) (-600.481) (-602.108) [-603.904] * (-608.073) (-601.927) [-601.982] (-601.218) -- 0:01:04
Average standard deviation of split frequencies: 0.028361
85500 -- (-605.166) [-601.397] (-603.635) (-602.773) * [-603.281] (-601.650) (-603.318) (-603.024) -- 0:01:04
86000 -- (-602.276) (-600.727) (-609.892) [-601.499] * (-602.165) (-602.420) [-601.539] (-603.729) -- 0:01:03
86500 -- (-604.277) (-600.629) [-603.159] (-601.843) * [-603.672] (-602.528) (-602.727) (-601.537) -- 0:01:03
87000 -- (-601.062) [-601.584] (-603.556) (-601.535) * (-602.360) [-602.806] (-602.713) (-601.450) -- 0:01:02
87500 -- [-600.917] (-601.127) (-602.779) (-601.468) * (-600.932) (-603.338) (-602.657) [-601.332] -- 0:01:02
88000 -- [-600.853] (-600.376) (-603.023) (-600.154) * [-602.451] (-606.367) (-602.512) (-600.722) -- 0:01:02
88500 -- (-601.628) (-601.767) (-603.379) [-601.311] * (-603.255) (-603.984) (-601.019) [-603.455] -- 0:01:01
89000 -- (-600.664) (-601.627) (-602.569) [-601.754] * [-602.129] (-600.172) (-602.743) (-602.135) -- 0:01:01
89500 -- [-601.156] (-602.500) (-602.597) (-603.763) * [-601.443] (-602.030) (-603.035) (-605.266) -- 0:01:01
90000 -- [-603.889] (-602.137) (-603.086) (-604.254) * (-601.644) (-602.245) (-604.605) [-606.205] -- 0:01:00
Average standard deviation of split frequencies: 0.027178
90500 -- (-603.964) (-603.515) [-601.889] (-605.405) * (-601.875) (-601.850) (-601.409) [-603.264] -- 0:01:00
91000 -- [-604.002] (-602.157) (-601.307) (-604.473) * (-603.117) [-604.184] (-600.994) (-601.633) -- 0:00:59
91500 -- (-600.345) (-601.041) [-601.704] (-601.847) * [-602.063] (-602.882) (-601.825) (-605.667) -- 0:00:59
92000 -- [-601.524] (-601.093) (-605.946) (-604.212) * [-605.351] (-602.966) (-604.571) (-602.139) -- 0:00:59
92500 -- (-602.457) (-601.323) [-600.932] (-604.040) * (-602.071) [-602.104] (-605.955) (-602.625) -- 0:00:58
93000 -- [-602.529] (-601.647) (-601.552) (-601.080) * [-603.539] (-607.571) (-604.325) (-600.901) -- 0:00:58
93500 -- [-602.557] (-600.935) (-603.303) (-602.427) * (-603.937) (-603.428) (-601.036) [-601.980] -- 0:00:58
94000 -- (-600.648) (-600.384) [-603.589] (-601.659) * [-603.419] (-606.273) (-601.203) (-603.504) -- 0:00:57
94500 -- (-602.167) [-606.408] (-601.665) (-600.464) * (-603.990) (-601.533) (-602.770) [-603.953] -- 0:00:57
95000 -- (-602.726) [-601.189] (-603.984) (-603.428) * [-602.446] (-602.911) (-603.013) (-604.794) -- 0:00:57
Average standard deviation of split frequencies: 0.028761
95500 -- (-603.547) (-602.535) (-600.906) [-602.452] * (-600.321) (-600.740) [-602.488] (-602.580) -- 0:00:56
96000 -- [-600.356] (-601.808) (-601.669) (-602.800) * (-604.169) (-603.427) (-604.106) [-604.340] -- 0:00:56
96500 -- [-600.988] (-601.082) (-601.083) (-602.987) * (-603.072) (-601.540) (-601.245) [-603.613] -- 0:00:56
97000 -- (-601.955) (-601.140) [-603.377] (-604.308) * (-606.293) (-601.616) (-605.698) [-604.133] -- 0:00:55
97500 -- (-601.984) (-602.386) [-604.509] (-602.509) * (-605.530) (-604.674) (-602.534) [-601.839] -- 0:00:55
98000 -- (-604.867) (-602.796) [-601.106] (-601.858) * (-607.005) (-603.616) [-602.301] (-604.498) -- 0:00:55
98500 -- (-602.417) [-602.820] (-603.391) (-602.108) * [-601.280] (-600.544) (-605.112) (-600.814) -- 0:00:54
99000 -- (-603.657) (-603.544) [-602.172] (-603.246) * (-605.918) [-602.928] (-601.101) (-606.656) -- 0:00:54
99500 -- (-600.795) (-608.413) [-605.040] (-600.589) * (-601.499) (-600.538) [-601.899] (-604.754) -- 0:00:54
100000 -- (-600.986) [-604.117] (-604.500) (-602.167) * (-601.728) [-602.038] (-602.088) (-603.751) -- 0:00:54
Average standard deviation of split frequencies: 0.026224
100500 -- (-600.260) [-601.665] (-607.001) (-601.591) * (-602.415) (-601.993) (-603.321) [-603.190] -- 0:00:53
101000 -- [-602.922] (-602.676) (-602.148) (-602.532) * [-601.646] (-603.729) (-600.113) (-602.911) -- 0:00:53
101500 -- (-606.143) [-601.730] (-602.164) (-601.100) * (-601.462) [-604.663] (-603.409) (-604.259) -- 0:01:01
102000 -- (-608.408) [-603.595] (-602.557) (-606.269) * (-601.614) (-604.514) (-603.486) [-601.224] -- 0:01:01
102500 -- (-607.440) (-604.250) [-601.269] (-606.679) * (-603.087) (-604.051) [-600.815] (-601.301) -- 0:01:01
103000 -- (-605.804) (-603.905) [-604.093] (-604.758) * [-601.385] (-603.051) (-601.238) (-602.355) -- 0:01:00
103500 -- (-607.987) [-601.410] (-606.740) (-605.184) * (-601.324) (-600.702) (-604.155) [-601.540] -- 0:01:00
104000 -- (-605.485) [-601.428] (-601.472) (-602.979) * (-600.796) (-600.371) (-601.805) [-601.610] -- 0:01:00
104500 -- (-604.871) (-600.556) [-601.997] (-603.207) * (-604.030) (-601.985) [-600.536] (-600.711) -- 0:00:59
105000 -- (-604.572) [-602.349] (-603.308) (-601.791) * (-601.116) (-602.881) (-601.491) [-603.062] -- 0:00:59
Average standard deviation of split frequencies: 0.025673
105500 -- (-602.079) (-603.848) [-602.674] (-602.897) * (-601.030) (-601.677) (-604.054) [-603.480] -- 0:00:59
106000 -- (-601.144) (-603.930) [-602.194] (-603.047) * (-601.157) (-602.368) (-602.894) [-602.876] -- 0:00:59
106500 -- [-604.281] (-602.235) (-601.927) (-603.793) * [-606.081] (-601.525) (-602.987) (-604.815) -- 0:00:58
107000 -- (-604.944) [-603.458] (-605.057) (-604.540) * (-600.669) [-600.982] (-602.402) (-604.743) -- 0:00:58
107500 -- [-600.232] (-603.267) (-607.737) (-602.035) * (-603.737) [-600.869] (-602.055) (-600.421) -- 0:00:58
108000 -- (-600.170) (-602.937) (-602.747) [-602.707] * (-603.732) [-601.139] (-602.233) (-602.489) -- 0:00:57
108500 -- (-603.403) [-604.440] (-607.926) (-605.694) * (-603.174) [-601.022] (-601.595) (-599.904) -- 0:00:57
109000 -- (-603.149) (-605.301) [-602.083] (-605.119) * [-602.466] (-601.229) (-605.182) (-601.509) -- 0:00:57
109500 -- [-600.252] (-600.343) (-600.525) (-601.601) * (-601.045) [-602.444] (-606.114) (-600.526) -- 0:00:56
110000 -- [-601.551] (-601.443) (-601.254) (-603.765) * (-601.422) (-600.710) [-602.712] (-600.960) -- 0:00:56
Average standard deviation of split frequencies: 0.027688
110500 -- (-603.252) (-603.020) [-601.177] (-607.434) * (-600.634) (-602.383) [-602.392] (-604.925) -- 0:00:56
111000 -- (-604.256) [-604.865] (-602.301) (-604.464) * (-601.165) [-600.145] (-601.769) (-606.191) -- 0:00:56
111500 -- (-604.490) [-601.751] (-602.953) (-602.957) * (-602.247) [-600.226] (-601.750) (-603.071) -- 0:00:55
112000 -- [-601.161] (-601.483) (-601.927) (-602.398) * [-603.501] (-602.021) (-603.215) (-603.906) -- 0:00:55
112500 -- [-603.277] (-604.380) (-602.428) (-603.198) * (-600.674) (-604.820) [-601.475] (-615.434) -- 0:00:55
113000 -- (-603.537) (-606.581) (-602.539) [-602.323] * (-602.627) [-600.984] (-601.772) (-604.032) -- 0:00:54
113500 -- (-601.910) (-602.846) [-600.677] (-600.789) * [-600.024] (-601.692) (-601.989) (-601.056) -- 0:00:54
114000 -- (-601.820) (-601.865) [-601.556] (-605.491) * (-605.590) (-600.909) [-601.845] (-600.586) -- 0:00:54
114500 -- [-600.885] (-600.842) (-601.761) (-603.109) * [-602.018] (-602.105) (-601.140) (-601.999) -- 0:00:54
115000 -- [-602.366] (-602.305) (-603.512) (-605.819) * (-601.660) (-601.249) [-600.862] (-600.270) -- 0:00:53
Average standard deviation of split frequencies: 0.021538
115500 -- (-604.525) (-600.231) [-601.590] (-603.940) * (-602.913) (-602.062) [-603.005] (-600.922) -- 0:00:53
116000 -- (-604.283) (-601.001) (-602.935) [-604.471] * (-603.289) (-603.707) [-601.437] (-601.576) -- 0:00:53
116500 -- (-604.541) (-602.382) (-602.003) [-603.997] * (-601.323) (-602.318) [-602.152] (-608.205) -- 0:00:53
117000 -- (-601.596) (-604.353) (-600.900) [-602.547] * (-602.024) [-600.421] (-604.376) (-602.428) -- 0:00:52
117500 -- (-600.241) (-605.564) (-602.395) [-600.917] * (-601.484) (-602.117) [-600.370] (-601.322) -- 0:00:52
118000 -- (-600.650) [-604.998] (-604.328) (-601.598) * (-602.483) (-601.319) [-601.167] (-602.795) -- 0:00:59
118500 -- [-601.645] (-602.442) (-601.549) (-602.344) * (-602.370) (-602.309) [-601.806] (-601.050) -- 0:00:59
119000 -- (-600.601) [-601.343] (-602.421) (-609.881) * (-603.932) [-604.671] (-601.161) (-601.098) -- 0:00:59
119500 -- (-603.816) (-602.045) (-605.074) [-602.549] * (-607.487) [-600.994] (-603.109) (-604.474) -- 0:00:58
120000 -- (-602.527) [-601.830] (-601.442) (-603.053) * (-600.948) (-602.949) (-601.767) [-602.074] -- 0:00:58
Average standard deviation of split frequencies: 0.019328
120500 -- (-603.023) (-602.279) (-606.174) [-604.441] * (-602.006) [-601.785] (-603.931) (-602.616) -- 0:00:58
121000 -- (-603.773) (-602.051) [-602.187] (-603.801) * (-604.655) (-601.279) (-600.805) [-604.203] -- 0:00:58
121500 -- (-602.975) [-602.513] (-602.854) (-603.401) * [-605.885] (-601.820) (-600.836) (-603.083) -- 0:00:57
122000 -- (-601.185) [-601.699] (-604.522) (-603.989) * [-601.500] (-601.116) (-600.562) (-605.812) -- 0:00:57
122500 -- (-602.185) [-602.690] (-603.702) (-603.383) * (-601.876) (-601.014) [-600.965] (-606.201) -- 0:00:57
123000 -- (-600.574) (-602.768) [-602.037] (-605.543) * (-602.304) [-600.996] (-606.258) (-602.375) -- 0:00:57
123500 -- (-604.191) (-603.663) (-603.720) [-601.370] * [-602.645] (-602.881) (-602.137) (-601.022) -- 0:00:56
124000 -- (-605.349) (-601.547) [-602.214] (-602.167) * (-601.303) (-602.591) (-604.097) [-601.383] -- 0:00:56
124500 -- (-604.724) [-601.897] (-600.905) (-605.694) * (-602.543) (-603.149) (-604.207) [-600.739] -- 0:00:56
125000 -- (-600.919) (-605.506) (-602.910) [-603.439] * (-606.061) (-602.008) (-605.047) [-602.420] -- 0:00:56
Average standard deviation of split frequencies: 0.016747
125500 -- (-603.214) [-603.007] (-601.296) (-603.665) * (-604.496) (-602.092) [-601.836] (-602.044) -- 0:00:55
126000 -- [-604.733] (-601.710) (-603.950) (-602.707) * (-601.113) (-603.866) [-602.136] (-601.029) -- 0:00:55
126500 -- (-605.851) (-600.021) (-602.115) [-600.942] * (-601.646) [-605.255] (-604.499) (-601.114) -- 0:00:55
127000 -- (-602.407) [-601.823] (-601.831) (-602.331) * (-600.790) (-610.138) [-602.578] (-601.501) -- 0:00:54
127500 -- (-602.061) (-605.581) [-601.695] (-603.170) * [-602.893] (-603.274) (-600.979) (-603.913) -- 0:00:54
128000 -- (-600.643) (-602.615) (-604.525) [-602.412] * (-602.023) (-605.192) (-605.524) [-602.988] -- 0:00:54
128500 -- (-602.050) (-603.044) [-601.683] (-605.354) * (-601.251) (-604.355) [-601.616] (-605.110) -- 0:00:54
129000 -- (-604.770) (-602.425) [-600.441] (-602.297) * (-601.048) (-600.823) [-603.827] (-602.282) -- 0:00:54
129500 -- (-607.349) (-602.505) (-604.456) [-602.066] * (-602.142) (-600.748) [-601.135] (-604.104) -- 0:00:53
130000 -- (-604.248) (-607.369) [-605.162] (-603.106) * (-602.545) (-600.426) [-603.925] (-602.554) -- 0:00:53
Average standard deviation of split frequencies: 0.013709
130500 -- (-603.615) (-605.746) (-601.143) [-603.354] * (-601.211) (-607.548) [-601.500] (-602.386) -- 0:00:53
131000 -- (-602.311) (-600.808) (-600.357) [-605.389] * (-601.934) (-604.323) (-604.392) [-602.622] -- 0:00:53
131500 -- [-601.713] (-600.722) (-602.279) (-601.971) * [-602.039] (-606.447) (-601.598) (-603.638) -- 0:00:52
132000 -- (-603.509) (-601.831) [-600.464] (-601.215) * [-602.151] (-603.503) (-600.915) (-602.828) -- 0:00:52
132500 -- (-604.165) (-605.557) (-605.366) [-601.513] * [-602.214] (-602.515) (-600.836) (-603.414) -- 0:00:52
133000 -- [-601.984] (-604.486) (-601.557) (-601.201) * (-602.377) [-603.241] (-601.424) (-601.454) -- 0:00:52
133500 -- (-602.560) [-601.490] (-602.324) (-600.635) * (-601.996) (-601.025) (-603.100) [-603.393] -- 0:00:51
134000 -- (-610.508) (-600.504) (-606.268) [-600.345] * (-600.605) (-603.037) (-603.559) [-603.178] -- 0:00:51
134500 -- [-604.163] (-601.018) (-604.209) (-600.219) * (-607.175) (-601.674) [-601.003] (-606.443) -- 0:00:51
135000 -- (-603.920) (-604.176) [-600.878] (-600.602) * (-601.849) [-602.097] (-601.151) (-602.488) -- 0:00:57
Average standard deviation of split frequencies: 0.014690
135500 -- (-606.448) (-603.344) (-600.327) [-603.141] * (-602.716) [-600.974] (-600.100) (-601.201) -- 0:00:57
136000 -- (-601.824) [-601.556] (-601.059) (-604.194) * [-604.954] (-601.598) (-600.427) (-600.002) -- 0:00:57
136500 -- [-603.305] (-604.846) (-603.395) (-605.346) * (-604.548) (-600.262) (-601.247) [-602.912] -- 0:00:56
137000 -- (-602.742) [-600.773] (-602.223) (-605.662) * [-600.715] (-601.213) (-603.730) (-603.016) -- 0:00:56
137500 -- (-602.355) (-601.346) (-602.868) [-601.452] * (-600.815) [-600.385] (-605.104) (-604.074) -- 0:00:56
138000 -- [-603.743] (-604.996) (-601.104) (-603.391) * (-601.099) (-602.260) [-602.320] (-606.966) -- 0:00:56
138500 -- (-603.176) (-602.462) [-602.804] (-604.284) * (-601.153) (-601.925) (-601.960) [-603.523] -- 0:00:55
139000 -- [-600.380] (-601.874) (-599.938) (-604.530) * (-601.190) (-601.013) [-601.300] (-601.636) -- 0:00:55
139500 -- (-602.568) (-602.560) [-600.752] (-606.234) * [-602.119] (-601.704) (-600.607) (-601.308) -- 0:00:55
140000 -- (-602.163) [-600.573] (-604.367) (-601.630) * (-600.971) [-603.996] (-601.187) (-607.804) -- 0:00:55
Average standard deviation of split frequencies: 0.015267
140500 -- (-602.693) [-601.259] (-602.065) (-602.373) * [-602.574] (-610.447) (-601.362) (-604.163) -- 0:00:55
141000 -- (-602.181) [-600.893] (-602.896) (-602.414) * (-602.730) (-609.554) [-600.687] (-601.174) -- 0:00:54
141500 -- (-601.638) [-602.092] (-600.384) (-602.815) * [-602.830] (-603.722) (-600.652) (-601.111) -- 0:00:54
142000 -- (-602.381) (-601.541) (-602.817) [-600.726] * (-603.340) (-605.151) [-600.632] (-601.771) -- 0:00:54
142500 -- (-601.316) (-601.099) (-603.991) [-601.540] * [-602.117] (-600.559) (-600.718) (-602.950) -- 0:00:54
143000 -- (-601.418) (-602.134) [-604.346] (-603.855) * [-601.105] (-602.332) (-601.885) (-603.184) -- 0:00:53
143500 -- (-601.184) [-600.194] (-603.147) (-602.852) * (-602.792) (-601.060) [-603.236] (-602.863) -- 0:00:53
144000 -- (-601.709) (-604.621) [-603.297] (-600.807) * (-602.423) (-602.349) [-602.616] (-601.298) -- 0:00:53
144500 -- (-602.687) [-601.879] (-602.833) (-600.853) * (-602.581) [-602.225] (-602.718) (-603.076) -- 0:00:53
145000 -- (-602.281) (-604.566) [-600.227] (-600.138) * [-603.952] (-601.980) (-606.876) (-602.419) -- 0:00:53
Average standard deviation of split frequencies: 0.013991
145500 -- (-600.104) [-602.753] (-600.848) (-604.298) * (-603.448) (-603.254) [-600.440] (-600.290) -- 0:00:52
146000 -- (-603.595) (-603.475) [-606.182] (-604.136) * [-603.274] (-608.801) (-603.415) (-602.721) -- 0:00:52
146500 -- (-603.088) [-603.154] (-603.903) (-605.675) * [-601.132] (-602.411) (-601.517) (-600.866) -- 0:00:52
147000 -- [-606.178] (-603.388) (-603.515) (-600.130) * (-600.337) (-606.030) (-601.238) [-601.754] -- 0:00:52
147500 -- (-602.236) [-601.155] (-601.469) (-601.928) * [-603.136] (-601.169) (-600.950) (-602.311) -- 0:00:52
148000 -- (-601.143) (-606.633) [-601.745] (-605.739) * [-602.956] (-605.669) (-602.809) (-606.609) -- 0:00:51
148500 -- [-602.338] (-603.563) (-607.716) (-603.071) * (-601.359) (-602.423) (-602.149) [-601.506] -- 0:00:51
149000 -- (-601.167) [-602.489] (-601.052) (-601.562) * (-602.572) [-600.915] (-601.528) (-603.808) -- 0:00:51
149500 -- (-601.125) (-604.276) [-600.433] (-603.589) * (-602.612) [-600.851] (-602.109) (-603.823) -- 0:00:51
150000 -- (-602.531) [-601.483] (-607.004) (-601.446) * (-602.341) (-606.305) [-601.248] (-601.984) -- 0:00:51
Average standard deviation of split frequencies: 0.014656
150500 -- (-604.181) [-602.495] (-604.386) (-603.381) * (-602.898) (-600.843) (-600.533) [-602.242] -- 0:00:50
151000 -- [-604.941] (-601.033) (-603.510) (-603.270) * [-600.866] (-602.663) (-604.201) (-601.777) -- 0:00:50
151500 -- (-603.012) [-605.689] (-601.598) (-603.089) * (-602.395) (-601.661) [-602.200] (-602.061) -- 0:00:56
152000 -- (-602.169) (-609.542) (-602.591) [-600.825] * [-602.846] (-603.224) (-604.166) (-606.449) -- 0:00:55
152500 -- (-601.836) [-602.313] (-602.809) (-602.442) * [-601.942] (-609.486) (-605.838) (-603.802) -- 0:00:55
153000 -- (-600.690) [-601.688] (-604.792) (-600.718) * (-603.837) (-609.087) (-602.175) [-601.377] -- 0:00:55
153500 -- (-600.899) [-601.297] (-603.950) (-603.278) * (-602.778) (-600.802) (-602.709) [-601.903] -- 0:00:55
154000 -- (-602.669) (-603.026) [-602.050] (-605.640) * [-602.521] (-600.826) (-604.316) (-600.910) -- 0:00:54
154500 -- (-603.392) (-603.395) (-605.978) [-609.136] * (-603.831) (-601.547) (-600.999) [-600.035] -- 0:00:54
155000 -- (-606.133) [-604.359] (-600.761) (-603.276) * (-601.931) (-601.829) (-602.854) [-601.136] -- 0:00:54
Average standard deviation of split frequencies: 0.013837
155500 -- (-601.800) (-602.455) [-602.821] (-602.362) * (-603.117) (-601.350) (-600.224) [-602.436] -- 0:00:54
156000 -- [-601.024] (-601.212) (-604.174) (-604.276) * (-603.288) [-600.727] (-603.416) (-600.255) -- 0:00:54
156500 -- (-601.147) (-602.071) [-601.092] (-601.326) * (-604.622) (-604.314) (-600.855) [-601.710] -- 0:00:53
157000 -- (-603.002) [-602.053] (-600.020) (-603.796) * [-603.431] (-605.422) (-600.714) (-602.760) -- 0:00:53
157500 -- (-603.810) (-602.153) (-600.569) [-602.601] * [-602.850] (-600.494) (-602.497) (-605.545) -- 0:00:53
158000 -- (-601.441) [-600.604] (-601.939) (-600.803) * [-601.062] (-603.514) (-600.385) (-607.627) -- 0:00:53
158500 -- (-601.979) (-608.872) [-601.085] (-601.425) * [-601.122] (-602.676) (-605.663) (-608.509) -- 0:00:53
159000 -- (-603.295) (-608.745) (-601.250) [-603.779] * (-600.841) (-603.378) (-603.819) [-604.740] -- 0:00:52
159500 -- (-600.860) (-601.641) [-601.952] (-602.990) * (-600.338) [-605.288] (-603.344) (-603.186) -- 0:00:52
160000 -- (-601.834) [-601.048] (-601.652) (-601.958) * (-600.932) (-601.625) (-602.116) [-600.471] -- 0:00:52
Average standard deviation of split frequencies: 0.014018
160500 -- [-601.490] (-601.920) (-603.856) (-601.723) * (-603.865) [-604.322] (-607.300) (-601.305) -- 0:00:52
161000 -- (-601.496) (-602.105) (-602.054) [-607.594] * (-602.728) (-604.928) [-602.774] (-603.043) -- 0:00:52
161500 -- (-601.431) (-603.578) [-602.530] (-601.985) * (-602.211) (-609.935) (-604.785) [-601.531] -- 0:00:51
162000 -- (-601.431) (-602.983) [-600.362] (-601.546) * (-601.890) (-603.816) (-602.270) [-600.943] -- 0:00:51
162500 -- (-601.695) [-600.897] (-600.738) (-602.048) * (-602.780) (-604.537) (-600.474) [-604.063] -- 0:00:51
163000 -- (-601.728) (-602.216) (-601.904) [-600.864] * (-601.716) (-600.317) (-600.876) [-606.585] -- 0:00:51
163500 -- (-610.511) [-601.165] (-601.590) (-600.807) * (-601.506) (-601.333) [-600.559] (-606.255) -- 0:00:51
164000 -- (-602.913) [-601.171] (-601.273) (-602.285) * (-602.196) (-600.874) [-605.044] (-603.662) -- 0:00:50
164500 -- [-603.708] (-602.427) (-603.877) (-603.234) * (-602.491) (-610.909) (-602.047) [-604.548] -- 0:00:50
165000 -- (-603.594) [-603.061] (-601.103) (-606.340) * (-603.245) [-600.667] (-600.115) (-604.959) -- 0:00:50
Average standard deviation of split frequencies: 0.013252
165500 -- (-600.816) (-603.029) (-603.929) [-601.412] * (-604.157) (-600.682) [-600.627] (-606.066) -- 0:00:50
166000 -- (-600.717) (-602.096) [-601.188] (-600.302) * (-603.479) (-604.587) [-605.593] (-605.029) -- 0:00:50
166500 -- (-603.238) (-601.892) [-600.630] (-600.698) * (-602.481) (-601.992) [-605.390] (-600.238) -- 0:00:50
167000 -- (-604.903) [-602.681] (-604.805) (-600.308) * (-601.454) (-603.039) (-601.422) [-600.276] -- 0:00:49
167500 -- (-604.824) (-602.381) (-602.198) [-600.573] * (-600.943) [-601.377] (-602.299) (-600.330) -- 0:00:49
168000 -- [-601.782] (-603.025) (-601.958) (-601.099) * (-602.645) (-601.860) (-602.118) [-600.001] -- 0:00:49
168500 -- (-602.506) (-600.640) [-602.882] (-601.879) * (-606.555) [-602.813] (-604.226) (-600.482) -- 0:00:54
169000 -- (-604.480) [-600.979] (-602.706) (-609.050) * (-603.335) (-602.235) [-602.294] (-602.121) -- 0:00:54
169500 -- (-602.638) [-604.722] (-600.647) (-610.126) * (-600.144) [-601.317] (-602.799) (-606.912) -- 0:00:53
170000 -- (-600.394) [-601.040] (-600.382) (-604.579) * (-600.559) [-601.615] (-603.673) (-603.430) -- 0:00:53
Average standard deviation of split frequencies: 0.013942
170500 -- (-600.663) [-600.818] (-602.391) (-605.346) * (-601.499) (-603.185) (-602.512) [-603.552] -- 0:00:53
171000 -- (-602.623) (-600.753) [-601.177] (-603.482) * (-601.137) (-601.947) [-603.424] (-601.866) -- 0:00:53
171500 -- (-602.623) [-603.714] (-600.376) (-604.421) * (-605.039) (-602.872) [-601.529] (-602.535) -- 0:00:53
172000 -- (-606.845) (-603.328) [-601.023] (-601.420) * [-603.389] (-602.273) (-604.488) (-604.270) -- 0:00:52
172500 -- (-601.766) (-600.802) (-605.387) [-601.019] * [-606.452] (-603.647) (-604.075) (-604.411) -- 0:00:52
173000 -- [-601.885] (-600.023) (-600.443) (-600.980) * [-601.927] (-602.976) (-601.663) (-600.225) -- 0:00:52
173500 -- (-604.732) [-601.828] (-601.161) (-604.635) * [-600.203] (-601.556) (-601.727) (-601.719) -- 0:00:52
174000 -- [-603.002] (-603.546) (-603.958) (-603.614) * (-601.693) [-600.882] (-605.742) (-601.146) -- 0:00:52
174500 -- (-601.273) [-603.359] (-600.640) (-604.124) * (-601.432) (-600.707) (-601.052) [-601.664] -- 0:00:52
175000 -- (-603.005) (-601.651) (-606.669) [-604.911] * [-600.379] (-601.244) (-607.486) (-602.417) -- 0:00:51
Average standard deviation of split frequencies: 0.012546
175500 -- (-601.461) (-606.601) [-604.317] (-608.103) * [-600.893] (-606.690) (-603.275) (-602.277) -- 0:00:51
176000 -- (-601.146) (-604.324) [-602.627] (-610.187) * [-600.300] (-603.533) (-603.247) (-601.813) -- 0:00:51
176500 -- (-602.143) (-602.318) [-605.703] (-600.517) * (-600.728) (-602.853) [-601.834] (-600.972) -- 0:00:51
177000 -- (-601.501) (-602.052) [-602.247] (-600.664) * (-602.584) (-603.559) [-601.539] (-604.282) -- 0:00:51
177500 -- (-603.236) (-603.010) [-602.219] (-604.102) * (-603.255) [-604.584] (-601.065) (-602.845) -- 0:00:50
178000 -- (-604.198) (-604.724) [-603.420] (-601.550) * (-602.147) (-601.759) [-600.608] (-604.401) -- 0:00:50
178500 -- [-601.457] (-604.340) (-604.691) (-600.783) * (-604.342) [-600.715] (-601.821) (-601.732) -- 0:00:50
179000 -- (-602.611) (-602.565) (-603.608) [-604.645] * (-604.017) [-604.331] (-604.410) (-603.895) -- 0:00:50
179500 -- (-608.269) [-601.708] (-602.389) (-602.767) * (-601.977) (-603.229) (-602.303) [-602.369] -- 0:00:50
180000 -- (-607.722) (-605.977) (-600.996) [-601.008] * (-600.553) (-601.721) (-601.666) [-601.187] -- 0:00:50
Average standard deviation of split frequencies: 0.011742
180500 -- (-606.343) (-604.246) (-602.323) [-601.608] * [-601.377] (-600.837) (-600.682) (-603.597) -- 0:00:49
181000 -- (-606.185) (-607.396) (-608.718) [-601.002] * [-601.396] (-603.823) (-601.120) (-604.243) -- 0:00:49
181500 -- (-605.489) (-604.419) [-603.414] (-600.894) * (-601.180) (-601.816) [-604.044] (-607.031) -- 0:00:49
182000 -- [-603.082] (-606.419) (-603.213) (-602.804) * (-602.235) (-600.235) [-600.807] (-603.952) -- 0:00:49
182500 -- (-600.732) (-607.287) (-605.076) [-605.208] * (-602.759) (-602.169) (-602.714) [-603.808] -- 0:00:49
183000 -- (-602.425) [-609.841] (-604.460) (-603.430) * (-601.216) (-601.651) [-601.402] (-602.319) -- 0:00:49
183500 -- (-602.016) [-601.149] (-602.920) (-605.530) * (-602.954) (-601.787) (-613.158) [-602.798] -- 0:00:48
184000 -- (-601.188) (-601.891) (-603.010) [-607.162] * (-600.546) (-604.329) (-606.399) [-601.308] -- 0:00:48
184500 -- [-601.697] (-605.618) (-603.663) (-609.607) * (-600.931) (-601.615) (-604.697) [-604.178] -- 0:00:48
185000 -- (-602.369) (-604.494) [-605.500] (-601.858) * [-605.009] (-602.104) (-606.728) (-606.516) -- 0:00:48
Average standard deviation of split frequencies: 0.011948
185500 -- (-601.223) [-601.908] (-601.336) (-600.867) * (-602.858) (-601.026) (-601.218) [-603.426] -- 0:00:52
186000 -- (-605.247) [-601.146] (-603.932) (-605.897) * (-601.044) [-602.912] (-603.026) (-601.296) -- 0:00:52
186500 -- (-602.415) (-601.238) [-600.885] (-605.343) * (-600.014) (-602.958) [-601.732] (-601.795) -- 0:00:52
187000 -- (-600.623) [-601.488] (-603.795) (-600.701) * [-604.229] (-601.117) (-600.760) (-601.732) -- 0:00:52
187500 -- (-602.696) [-600.431] (-604.256) (-603.164) * (-606.221) (-600.504) [-601.136] (-608.200) -- 0:00:52
188000 -- (-604.213) (-601.498) [-601.179] (-604.058) * (-602.247) [-602.336] (-602.058) (-602.473) -- 0:00:51
188500 -- (-601.691) (-601.505) (-600.504) [-601.748] * (-603.303) (-602.184) (-603.088) [-603.333] -- 0:00:51
189000 -- (-603.152) (-600.670) [-601.102] (-604.784) * [-601.342] (-602.470) (-602.654) (-603.144) -- 0:00:51
189500 -- (-606.078) (-603.716) (-604.475) [-601.179] * (-602.182) (-602.390) [-600.814] (-601.373) -- 0:00:51
190000 -- [-600.628] (-601.763) (-603.414) (-603.813) * (-600.434) (-602.078) [-601.803] (-605.535) -- 0:00:51
Average standard deviation of split frequencies: 0.012009
190500 -- (-600.994) (-603.234) (-606.033) [-604.541] * [-601.321] (-602.656) (-609.098) (-601.606) -- 0:00:50
191000 -- (-602.918) (-606.783) (-604.632) [-604.845] * (-603.244) (-603.993) [-602.792] (-601.923) -- 0:00:50
191500 -- (-604.892) (-602.907) [-602.207] (-602.554) * (-601.474) (-609.337) [-603.890] (-601.545) -- 0:00:50
192000 -- (-601.571) [-602.002] (-602.633) (-600.432) * (-606.114) (-604.385) [-603.658] (-607.050) -- 0:00:50
192500 -- (-605.405) (-602.280) (-601.505) [-601.398] * (-603.963) (-603.137) [-600.621] (-602.370) -- 0:00:50
193000 -- (-607.062) (-601.270) [-602.268] (-603.598) * (-601.427) (-606.475) [-600.933] (-603.442) -- 0:00:50
193500 -- (-601.087) [-604.411] (-603.387) (-604.410) * (-601.995) (-602.653) [-601.140] (-602.103) -- 0:00:50
194000 -- (-603.344) (-603.821) [-603.054] (-601.725) * (-604.055) [-601.956] (-602.161) (-600.771) -- 0:00:49
194500 -- (-603.030) (-608.690) [-602.050] (-601.548) * (-601.960) (-602.831) [-602.394] (-600.743) -- 0:00:49
195000 -- (-602.340) (-605.571) (-601.793) [-600.967] * (-601.594) (-603.386) [-601.210] (-604.066) -- 0:00:49
Average standard deviation of split frequencies: 0.013291
195500 -- (-601.422) (-602.185) (-601.057) [-601.266] * (-601.103) (-601.551) [-602.430] (-602.977) -- 0:00:49
196000 -- [-601.588] (-600.962) (-602.307) (-601.472) * (-600.780) (-601.777) [-602.648] (-605.082) -- 0:00:49
196500 -- (-602.779) (-607.513) (-600.459) [-603.370] * (-601.389) (-601.543) [-604.047] (-600.455) -- 0:00:49
197000 -- (-601.299) (-601.878) (-600.686) [-603.565] * (-600.781) (-601.731) (-603.923) [-600.734] -- 0:00:48
197500 -- (-601.559) [-602.856] (-600.376) (-601.724) * (-606.923) (-602.378) [-601.578] (-601.763) -- 0:00:48
198000 -- (-601.008) (-603.360) (-601.511) [-602.684] * [-602.700] (-605.724) (-600.536) (-603.043) -- 0:00:48
198500 -- (-602.081) [-601.061] (-600.563) (-607.264) * (-604.857) (-602.100) (-605.141) [-603.347] -- 0:00:48
199000 -- [-602.263] (-601.255) (-603.493) (-602.765) * [-601.937] (-602.931) (-603.159) (-600.221) -- 0:00:48
199500 -- (-601.115) (-601.440) [-601.452] (-603.910) * (-602.680) (-602.039) [-605.759] (-603.461) -- 0:00:48
200000 -- (-603.020) (-600.775) [-602.033] (-602.716) * (-600.137) [-601.085] (-606.673) (-603.410) -- 0:00:48
Average standard deviation of split frequencies: 0.013978
200500 -- [-601.460] (-600.412) (-601.271) (-600.990) * [-601.201] (-603.285) (-605.938) (-601.142) -- 0:00:47
201000 -- (-599.985) (-601.643) [-601.533] (-607.950) * (-602.266) (-609.043) [-603.909] (-600.964) -- 0:00:47
201500 -- (-601.928) [-602.533] (-600.587) (-606.896) * (-603.099) (-602.498) (-601.645) [-603.412] -- 0:00:47
202000 -- [-602.188] (-603.211) (-603.077) (-601.170) * (-604.401) (-601.622) (-601.405) [-602.840] -- 0:00:51
202500 -- [-602.002] (-600.509) (-602.460) (-602.352) * [-603.067] (-603.540) (-604.106) (-602.735) -- 0:00:51
203000 -- (-604.811) (-601.310) (-604.102) [-601.957] * [-601.306] (-600.843) (-601.599) (-603.876) -- 0:00:51
203500 -- (-601.119) [-603.502] (-604.765) (-601.656) * (-604.181) (-601.165) [-602.032] (-601.876) -- 0:00:50
204000 -- [-601.637] (-601.689) (-604.776) (-605.202) * (-601.007) [-601.738] (-602.637) (-606.346) -- 0:00:50
204500 -- (-603.118) [-604.330] (-601.923) (-601.256) * (-601.334) (-601.435) (-602.156) [-603.662] -- 0:00:50
205000 -- [-604.515] (-602.565) (-606.304) (-601.876) * (-605.866) [-601.472] (-602.642) (-601.646) -- 0:00:50
Average standard deviation of split frequencies: 0.014760
205500 -- (-603.084) [-604.261] (-603.091) (-600.424) * (-604.528) (-601.384) (-604.471) [-603.409] -- 0:00:50
206000 -- (-601.702) (-603.852) [-602.980] (-603.321) * (-608.872) [-600.042] (-604.866) (-602.483) -- 0:00:50
206500 -- (-604.792) (-602.293) (-603.176) [-601.834] * (-608.623) [-601.806] (-602.083) (-605.515) -- 0:00:49
207000 -- [-600.434] (-603.327) (-605.772) (-601.728) * (-603.527) (-603.417) [-600.320] (-603.029) -- 0:00:49
207500 -- (-600.997) (-603.111) [-601.893] (-601.736) * [-601.482] (-601.945) (-604.223) (-600.735) -- 0:00:49
208000 -- (-601.246) [-602.415] (-602.426) (-601.596) * [-608.767] (-600.452) (-605.923) (-603.069) -- 0:00:49
208500 -- (-607.976) (-601.058) (-601.471) [-601.570] * (-600.818) (-601.203) (-603.966) [-602.643] -- 0:00:49
209000 -- [-601.853] (-602.216) (-602.525) (-606.093) * (-604.794) [-601.792] (-604.590) (-603.053) -- 0:00:49
209500 -- (-600.828) (-602.716) [-602.814] (-602.401) * [-605.371] (-603.728) (-600.519) (-603.741) -- 0:00:49
210000 -- (-600.923) (-603.284) (-601.601) [-601.007] * [-601.954] (-601.974) (-600.375) (-606.520) -- 0:00:48
Average standard deviation of split frequencies: 0.015075
210500 -- (-600.901) [-600.483] (-602.170) (-602.206) * (-602.591) (-601.467) (-602.291) [-603.932] -- 0:00:48
211000 -- (-602.499) (-600.794) [-602.857] (-605.642) * [-602.276] (-602.194) (-600.076) (-606.562) -- 0:00:48
211500 -- (-602.869) [-600.812] (-602.409) (-602.651) * (-602.916) (-600.921) [-601.598] (-602.299) -- 0:00:48
212000 -- (-602.296) [-603.232] (-602.664) (-602.331) * (-601.692) [-606.225] (-603.594) (-601.899) -- 0:00:48
212500 -- (-600.992) (-601.579) [-603.857] (-604.429) * (-603.371) (-601.833) (-602.013) [-600.235] -- 0:00:48
213000 -- (-604.791) [-601.915] (-602.358) (-602.183) * (-602.997) [-602.978] (-601.611) (-606.643) -- 0:00:48
213500 -- [-601.202] (-603.464) (-601.804) (-603.445) * (-606.480) (-603.283) [-607.289] (-600.927) -- 0:00:47
214000 -- (-601.694) (-606.461) [-604.826] (-606.976) * (-602.700) [-601.705] (-602.439) (-601.104) -- 0:00:47
214500 -- (-606.829) (-601.512) [-600.994] (-604.976) * (-602.920) [-602.474] (-602.072) (-600.306) -- 0:00:47
215000 -- [-602.611] (-600.262) (-601.586) (-603.414) * (-602.723) (-602.556) [-602.291] (-602.281) -- 0:00:47
Average standard deviation of split frequencies: 0.014622
215500 -- (-605.704) (-601.346) [-600.928] (-601.012) * (-601.081) [-606.612] (-604.662) (-601.792) -- 0:00:47
216000 -- (-601.643) [-601.518] (-602.968) (-601.268) * (-602.788) [-601.311] (-607.869) (-603.261) -- 0:00:47
216500 -- (-602.365) (-603.129) (-604.596) [-602.419] * (-601.812) (-603.991) [-601.605] (-603.947) -- 0:00:47
217000 -- (-605.083) [-600.940] (-602.916) (-601.386) * (-601.069) [-604.691] (-602.400) (-609.301) -- 0:00:46
217500 -- (-605.248) [-600.614] (-602.715) (-600.994) * (-601.306) (-601.206) [-601.851] (-602.603) -- 0:00:46
218000 -- (-604.018) (-600.560) (-601.130) [-601.434] * (-602.535) (-603.817) [-602.644] (-602.423) -- 0:00:50
218500 -- (-601.944) (-602.925) [-602.811] (-602.013) * (-602.862) [-601.831] (-603.431) (-603.329) -- 0:00:50
219000 -- (-602.209) [-603.029] (-602.714) (-601.931) * (-605.330) (-601.070) [-602.091] (-600.449) -- 0:00:49
219500 -- (-602.413) [-601.158] (-601.992) (-601.580) * (-602.557) (-602.300) [-600.652] (-600.897) -- 0:00:49
220000 -- (-602.026) [-603.435] (-602.249) (-601.433) * (-602.451) (-603.019) [-601.799] (-601.875) -- 0:00:49
Average standard deviation of split frequencies: 0.014633
220500 -- [-601.317] (-602.225) (-601.289) (-602.611) * (-600.290) (-602.737) (-605.413) [-600.488] -- 0:00:49
221000 -- (-601.406) (-609.748) (-600.728) [-600.435] * [-602.581] (-603.487) (-605.906) (-600.793) -- 0:00:49
221500 -- (-601.410) (-603.794) [-605.410] (-601.037) * (-602.428) (-605.022) [-603.000] (-601.060) -- 0:00:49
222000 -- (-601.039) (-602.223) (-601.962) [-600.874] * (-605.546) (-610.310) [-602.598] (-605.749) -- 0:00:49
222500 -- [-601.215] (-601.497) (-602.873) (-601.341) * (-603.739) (-603.664) [-603.692] (-601.335) -- 0:00:48
223000 -- [-600.573] (-604.082) (-603.769) (-605.065) * (-601.151) (-602.731) (-600.960) [-602.168] -- 0:00:48
223500 -- (-604.732) (-601.786) [-601.720] (-608.444) * (-604.626) [-600.984] (-600.946) (-602.526) -- 0:00:48
224000 -- [-604.578] (-600.499) (-602.839) (-607.169) * [-601.369] (-600.786) (-600.028) (-600.383) -- 0:00:48
224500 -- (-603.231) (-603.695) [-602.484] (-602.771) * (-600.890) [-601.923] (-600.506) (-601.234) -- 0:00:48
225000 -- (-600.286) [-605.026] (-600.356) (-602.261) * (-603.470) (-601.677) (-600.274) [-604.210] -- 0:00:48
Average standard deviation of split frequencies: 0.013975
225500 -- (-601.387) (-611.029) (-602.076) [-604.064] * (-601.855) (-604.185) (-605.277) [-601.586] -- 0:00:48
226000 -- (-602.526) (-601.684) (-602.024) [-601.729] * (-602.347) (-602.635) [-607.415] (-601.470) -- 0:00:47
226500 -- [-601.086] (-602.687) (-603.361) (-600.603) * (-607.444) [-605.384] (-603.103) (-602.193) -- 0:00:47
227000 -- [-603.363] (-601.621) (-601.173) (-601.612) * (-603.023) [-601.755] (-607.773) (-600.586) -- 0:00:47
227500 -- [-602.398] (-600.713) (-607.019) (-604.640) * [-601.348] (-604.621) (-604.620) (-600.452) -- 0:00:47
228000 -- (-603.528) [-601.157] (-600.990) (-601.135) * [-600.372] (-603.157) (-601.930) (-600.628) -- 0:00:47
228500 -- (-601.269) (-601.331) (-606.526) [-602.333] * (-602.293) [-603.139] (-602.870) (-600.013) -- 0:00:47
229000 -- [-601.362] (-603.535) (-601.681) (-607.134) * (-602.443) (-604.741) [-604.652] (-600.294) -- 0:00:47
229500 -- [-600.655] (-602.343) (-602.050) (-602.903) * (-603.635) (-601.410) (-601.818) [-603.346] -- 0:00:47
230000 -- [-600.071] (-601.585) (-604.724) (-604.164) * (-604.799) (-604.197) [-601.719] (-605.085) -- 0:00:46
Average standard deviation of split frequencies: 0.013079
230500 -- (-601.992) (-600.699) [-601.553] (-601.406) * (-602.569) (-603.145) [-600.420] (-608.753) -- 0:00:46
231000 -- (-600.268) [-601.220] (-603.620) (-602.848) * [-601.585] (-600.482) (-601.500) (-603.201) -- 0:00:46
231500 -- [-600.518] (-608.157) (-602.246) (-601.229) * [-600.672] (-601.784) (-601.962) (-602.175) -- 0:00:46
232000 -- [-602.043] (-606.841) (-600.867) (-601.997) * (-602.523) [-601.829] (-600.371) (-611.092) -- 0:00:46
232500 -- (-601.308) [-607.009] (-600.051) (-603.095) * [-601.578] (-602.942) (-604.787) (-607.289) -- 0:00:46
233000 -- (-601.398) (-605.721) (-601.982) [-600.779] * (-602.097) [-600.981] (-602.542) (-604.383) -- 0:00:46
233500 -- (-601.140) (-605.156) [-601.204] (-603.136) * (-602.072) (-605.992) (-605.252) [-601.202] -- 0:00:45
234000 -- (-600.505) (-601.831) [-602.377] (-600.861) * (-602.192) (-600.142) (-601.969) [-602.295] -- 0:00:45
234500 -- (-605.438) (-602.497) (-604.263) [-600.327] * (-605.240) (-601.160) (-603.178) [-605.752] -- 0:00:45
235000 -- (-605.156) (-602.043) [-601.892] (-600.457) * (-600.620) (-602.451) [-601.736] (-605.766) -- 0:00:48
Average standard deviation of split frequencies: 0.015139
235500 -- (-604.085) (-601.189) [-600.649] (-601.394) * (-605.630) [-602.115] (-604.075) (-604.102) -- 0:00:48
236000 -- (-606.603) (-602.575) (-602.005) [-603.262] * (-601.930) (-602.979) (-605.004) [-601.310] -- 0:00:48
236500 -- (-601.356) [-602.188] (-602.841) (-602.468) * (-600.037) (-600.690) [-603.800] (-602.157) -- 0:00:48
237000 -- (-601.026) (-602.524) (-601.133) [-601.979] * (-602.247) [-600.464] (-603.272) (-601.269) -- 0:00:48
237500 -- (-601.666) (-601.653) [-600.759] (-607.992) * (-602.803) (-600.806) [-601.970] (-601.310) -- 0:00:48
238000 -- (-600.840) (-601.392) [-600.911] (-603.226) * (-601.807) (-602.082) (-602.219) [-601.237] -- 0:00:48
238500 -- (-601.916) (-601.493) [-601.346] (-602.983) * (-604.473) (-602.891) (-602.698) [-601.708] -- 0:00:47
239000 -- [-601.256] (-604.494) (-602.255) (-602.026) * (-604.122) (-602.947) [-607.609] (-605.751) -- 0:00:47
239500 -- (-600.949) [-600.933] (-603.104) (-601.165) * (-604.011) [-602.243] (-602.558) (-603.285) -- 0:00:47
240000 -- (-602.953) (-602.076) (-602.017) [-600.866] * (-609.645) (-600.797) (-602.765) [-600.572] -- 0:00:47
Average standard deviation of split frequencies: 0.013417
240500 -- [-601.568] (-603.115) (-602.665) (-601.581) * (-605.184) (-600.905) (-603.048) [-604.034] -- 0:00:47
241000 -- [-600.735] (-600.978) (-609.919) (-600.465) * (-601.859) (-601.859) [-603.921] (-601.907) -- 0:00:47
241500 -- [-606.197] (-603.288) (-601.377) (-603.315) * (-602.237) (-602.378) [-605.922] (-608.290) -- 0:00:47
242000 -- (-603.505) (-604.989) [-600.992] (-601.545) * [-604.064] (-603.175) (-604.322) (-605.479) -- 0:00:46
242500 -- [-600.387] (-601.898) (-600.788) (-602.303) * [-602.755] (-602.853) (-602.089) (-600.733) -- 0:00:46
243000 -- [-600.895] (-601.621) (-602.478) (-603.644) * (-602.337) (-600.472) [-601.110] (-601.258) -- 0:00:46
243500 -- (-602.738) (-600.116) [-605.959] (-602.254) * (-602.221) (-602.401) (-601.728) [-601.011] -- 0:00:46
244000 -- (-604.825) [-600.413] (-600.639) (-604.534) * (-601.415) (-601.436) (-602.301) [-604.987] -- 0:00:46
244500 -- (-603.248) (-601.208) [-603.247] (-601.362) * [-601.503] (-605.412) (-602.005) (-602.428) -- 0:00:46
245000 -- (-607.708) (-602.770) [-600.627] (-602.235) * (-602.149) (-606.449) [-601.452] (-605.310) -- 0:00:46
Average standard deviation of split frequencies: 0.012935
245500 -- (-604.595) [-601.649] (-604.430) (-603.220) * (-603.185) [-600.610] (-604.471) (-606.338) -- 0:00:46
246000 -- (-603.952) (-602.082) [-601.788] (-602.230) * (-602.756) (-601.195) [-601.161] (-603.217) -- 0:00:45
246500 -- [-601.021] (-603.161) (-600.544) (-601.549) * (-604.227) (-602.572) (-601.616) [-603.528] -- 0:00:45
247000 -- [-602.464] (-601.052) (-601.331) (-603.492) * [-600.944] (-601.943) (-601.018) (-601.101) -- 0:00:45
247500 -- (-603.534) [-601.970] (-600.518) (-600.244) * [-600.653] (-603.577) (-601.221) (-602.548) -- 0:00:45
248000 -- [-601.314] (-602.249) (-600.590) (-601.896) * [-600.752] (-601.535) (-603.387) (-600.933) -- 0:00:45
248500 -- [-602.141] (-601.022) (-603.224) (-602.771) * (-600.959) [-600.057] (-602.819) (-601.466) -- 0:00:45
249000 -- [-601.665] (-602.263) (-606.781) (-601.281) * (-602.971) (-601.491) (-602.839) [-604.193] -- 0:00:45
249500 -- (-604.007) [-603.449] (-604.817) (-602.710) * (-602.179) (-600.741) [-601.936] (-605.440) -- 0:00:45
250000 -- (-604.241) [-600.723] (-605.736) (-603.207) * [-601.392] (-600.653) (-602.643) (-604.038) -- 0:00:45
Average standard deviation of split frequencies: 0.012224
250500 -- (-601.328) (-605.275) [-601.681] (-601.721) * [-605.775] (-601.717) (-603.920) (-603.534) -- 0:00:44
251000 -- [-601.781] (-602.252) (-604.073) (-602.368) * (-600.066) [-603.430] (-600.065) (-603.696) -- 0:00:44
251500 -- (-600.525) [-600.511] (-600.487) (-603.540) * (-600.957) [-607.651] (-602.373) (-600.602) -- 0:00:47
252000 -- (-604.119) (-602.320) (-602.105) [-603.376] * (-601.027) (-605.278) (-604.924) [-603.718] -- 0:00:47
252500 -- (-601.440) [-600.973] (-603.465) (-603.219) * (-602.983) (-601.823) [-601.673] (-602.949) -- 0:00:47
253000 -- [-601.834] (-600.408) (-600.892) (-601.098) * (-604.561) (-601.288) (-601.446) [-600.803] -- 0:00:47
253500 -- [-600.983] (-603.217) (-600.567) (-602.383) * (-602.128) (-605.285) (-601.471) [-600.512] -- 0:00:47
254000 -- (-602.668) (-603.514) (-602.455) [-606.433] * (-600.538) [-601.889] (-603.469) (-601.325) -- 0:00:46
254500 -- [-603.341] (-605.233) (-602.454) (-604.324) * [-602.835] (-601.989) (-601.522) (-603.148) -- 0:00:46
255000 -- [-601.097] (-601.225) (-604.767) (-602.380) * [-602.466] (-603.217) (-600.776) (-603.446) -- 0:00:46
Average standard deviation of split frequencies: 0.013197
255500 -- (-604.869) (-603.944) (-605.903) [-602.015] * [-603.311] (-601.492) (-601.984) (-601.822) -- 0:00:46
256000 -- [-600.677] (-601.928) (-601.587) (-602.811) * (-603.117) [-601.412] (-606.865) (-603.325) -- 0:00:46
256500 -- (-600.270) (-602.744) [-603.189] (-602.835) * (-603.766) (-602.033) (-602.488) [-601.978] -- 0:00:46
257000 -- (-604.195) [-602.227] (-602.403) (-605.165) * (-602.557) [-602.106] (-601.340) (-600.870) -- 0:00:46
257500 -- (-603.220) (-601.873) (-602.598) [-604.434] * (-607.271) [-602.174] (-600.540) (-602.080) -- 0:00:46
258000 -- [-605.161] (-603.979) (-602.576) (-605.608) * [-601.277] (-603.345) (-601.201) (-602.004) -- 0:00:46
258500 -- (-602.524) [-601.587] (-603.489) (-601.406) * (-602.727) (-600.913) [-601.999] (-601.682) -- 0:00:45
259000 -- (-600.600) (-602.225) [-604.110] (-601.877) * (-603.897) (-603.092) (-600.849) [-600.752] -- 0:00:45
259500 -- (-608.131) [-602.212] (-600.580) (-603.769) * [-602.704] (-601.885) (-603.311) (-601.692) -- 0:00:45
260000 -- (-600.672) (-601.754) (-601.913) [-601.205] * (-602.553) (-603.019) [-603.096] (-602.503) -- 0:00:45
Average standard deviation of split frequencies: 0.013463
260500 -- (-602.272) (-602.379) (-603.234) [-605.151] * (-605.731) (-605.858) (-600.184) [-604.157] -- 0:00:45
261000 -- (-603.541) [-602.138] (-602.813) (-601.985) * (-601.957) (-604.151) [-600.421] (-602.840) -- 0:00:45
261500 -- [-604.593] (-604.142) (-600.889) (-604.052) * (-601.243) [-600.659] (-600.095) (-602.711) -- 0:00:45
262000 -- (-609.912) (-602.739) (-603.827) [-603.435] * [-604.063] (-602.215) (-602.543) (-601.979) -- 0:00:45
262500 -- [-606.335] (-602.560) (-608.438) (-603.586) * (-602.616) (-608.165) (-602.175) [-601.199] -- 0:00:44
263000 -- (-603.022) [-602.890] (-603.403) (-603.322) * (-605.098) (-606.309) [-603.966] (-606.575) -- 0:00:44
263500 -- [-602.456] (-603.868) (-604.850) (-602.011) * (-604.751) [-601.515] (-602.903) (-602.080) -- 0:00:44
264000 -- (-605.009) (-605.619) (-602.843) [-603.661] * (-603.117) [-602.162] (-602.393) (-602.877) -- 0:00:44
264500 -- (-602.293) [-606.007] (-602.391) (-605.531) * [-603.142] (-602.831) (-601.983) (-602.461) -- 0:00:44
265000 -- [-602.109] (-604.226) (-603.534) (-603.892) * (-604.255) (-604.704) [-601.074] (-601.252) -- 0:00:44
Average standard deviation of split frequencies: 0.013095
265500 -- [-601.482] (-601.349) (-603.693) (-602.130) * (-605.897) (-600.999) (-608.148) [-602.534] -- 0:00:44
266000 -- (-601.090) [-602.636] (-607.104) (-608.568) * (-602.996) [-600.057] (-602.467) (-601.350) -- 0:00:44
266500 -- (-603.464) (-604.050) (-602.970) [-602.499] * (-602.269) (-603.508) [-601.122] (-604.356) -- 0:00:44
267000 -- (-603.449) (-601.749) (-604.656) [-601.796] * (-602.768) (-601.419) (-603.967) [-604.390] -- 0:00:43
267500 -- (-601.126) (-600.638) (-602.341) [-601.603] * [-601.395] (-600.905) (-601.230) (-600.997) -- 0:00:43
268000 -- (-603.787) [-600.343] (-603.039) (-603.891) * (-605.260) (-602.537) (-604.564) [-601.091] -- 0:00:43
268500 -- [-602.081] (-600.847) (-600.541) (-602.298) * (-600.586) (-602.120) (-602.776) [-601.265] -- 0:00:46
269000 -- (-601.232) (-602.848) [-602.310] (-602.697) * (-607.715) (-604.326) (-600.437) [-601.103] -- 0:00:46
269500 -- (-603.649) (-603.849) [-600.900] (-602.270) * (-603.809) (-602.395) [-600.485] (-602.311) -- 0:00:46
270000 -- (-602.643) (-602.182) [-601.953] (-601.457) * [-600.993] (-601.861) (-600.251) (-603.815) -- 0:00:45
Average standard deviation of split frequencies: 0.012375
270500 -- [-601.857] (-601.008) (-602.622) (-602.603) * (-602.063) (-602.322) [-601.042] (-605.211) -- 0:00:45
271000 -- (-601.597) [-600.960] (-600.522) (-602.677) * (-601.134) (-601.371) (-603.071) [-603.316] -- 0:00:45
271500 -- (-602.541) (-601.567) [-601.454] (-602.487) * (-608.728) [-604.721] (-601.489) (-606.700) -- 0:00:45
272000 -- (-607.827) (-604.639) [-601.418] (-601.436) * [-602.597] (-600.567) (-600.247) (-606.128) -- 0:00:45
272500 -- (-604.217) (-608.762) (-605.114) [-601.169] * (-603.249) (-601.647) (-599.950) [-602.743] -- 0:00:45
273000 -- (-601.765) [-601.512] (-600.597) (-602.049) * (-601.754) (-601.657) (-600.943) [-600.945] -- 0:00:45
273500 -- (-601.914) [-601.724] (-601.004) (-600.796) * (-603.472) (-604.245) (-601.374) [-601.363] -- 0:00:45
274000 -- (-602.071) (-603.227) [-601.199] (-602.035) * [-606.822] (-603.738) (-600.440) (-605.364) -- 0:00:45
274500 -- (-600.547) [-605.681] (-605.287) (-603.997) * (-607.424) (-602.030) (-602.939) [-600.842] -- 0:00:44
275000 -- (-600.265) (-607.676) (-603.608) [-602.155] * (-606.219) (-600.404) (-606.330) [-602.569] -- 0:00:44
Average standard deviation of split frequencies: 0.014411
275500 -- (-601.867) (-601.411) [-601.830] (-602.182) * (-600.733) (-600.884) [-602.569] (-601.434) -- 0:00:44
276000 -- [-602.876] (-602.218) (-602.152) (-602.921) * (-602.343) (-600.720) (-603.899) [-602.693] -- 0:00:44
276500 -- (-604.465) [-605.326] (-604.044) (-600.790) * (-603.621) [-601.308] (-604.920) (-602.201) -- 0:00:44
277000 -- [-602.535] (-601.859) (-602.603) (-601.594) * [-604.218] (-606.694) (-604.782) (-602.021) -- 0:00:44
277500 -- (-600.675) [-600.797] (-601.792) (-603.732) * (-603.012) (-602.752) [-602.584] (-603.184) -- 0:00:44
278000 -- (-604.439) [-603.048] (-602.868) (-603.119) * (-602.213) (-602.107) [-606.353] (-602.057) -- 0:00:44
278500 -- [-602.842] (-604.738) (-603.371) (-603.729) * (-603.598) (-602.093) [-604.096] (-605.239) -- 0:00:44
279000 -- [-603.491] (-602.806) (-601.447) (-601.264) * [-602.635] (-603.817) (-603.479) (-603.200) -- 0:00:43
279500 -- (-601.435) (-602.040) [-603.929] (-605.379) * (-605.155) (-600.909) (-603.065) [-602.723] -- 0:00:43
280000 -- (-603.566) (-601.507) (-602.488) [-603.723] * (-606.522) (-603.742) [-602.531] (-600.674) -- 0:00:43
Average standard deviation of split frequencies: 0.014591
280500 -- (-604.830) (-601.688) [-600.458] (-601.423) * (-607.618) [-605.670] (-602.884) (-601.682) -- 0:00:43
281000 -- (-602.021) [-603.113] (-602.388) (-603.171) * (-600.483) [-602.275] (-601.844) (-608.186) -- 0:00:43
281500 -- [-604.804] (-601.484) (-600.874) (-602.823) * (-603.550) (-601.773) [-601.242] (-606.122) -- 0:00:43
282000 -- (-605.404) (-601.157) [-603.330] (-600.291) * (-602.264) (-603.941) [-602.021] (-606.683) -- 0:00:43
282500 -- (-602.437) (-601.921) [-601.664] (-602.380) * (-606.731) [-602.774] (-602.167) (-606.917) -- 0:00:43
283000 -- (-606.424) [-602.087] (-602.340) (-604.565) * (-601.762) (-603.312) [-602.663] (-601.898) -- 0:00:43
283500 -- (-609.000) (-602.779) [-606.220] (-601.474) * (-605.501) [-603.412] (-607.595) (-603.280) -- 0:00:42
284000 -- (-603.108) (-601.586) (-605.025) [-603.062] * (-604.330) [-600.983] (-601.838) (-600.087) -- 0:00:42
284500 -- (-601.559) (-601.970) (-604.152) [-600.736] * (-601.698) (-602.490) (-601.774) [-602.174] -- 0:00:42
285000 -- [-600.302] (-601.281) (-604.989) (-601.734) * [-601.311] (-602.774) (-602.118) (-604.353) -- 0:00:45
Average standard deviation of split frequencies: 0.014350
285500 -- [-602.776] (-600.936) (-602.004) (-602.809) * [-600.277] (-601.692) (-602.729) (-602.182) -- 0:00:45
286000 -- (-601.323) (-600.960) (-600.873) [-605.873] * (-601.356) [-604.659] (-601.220) (-601.553) -- 0:00:44
286500 -- [-604.574] (-602.443) (-603.344) (-606.849) * [-601.524] (-604.733) (-602.033) (-602.410) -- 0:00:44
287000 -- (-601.801) [-600.537] (-603.006) (-603.458) * (-601.477) (-602.112) (-602.845) [-600.782] -- 0:00:44
287500 -- (-602.007) (-603.585) (-601.180) [-602.880] * (-600.387) (-603.212) (-601.722) [-600.071] -- 0:00:44
288000 -- [-602.700] (-599.982) (-602.033) (-611.907) * (-601.192) (-603.994) [-600.699] (-600.247) -- 0:00:44
288500 -- (-601.004) (-601.535) (-603.802) [-611.136] * (-602.172) (-600.903) (-601.388) [-601.984] -- 0:00:44
289000 -- (-601.394) (-601.773) [-600.652] (-606.379) * (-602.704) (-604.723) (-601.696) [-603.528] -- 0:00:44
289500 -- (-600.818) (-603.812) [-602.834] (-604.508) * (-602.629) (-601.029) [-601.963] (-601.689) -- 0:00:44
290000 -- (-602.413) (-601.223) [-600.241] (-604.458) * (-603.033) (-601.071) (-601.692) [-601.327] -- 0:00:44
Average standard deviation of split frequencies: 0.014495
290500 -- (-600.953) (-603.369) [-601.728] (-602.226) * (-601.647) (-606.087) (-601.122) [-604.364] -- 0:00:43
291000 -- (-600.852) (-608.945) [-606.311] (-600.361) * (-602.286) (-602.615) (-601.920) [-603.899] -- 0:00:43
291500 -- [-600.678] (-608.847) (-602.942) (-601.280) * (-603.211) (-605.279) (-601.220) [-601.043] -- 0:00:43
292000 -- (-601.481) [-602.439] (-600.963) (-601.105) * (-606.533) (-601.130) [-604.272] (-601.257) -- 0:00:43
292500 -- (-601.722) [-603.167] (-604.122) (-603.928) * (-604.019) [-601.083] (-603.405) (-600.747) -- 0:00:43
293000 -- [-601.421] (-600.906) (-605.881) (-607.010) * (-604.194) (-601.369) (-603.495) [-603.865] -- 0:00:43
293500 -- (-600.194) (-603.578) (-604.732) [-601.631] * (-600.976) [-600.562] (-601.149) (-601.799) -- 0:00:43
294000 -- (-602.241) (-603.618) (-600.656) [-600.948] * [-602.180] (-600.881) (-602.601) (-602.446) -- 0:00:43
294500 -- (-603.974) (-602.046) (-600.803) [-601.105] * [-604.956] (-600.245) (-600.599) (-603.196) -- 0:00:43
295000 -- (-602.451) (-601.142) [-600.803] (-603.286) * (-601.037) [-601.681] (-605.290) (-602.254) -- 0:00:43
Average standard deviation of split frequencies: 0.013736
295500 -- (-600.744) (-602.177) (-601.103) [-603.020] * [-600.487] (-602.011) (-601.942) (-602.744) -- 0:00:42
296000 -- (-600.181) (-601.789) (-602.285) [-599.987] * (-603.768) (-601.634) [-601.727] (-604.440) -- 0:00:42
296500 -- (-606.941) [-602.035] (-601.609) (-605.536) * (-601.036) (-601.292) [-604.864] (-601.958) -- 0:00:42
297000 -- [-601.656] (-600.398) (-602.036) (-601.124) * (-600.514) (-600.834) [-604.113] (-600.934) -- 0:00:42
297500 -- [-602.836] (-600.436) (-602.317) (-601.344) * (-601.612) (-601.032) (-605.772) [-602.184] -- 0:00:42
298000 -- [-602.805] (-602.257) (-601.358) (-600.506) * [-600.829] (-601.435) (-603.379) (-601.702) -- 0:00:42
298500 -- (-601.510) (-600.677) (-602.039) [-600.859] * (-603.152) (-604.177) (-601.915) [-602.739] -- 0:00:42
299000 -- (-604.207) (-601.643) (-602.017) [-600.932] * (-600.900) (-601.317) [-603.455] (-602.229) -- 0:00:42
299500 -- [-601.016] (-608.417) (-600.898) (-602.806) * [-601.096] (-600.905) (-600.161) (-604.280) -- 0:00:42
300000 -- (-603.902) (-609.173) (-601.847) [-602.399] * (-601.549) (-601.020) (-603.470) [-600.863] -- 0:00:42
Average standard deviation of split frequencies: 0.014756
300500 -- [-601.734] (-603.373) (-601.321) (-601.765) * [-603.055] (-601.187) (-602.920) (-603.629) -- 0:00:41
301000 -- [-601.280] (-603.852) (-600.584) (-602.663) * (-603.510) [-600.366] (-604.511) (-604.270) -- 0:00:41
301500 -- (-600.972) (-602.346) [-603.246] (-601.324) * (-605.190) (-602.587) [-600.983] (-601.016) -- 0:00:41
302000 -- (-601.548) (-600.244) [-603.164] (-600.917) * (-605.912) (-608.110) (-602.815) [-603.176] -- 0:00:43
302500 -- (-602.028) (-603.215) [-607.630] (-600.563) * (-605.959) [-601.712] (-603.698) (-605.708) -- 0:00:43
303000 -- (-600.568) (-600.441) [-605.013] (-601.914) * (-603.094) (-602.461) [-600.682] (-600.673) -- 0:00:43
303500 -- [-600.937] (-603.809) (-603.150) (-600.758) * [-603.785] (-602.192) (-603.296) (-605.207) -- 0:00:43
304000 -- (-603.916) (-608.498) [-604.858] (-602.534) * (-600.835) (-603.909) [-602.979] (-602.942) -- 0:00:43
304500 -- (-601.429) (-605.026) (-601.724) [-603.158] * (-601.440) [-601.236] (-608.018) (-602.471) -- 0:00:43
305000 -- (-601.462) [-606.451] (-600.829) (-604.478) * (-602.697) [-601.194] (-604.631) (-603.044) -- 0:00:43
Average standard deviation of split frequencies: 0.015043
305500 -- (-600.919) (-601.883) (-600.650) [-603.140] * (-602.334) (-600.552) [-603.609] (-600.717) -- 0:00:43
306000 -- (-601.343) [-607.219] (-601.796) (-609.256) * (-601.882) (-600.722) (-602.438) [-599.945] -- 0:00:43
306500 -- (-600.294) (-609.751) (-601.621) [-606.347] * (-602.262) [-601.962] (-605.623) (-601.515) -- 0:00:42
307000 -- [-600.479] (-602.134) (-602.499) (-601.557) * (-600.415) [-605.170] (-604.379) (-602.995) -- 0:00:42
307500 -- (-601.984) (-605.209) [-601.254] (-601.529) * (-602.161) [-603.230] (-603.529) (-600.598) -- 0:00:42
308000 -- (-600.382) (-603.804) (-602.584) [-603.035] * (-601.155) (-601.090) (-601.089) [-602.160] -- 0:00:42
308500 -- [-603.605] (-603.041) (-600.986) (-600.430) * (-601.254) (-603.471) (-601.707) [-602.919] -- 0:00:42
309000 -- (-602.828) (-604.642) [-601.229] (-604.170) * (-601.655) (-604.157) (-606.167) [-600.704] -- 0:00:42
309500 -- [-600.877] (-603.956) (-601.225) (-602.651) * [-601.429] (-606.225) (-603.921) (-602.483) -- 0:00:42
310000 -- (-601.937) (-600.985) (-600.709) [-606.132] * (-602.786) [-605.722] (-603.283) (-601.196) -- 0:00:42
Average standard deviation of split frequencies: 0.015531
310500 -- (-601.020) [-600.618] (-602.866) (-605.737) * (-601.328) (-603.546) [-602.073] (-604.733) -- 0:00:42
311000 -- [-602.854] (-602.526) (-600.900) (-601.952) * (-601.440) (-603.284) [-601.609] (-600.738) -- 0:00:42
311500 -- (-601.465) [-602.215] (-601.341) (-603.797) * (-600.969) (-602.738) [-601.935] (-600.698) -- 0:00:41
312000 -- (-601.143) (-603.481) [-601.620] (-604.503) * (-600.765) (-605.597) [-601.036] (-600.874) -- 0:00:41
312500 -- (-600.309) (-602.963) [-605.114] (-605.029) * [-599.980] (-604.488) (-601.098) (-604.280) -- 0:00:41
313000 -- (-602.456) (-601.125) (-601.839) [-606.376] * (-606.736) [-600.670] (-601.030) (-602.490) -- 0:00:41
313500 -- (-603.448) (-600.719) [-603.034] (-612.698) * (-603.634) (-602.139) [-604.830] (-600.605) -- 0:00:41
314000 -- (-603.147) [-601.725] (-601.315) (-609.971) * [-603.633] (-601.856) (-601.936) (-600.366) -- 0:00:41
314500 -- [-603.582] (-603.910) (-600.429) (-604.978) * (-604.383) (-601.646) [-601.165] (-603.398) -- 0:00:41
315000 -- (-600.009) [-601.181] (-605.849) (-606.356) * (-602.933) (-600.481) [-602.150] (-603.657) -- 0:00:41
Average standard deviation of split frequencies: 0.015664
315500 -- (-600.964) (-600.438) (-605.593) [-600.288] * [-601.688] (-606.772) (-606.473) (-601.339) -- 0:00:41
316000 -- (-602.779) (-604.556) [-602.411] (-601.731) * (-603.449) [-602.044] (-604.606) (-602.159) -- 0:00:41
316500 -- (-601.954) (-603.861) [-604.701] (-602.374) * (-601.316) (-604.926) (-602.971) [-600.750] -- 0:00:41
317000 -- (-603.839) (-606.039) (-601.783) [-602.608] * [-601.112] (-603.365) (-603.002) (-602.686) -- 0:00:40
317500 -- (-600.331) (-601.670) [-604.252] (-601.607) * (-604.542) [-605.003] (-604.116) (-604.203) -- 0:00:40
318000 -- (-601.862) (-602.615) [-603.665] (-601.908) * [-600.772] (-605.592) (-605.182) (-602.616) -- 0:00:40
318500 -- (-601.750) (-601.192) (-607.478) [-602.157] * (-601.300) [-600.570] (-603.354) (-603.899) -- 0:00:42
319000 -- [-600.123] (-601.414) (-604.225) (-602.275) * (-601.087) (-601.292) [-602.364] (-602.794) -- 0:00:42
319500 -- (-601.984) (-600.021) [-602.815] (-601.411) * (-601.222) (-603.102) [-604.243] (-604.783) -- 0:00:42
320000 -- (-602.099) (-600.319) [-603.029] (-602.353) * (-602.746) (-606.865) (-602.276) [-601.206] -- 0:00:42
Average standard deviation of split frequencies: 0.015711
320500 -- [-601.876] (-601.981) (-602.124) (-604.466) * (-600.604) (-605.608) [-603.426] (-602.092) -- 0:00:42
321000 -- (-603.792) (-604.702) [-602.448] (-602.972) * (-603.184) [-602.834] (-603.895) (-603.185) -- 0:00:42
321500 -- (-602.664) (-602.176) (-603.801) [-603.355] * [-601.566] (-603.884) (-601.303) (-602.008) -- 0:00:42
322000 -- (-600.823) (-601.984) [-605.214] (-602.415) * [-604.006] (-600.118) (-601.425) (-601.405) -- 0:00:42
322500 -- (-600.224) (-601.278) (-605.107) [-602.698] * (-600.688) (-600.681) [-601.161] (-601.886) -- 0:00:42
323000 -- [-600.695] (-606.928) (-603.078) (-605.625) * [-600.626] (-602.623) (-601.613) (-603.572) -- 0:00:41
323500 -- (-602.787) [-602.785] (-602.177) (-604.250) * [-600.482] (-603.065) (-602.444) (-603.142) -- 0:00:41
324000 -- (-603.191) (-601.031) (-603.321) [-601.808] * (-601.814) (-602.569) (-602.888) [-609.491] -- 0:00:41
324500 -- (-604.446) (-601.738) [-604.152] (-608.013) * (-601.741) (-609.928) [-600.870] (-603.498) -- 0:00:41
325000 -- (-606.067) [-600.536] (-605.830) (-608.324) * (-605.329) [-608.317] (-604.182) (-604.596) -- 0:00:41
Average standard deviation of split frequencies: 0.015274
325500 -- (-604.371) (-600.998) [-602.573] (-604.451) * [-605.087] (-605.450) (-601.606) (-602.456) -- 0:00:41
326000 -- (-603.314) (-600.585) [-602.220] (-602.757) * [-605.459] (-603.131) (-603.983) (-601.716) -- 0:00:41
326500 -- (-607.544) (-602.434) (-600.557) [-601.267] * [-602.003] (-601.308) (-605.950) (-601.985) -- 0:00:41
327000 -- (-601.648) (-601.804) [-602.428] (-605.856) * (-604.310) (-601.807) [-600.986] (-604.365) -- 0:00:41
327500 -- (-601.235) (-601.857) (-601.755) [-601.487] * (-602.859) (-602.908) (-602.928) [-600.885] -- 0:00:41
328000 -- (-601.019) (-600.896) [-605.606] (-602.024) * (-601.906) [-600.784] (-600.717) (-602.054) -- 0:00:40
328500 -- (-602.594) [-601.067] (-602.022) (-601.567) * (-605.459) (-604.055) [-601.427] (-601.296) -- 0:00:40
329000 -- (-602.395) (-601.145) (-604.432) [-602.992] * (-603.567) (-601.092) (-601.145) [-600.926] -- 0:00:40
329500 -- (-603.167) (-600.283) [-603.021] (-603.763) * (-601.071) (-602.402) (-601.491) [-600.793] -- 0:00:40
330000 -- [-602.614] (-600.699) (-603.396) (-609.377) * (-604.449) [-602.423] (-605.996) (-602.494) -- 0:00:40
Average standard deviation of split frequencies: 0.015504
330500 -- (-601.942) [-602.509] (-604.111) (-604.958) * [-603.098] (-602.764) (-601.227) (-604.207) -- 0:00:40
331000 -- (-604.800) [-601.756] (-602.712) (-601.596) * (-602.186) [-602.239] (-602.845) (-607.527) -- 0:00:40
331500 -- [-602.725] (-602.607) (-608.355) (-600.234) * (-605.630) (-601.148) [-600.725] (-604.768) -- 0:00:40
332000 -- (-601.780) [-601.479] (-606.532) (-602.156) * [-601.496] (-604.578) (-600.119) (-607.834) -- 0:00:40
332500 -- [-602.125] (-601.809) (-603.735) (-600.171) * (-601.455) (-601.554) [-601.795] (-602.269) -- 0:00:40
333000 -- (-604.389) (-607.359) (-602.481) [-602.049] * (-601.680) (-601.554) [-600.929] (-600.984) -- 0:00:40
333500 -- (-601.674) [-602.286] (-601.849) (-601.485) * (-603.545) [-602.046] (-601.181) (-600.774) -- 0:00:39
334000 -- (-601.128) (-600.726) [-601.299] (-600.618) * [-603.583] (-603.740) (-600.489) (-601.742) -- 0:00:39
334500 -- (-604.320) (-603.091) (-600.251) [-600.847] * (-605.048) (-603.144) (-605.856) [-601.144] -- 0:00:39
335000 -- (-601.413) (-605.636) (-601.761) [-601.663] * (-603.373) [-602.300] (-603.209) (-600.641) -- 0:00:39
Average standard deviation of split frequencies: 0.015696
335500 -- (-604.997) [-602.557] (-600.941) (-600.932) * (-601.834) (-603.464) (-602.126) [-602.485] -- 0:00:41
336000 -- (-605.068) (-601.036) [-602.137] (-603.181) * (-600.480) [-600.865] (-599.989) (-600.187) -- 0:00:41
336500 -- (-605.581) (-602.284) [-601.873] (-601.337) * [-600.270] (-600.638) (-609.152) (-600.850) -- 0:00:41
337000 -- (-602.024) (-602.584) (-601.818) [-604.901] * (-601.527) (-600.331) (-600.730) [-601.147] -- 0:00:41
337500 -- (-601.216) (-600.646) [-601.130] (-605.306) * (-601.283) (-601.960) [-602.040] (-602.786) -- 0:00:41
338000 -- (-600.698) (-603.497) (-605.389) [-602.686] * (-601.371) (-600.865) [-603.208] (-603.201) -- 0:00:41
338500 -- [-602.607] (-602.297) (-605.593) (-601.235) * [-600.535] (-600.659) (-600.899) (-602.796) -- 0:00:41
339000 -- [-604.608] (-604.918) (-604.018) (-603.355) * [-600.633] (-602.938) (-600.116) (-603.741) -- 0:00:40
339500 -- (-604.830) [-601.588] (-604.065) (-602.399) * (-602.777) (-606.327) [-600.644] (-603.072) -- 0:00:40
340000 -- (-602.619) (-603.193) (-602.360) [-601.736] * (-601.227) [-602.109] (-602.401) (-602.679) -- 0:00:40
Average standard deviation of split frequencies: 0.013924
340500 -- (-606.363) (-601.256) [-600.826] (-604.238) * (-600.946) (-605.328) (-601.565) [-600.956] -- 0:00:40
341000 -- [-603.531] (-603.903) (-600.940) (-607.525) * [-600.831] (-603.132) (-601.144) (-601.729) -- 0:00:40
341500 -- (-601.491) (-603.854) [-603.467] (-605.614) * (-602.878) (-601.698) (-600.316) [-604.011] -- 0:00:40
342000 -- [-602.991] (-602.699) (-602.084) (-603.741) * (-604.874) [-601.184] (-606.008) (-601.693) -- 0:00:40
342500 -- (-604.649) [-602.770] (-603.405) (-602.845) * (-600.083) (-601.159) [-602.837] (-602.034) -- 0:00:40
343000 -- [-602.480] (-603.629) (-600.388) (-607.309) * [-602.705] (-601.751) (-602.535) (-600.595) -- 0:00:40
343500 -- [-601.126] (-602.363) (-604.783) (-602.572) * (-606.690) (-600.132) [-602.086] (-602.013) -- 0:00:40
344000 -- (-601.110) (-604.106) (-609.769) [-600.669] * (-606.212) (-600.663) [-602.404] (-602.985) -- 0:00:40
344500 -- (-601.045) [-606.802] (-600.708) (-603.416) * (-604.700) (-602.132) [-600.002] (-603.265) -- 0:00:39
345000 -- [-602.992] (-602.557) (-602.020) (-600.397) * (-602.111) [-601.329] (-601.778) (-601.388) -- 0:00:39
Average standard deviation of split frequencies: 0.014306
345500 -- (-602.588) [-603.698] (-602.792) (-601.155) * (-602.355) (-601.691) [-602.584] (-602.381) -- 0:00:39
346000 -- [-602.704] (-602.429) (-601.846) (-603.256) * [-602.112] (-604.179) (-601.055) (-600.858) -- 0:00:39
346500 -- (-603.383) (-605.150) [-601.704] (-610.312) * [-602.179] (-603.143) (-601.155) (-602.792) -- 0:00:39
347000 -- (-603.019) (-601.867) (-603.762) [-603.187] * (-602.061) [-602.788] (-602.740) (-603.911) -- 0:00:39
347500 -- (-603.155) (-601.789) [-600.463] (-600.732) * (-602.535) [-601.821] (-610.751) (-603.615) -- 0:00:39
348000 -- (-601.514) (-601.546) [-600.763] (-602.083) * (-603.627) [-600.875] (-603.705) (-603.233) -- 0:00:39
348500 -- [-600.494] (-600.435) (-601.703) (-601.213) * (-603.808) [-602.895] (-600.930) (-603.847) -- 0:00:39
349000 -- [-602.171] (-606.091) (-604.622) (-604.226) * (-613.701) [-603.214] (-601.671) (-603.494) -- 0:00:39
349500 -- (-603.264) (-602.476) (-603.241) [-603.660] * (-606.191) [-601.602] (-601.427) (-603.774) -- 0:00:39
350000 -- [-604.072] (-604.282) (-603.767) (-607.031) * (-602.894) (-602.750) [-602.071] (-604.089) -- 0:00:39
Average standard deviation of split frequencies: 0.015123
350500 -- [-603.399] (-601.387) (-601.280) (-603.393) * (-600.816) [-601.278] (-602.448) (-601.697) -- 0:00:38
351000 -- (-602.483) [-600.708] (-602.784) (-602.053) * (-601.574) (-605.027) (-603.198) [-601.743] -- 0:00:38
351500 -- (-604.252) (-605.208) [-601.948] (-603.676) * (-605.791) (-604.725) [-601.028] (-602.068) -- 0:00:38
352000 -- [-604.919] (-606.212) (-601.153) (-604.573) * (-602.715) (-604.268) [-604.073] (-600.558) -- 0:00:40
352500 -- (-603.150) (-601.128) [-601.164] (-603.672) * (-603.747) (-602.941) [-604.708] (-600.557) -- 0:00:40
353000 -- (-605.299) [-601.356] (-602.577) (-606.245) * (-605.505) (-600.569) (-601.516) [-603.719] -- 0:00:40
353500 -- (-600.078) (-601.026) [-602.873] (-601.604) * [-601.058] (-600.669) (-606.899) (-605.296) -- 0:00:40
354000 -- (-600.783) (-600.819) (-603.597) [-601.280] * (-600.651) (-601.602) [-604.780] (-602.468) -- 0:00:40
354500 -- (-601.758) [-602.512] (-601.018) (-604.412) * (-600.698) (-604.624) (-603.053) [-602.438] -- 0:00:40
355000 -- (-600.684) (-602.282) [-600.124] (-601.115) * (-601.511) (-605.809) [-601.149] (-603.402) -- 0:00:39
Average standard deviation of split frequencies: 0.015642
355500 -- (-604.198) [-603.238] (-603.979) (-603.412) * (-604.519) (-600.767) (-600.923) [-603.029] -- 0:00:39
356000 -- [-604.903] (-606.001) (-603.734) (-603.471) * (-605.626) (-601.217) (-601.074) [-601.940] -- 0:00:39
356500 -- [-600.598] (-602.883) (-600.838) (-604.282) * [-603.028] (-601.139) (-601.487) (-603.959) -- 0:00:39
357000 -- (-600.580) [-602.819] (-607.696) (-603.352) * (-602.400) (-600.634) (-605.958) [-601.176] -- 0:00:39
357500 -- (-600.568) (-603.235) (-601.803) [-601.792] * (-600.770) [-606.471] (-601.557) (-603.120) -- 0:00:39
358000 -- (-601.833) (-601.060) (-601.908) [-599.912] * (-601.287) (-601.126) [-604.319] (-600.975) -- 0:00:39
358500 -- (-603.986) (-601.625) [-602.946] (-601.071) * (-601.007) [-603.145] (-602.193) (-603.789) -- 0:00:39
359000 -- (-601.571) (-601.839) [-604.555] (-602.572) * (-602.834) (-604.884) [-602.267] (-603.838) -- 0:00:39
359500 -- (-601.091) [-601.748] (-602.153) (-602.082) * (-607.994) (-603.611) [-604.079] (-600.814) -- 0:00:39
360000 -- (-605.470) (-601.169) [-601.800] (-604.341) * (-601.534) [-605.303] (-601.730) (-604.142) -- 0:00:39
Average standard deviation of split frequencies: 0.015358
360500 -- (-602.786) (-600.399) (-600.222) [-603.291] * [-600.609] (-604.683) (-602.380) (-608.068) -- 0:00:39
361000 -- (-600.102) (-603.558) [-601.228] (-603.375) * [-600.351] (-607.014) (-600.931) (-604.399) -- 0:00:38
361500 -- (-603.870) [-601.855] (-602.224) (-602.176) * (-601.521) [-602.562] (-600.666) (-600.993) -- 0:00:38
362000 -- (-603.456) (-601.826) [-603.160] (-602.657) * (-601.781) (-603.711) (-600.625) [-604.292] -- 0:00:38
362500 -- (-602.122) [-601.869] (-601.228) (-601.258) * [-603.032] (-604.170) (-601.750) (-601.190) -- 0:00:38
363000 -- (-602.637) (-602.126) (-600.712) [-602.892] * (-601.279) (-600.414) (-602.838) [-600.954] -- 0:00:38
363500 -- [-602.491] (-607.671) (-601.253) (-602.193) * (-601.556) [-603.438] (-601.033) (-605.953) -- 0:00:38
364000 -- (-603.586) [-601.193] (-601.635) (-601.546) * (-603.470) (-608.178) [-601.725] (-601.873) -- 0:00:38
364500 -- [-605.938] (-601.939) (-601.880) (-604.427) * (-603.273) (-600.550) (-603.293) [-601.157] -- 0:00:38
365000 -- [-603.060] (-602.832) (-600.933) (-603.743) * (-605.080) (-600.547) (-602.839) [-605.053] -- 0:00:38
Average standard deviation of split frequencies: 0.016261
365500 -- [-601.462] (-601.171) (-605.118) (-605.049) * (-602.485) (-600.978) [-601.300] (-606.235) -- 0:00:38
366000 -- [-601.796] (-602.630) (-602.043) (-605.760) * [-602.560] (-605.902) (-601.424) (-602.179) -- 0:00:38
366500 -- (-601.188) [-600.309] (-602.361) (-601.785) * [-601.903] (-600.394) (-602.900) (-606.197) -- 0:00:38
367000 -- [-603.081] (-601.491) (-604.877) (-600.471) * [-603.153] (-601.185) (-603.135) (-603.295) -- 0:00:37
367500 -- [-600.603] (-605.470) (-602.351) (-600.606) * [-602.102] (-600.533) (-602.802) (-600.909) -- 0:00:37
368000 -- (-600.114) (-602.735) [-601.892] (-601.477) * (-604.587) (-601.900) [-601.142] (-603.120) -- 0:00:37
368500 -- [-600.482] (-599.890) (-603.171) (-602.573) * (-606.798) (-604.272) [-600.325] (-601.610) -- 0:00:37
369000 -- (-601.960) (-601.985) [-601.646] (-601.576) * [-601.464] (-602.217) (-600.985) (-603.990) -- 0:00:39
369500 -- (-601.492) (-605.431) (-603.091) [-600.973] * (-604.226) (-602.430) [-603.466] (-602.445) -- 0:00:39
370000 -- (-606.339) [-601.801] (-604.187) (-601.996) * (-602.197) [-602.151] (-601.937) (-602.255) -- 0:00:39
Average standard deviation of split frequencies: 0.016454
370500 -- [-605.457] (-600.498) (-601.589) (-601.477) * [-601.256] (-600.983) (-602.266) (-601.960) -- 0:00:39
371000 -- (-605.754) (-605.892) [-603.397] (-601.584) * (-602.050) (-601.553) (-600.740) [-600.888] -- 0:00:38
371500 -- [-603.245] (-601.472) (-603.922) (-602.631) * [-604.704] (-607.941) (-602.487) (-603.091) -- 0:00:38
372000 -- [-600.675] (-601.145) (-606.659) (-601.934) * (-601.324) [-601.899] (-600.232) (-601.813) -- 0:00:38
372500 -- (-603.723) (-601.216) [-602.092] (-602.591) * (-600.511) (-602.172) (-601.006) [-599.887] -- 0:00:38
373000 -- [-606.945] (-602.239) (-602.720) (-602.263) * (-603.750) [-602.089] (-600.738) (-600.265) -- 0:00:38
373500 -- [-604.292] (-603.138) (-603.792) (-600.465) * (-601.233) [-601.251] (-602.722) (-602.215) -- 0:00:38
374000 -- [-604.749] (-603.951) (-600.460) (-601.832) * (-602.226) (-600.521) [-600.496] (-602.495) -- 0:00:38
374500 -- [-601.965] (-600.478) (-605.493) (-600.944) * (-601.345) (-605.781) [-602.761] (-602.073) -- 0:00:38
375000 -- (-602.064) [-600.720] (-602.398) (-600.748) * (-601.829) (-606.087) [-604.220] (-600.428) -- 0:00:38
Average standard deviation of split frequencies: 0.015907
375500 -- [-602.062] (-602.356) (-601.650) (-605.008) * [-601.530] (-602.561) (-600.971) (-603.389) -- 0:00:38
376000 -- (-603.456) (-601.106) [-601.716] (-604.086) * (-600.163) (-604.042) (-604.436) [-600.849] -- 0:00:38
376500 -- (-605.859) (-603.451) [-600.689] (-603.139) * (-602.752) (-600.971) [-601.575] (-603.130) -- 0:00:38
377000 -- (-601.691) (-600.719) [-602.566] (-601.454) * [-601.417] (-600.830) (-600.018) (-605.774) -- 0:00:38
377500 -- [-602.469] (-601.196) (-602.769) (-599.959) * (-603.299) (-602.702) (-601.486) [-602.363] -- 0:00:37
378000 -- (-606.083) (-601.307) (-601.512) [-601.586] * (-601.909) [-604.200] (-601.696) (-600.692) -- 0:00:37
378500 -- (-602.713) [-600.922] (-603.320) (-605.703) * [-601.190] (-604.269) (-601.080) (-600.400) -- 0:00:37
379000 -- (-602.179) [-600.255] (-602.070) (-605.368) * (-603.082) [-601.913] (-600.776) (-602.492) -- 0:00:37
379500 -- (-604.936) (-606.993) [-601.391] (-602.903) * [-602.417] (-601.146) (-600.888) (-601.264) -- 0:00:37
380000 -- (-603.751) (-605.438) [-602.268] (-602.752) * (-601.751) (-603.958) [-601.780] (-602.298) -- 0:00:37
Average standard deviation of split frequencies: 0.016486
380500 -- [-599.924] (-604.770) (-600.565) (-603.427) * [-600.157] (-607.991) (-602.861) (-601.471) -- 0:00:37
381000 -- [-602.341] (-602.040) (-603.304) (-600.328) * [-604.280] (-600.570) (-601.687) (-601.433) -- 0:00:37
381500 -- (-602.393) [-601.445] (-600.407) (-600.736) * (-603.270) (-600.476) [-602.708] (-602.417) -- 0:00:37
382000 -- [-600.545] (-604.943) (-603.360) (-600.679) * (-602.500) (-601.110) (-600.985) [-601.862] -- 0:00:37
382500 -- (-602.391) (-602.503) (-607.239) [-602.146] * (-600.965) (-600.932) (-601.517) [-600.588] -- 0:00:37
383000 -- (-602.467) (-601.214) (-614.460) [-600.996] * (-603.186) (-600.392) [-604.131] (-602.402) -- 0:00:37
383500 -- (-603.739) (-601.785) [-605.961] (-608.767) * [-603.655] (-600.661) (-602.806) (-600.639) -- 0:00:36
384000 -- (-602.857) (-606.163) [-601.480] (-606.237) * [-603.392] (-600.462) (-602.065) (-602.886) -- 0:00:36
384500 -- (-600.629) (-604.197) [-601.445] (-602.185) * (-601.553) [-600.885] (-600.627) (-601.557) -- 0:00:36
385000 -- (-601.116) (-601.142) (-602.021) [-600.705] * [-605.151] (-603.803) (-603.444) (-603.488) -- 0:00:36
Average standard deviation of split frequencies: 0.015495
385500 -- (-605.213) [-601.166] (-603.386) (-604.577) * (-601.164) [-604.119] (-604.450) (-603.377) -- 0:00:36
386000 -- [-603.989] (-601.900) (-602.251) (-601.196) * (-603.401) [-602.847] (-602.351) (-603.340) -- 0:00:38
386500 -- (-602.411) [-602.652] (-601.919) (-602.298) * (-604.911) (-601.841) (-602.952) [-601.534] -- 0:00:38
387000 -- (-602.948) [-600.539] (-600.582) (-604.435) * (-602.198) (-601.400) [-604.855] (-606.457) -- 0:00:38
387500 -- (-607.129) (-600.199) [-602.684] (-602.967) * (-603.752) (-601.894) (-603.518) [-600.536] -- 0:00:37
388000 -- (-607.152) (-606.755) [-602.429] (-602.553) * (-602.332) (-602.993) (-601.491) [-604.531] -- 0:00:37
388500 -- (-603.046) (-600.553) (-603.716) [-602.455] * (-600.942) (-600.553) (-601.407) [-605.015] -- 0:00:37
389000 -- [-601.660] (-601.341) (-604.154) (-604.509) * [-603.715] (-600.141) (-602.673) (-606.334) -- 0:00:37
389500 -- [-600.562] (-601.363) (-604.520) (-606.183) * (-602.006) (-601.895) [-601.311] (-606.173) -- 0:00:37
390000 -- [-600.424] (-603.356) (-604.757) (-604.967) * (-602.699) (-602.199) [-602.005] (-610.817) -- 0:00:37
Average standard deviation of split frequencies: 0.016064
390500 -- [-600.628] (-601.022) (-609.357) (-602.609) * (-604.688) (-601.456) [-602.469] (-600.524) -- 0:00:37
391000 -- [-600.628] (-601.321) (-604.866) (-601.852) * (-601.489) (-601.525) [-600.156] (-600.420) -- 0:00:37
391500 -- (-602.387) (-601.775) (-604.252) [-602.173] * (-604.605) (-603.423) (-600.294) [-600.787] -- 0:00:37
392000 -- (-605.327) [-603.072] (-601.614) (-602.616) * (-605.884) (-601.400) [-601.396] (-601.463) -- 0:00:37
392500 -- [-603.493] (-603.039) (-601.558) (-600.641) * (-605.371) (-601.855) [-600.392] (-602.819) -- 0:00:37
393000 -- (-601.057) (-601.540) [-602.882] (-605.572) * (-607.796) (-605.643) (-602.629) [-606.547] -- 0:00:37
393500 -- [-601.375] (-602.468) (-602.755) (-602.344) * [-600.962] (-601.589) (-608.484) (-611.964) -- 0:00:36
394000 -- (-603.092) [-600.075] (-600.807) (-602.448) * [-600.397] (-600.840) (-604.312) (-608.307) -- 0:00:36
394500 -- (-602.561) (-604.617) (-600.954) [-602.126] * [-602.929] (-605.004) (-602.431) (-602.235) -- 0:00:36
395000 -- (-601.690) (-612.496) (-601.680) [-604.779] * (-601.639) (-602.406) [-602.055] (-606.868) -- 0:00:36
Average standard deviation of split frequencies: 0.015996
395500 -- (-601.421) (-606.322) (-603.770) [-601.702] * (-601.000) [-602.902] (-604.596) (-600.809) -- 0:00:36
396000 -- (-600.344) (-601.545) [-601.677] (-605.481) * (-606.409) [-601.897] (-608.034) (-604.103) -- 0:00:36
396500 -- [-601.767] (-602.884) (-602.609) (-606.001) * (-608.028) (-612.623) [-602.091] (-607.691) -- 0:00:36
397000 -- [-604.235] (-602.778) (-600.513) (-608.145) * (-603.607) (-601.819) [-600.756] (-602.621) -- 0:00:36
397500 -- (-604.395) (-604.336) [-603.744] (-601.611) * (-603.862) (-602.851) (-602.684) [-602.161] -- 0:00:36
398000 -- [-600.582] (-604.047) (-603.359) (-603.616) * (-603.110) (-601.363) [-601.481] (-601.764) -- 0:00:36
398500 -- (-601.045) [-602.054] (-603.615) (-600.897) * (-601.864) (-599.953) (-600.876) [-602.226] -- 0:00:36
399000 -- (-604.853) (-603.254) (-609.068) [-601.866] * (-603.245) [-600.192] (-603.912) (-602.259) -- 0:00:36
399500 -- [-600.734] (-606.159) (-602.950) (-603.271) * (-602.312) (-602.709) (-603.267) [-604.668] -- 0:00:36
400000 -- (-604.140) (-601.896) [-605.522] (-603.630) * (-601.878) [-602.664] (-602.881) (-602.797) -- 0:00:36
Average standard deviation of split frequencies: 0.014780
400500 -- (-602.992) [-602.237] (-603.700) (-600.684) * (-600.203) (-601.092) [-602.255] (-600.828) -- 0:00:35
401000 -- (-602.081) (-600.468) [-602.307] (-601.425) * (-600.447) (-601.730) (-601.994) [-601.180] -- 0:00:35
401500 -- (-602.821) (-606.169) (-600.772) [-603.054] * (-602.197) (-602.495) (-602.971) [-601.971] -- 0:00:35
402000 -- [-602.771] (-604.679) (-601.959) (-603.777) * (-602.586) (-603.074) (-603.115) [-605.049] -- 0:00:35
402500 -- (-602.716) (-601.343) [-601.356] (-601.166) * [-602.017] (-604.630) (-602.381) (-602.867) -- 0:00:37
403000 -- (-602.812) (-600.259) [-601.680] (-601.896) * (-600.672) (-600.574) [-600.882] (-605.039) -- 0:00:37
403500 -- [-601.214] (-600.385) (-603.580) (-605.506) * [-600.051] (-603.204) (-602.595) (-604.444) -- 0:00:36
404000 -- (-601.204) [-600.364] (-601.851) (-606.089) * (-600.305) [-601.422] (-603.510) (-605.149) -- 0:00:36
404500 -- [-600.721] (-601.768) (-606.893) (-602.274) * (-601.445) (-602.647) (-603.166) [-601.891] -- 0:00:36
405000 -- (-603.616) [-602.259] (-602.248) (-601.635) * (-601.516) [-600.641] (-600.448) (-605.104) -- 0:00:36
Average standard deviation of split frequencies: 0.013933
405500 -- (-602.676) (-601.931) (-602.478) [-608.577] * [-603.090] (-602.224) (-600.427) (-601.873) -- 0:00:36
406000 -- (-604.425) (-600.712) [-601.665] (-601.559) * (-605.875) [-603.144] (-604.991) (-604.139) -- 0:00:36
406500 -- (-600.933) [-600.540] (-603.342) (-601.732) * (-603.853) [-599.973] (-603.969) (-601.032) -- 0:00:36
407000 -- [-602.586] (-601.737) (-604.449) (-599.978) * (-604.011) (-601.577) [-603.978] (-603.490) -- 0:00:36
407500 -- [-601.186] (-602.014) (-602.456) (-601.382) * [-602.168] (-606.494) (-607.764) (-602.017) -- 0:00:36
408000 -- (-601.249) (-604.146) (-602.698) [-600.299] * (-604.280) (-603.734) [-605.050] (-601.404) -- 0:00:36
408500 -- (-602.760) (-603.131) [-601.585] (-600.183) * (-602.078) (-609.196) [-602.276] (-605.077) -- 0:00:36
409000 -- [-600.322] (-604.133) (-605.832) (-602.617) * (-607.989) (-601.737) [-603.031] (-602.488) -- 0:00:36
409500 -- (-601.597) (-601.422) (-602.448) [-603.138] * (-600.419) (-606.186) [-601.986] (-605.880) -- 0:00:36
410000 -- [-601.189] (-603.246) (-601.296) (-603.831) * (-600.500) (-600.718) (-603.888) [-601.786] -- 0:00:35
Average standard deviation of split frequencies: 0.014277
410500 -- (-601.012) (-602.660) (-600.582) [-601.926] * (-605.306) [-601.894] (-602.269) (-603.315) -- 0:00:35
411000 -- (-603.699) (-607.205) (-602.984) [-602.204] * (-605.676) [-603.200] (-601.249) (-602.148) -- 0:00:35
411500 -- [-604.564] (-602.023) (-601.807) (-602.776) * (-602.562) (-603.161) (-602.538) [-602.359] -- 0:00:35
412000 -- [-602.039] (-603.646) (-603.990) (-604.812) * (-604.816) [-602.428] (-606.493) (-603.770) -- 0:00:35
412500 -- (-601.747) [-603.075] (-611.504) (-601.875) * [-602.324] (-602.223) (-604.470) (-603.263) -- 0:00:35
413000 -- (-605.326) (-605.150) (-605.658) [-604.724] * (-602.697) (-603.344) (-601.353) [-602.071] -- 0:00:35
413500 -- (-604.227) [-602.267] (-605.686) (-601.535) * [-603.912] (-602.007) (-602.183) (-601.437) -- 0:00:35
414000 -- (-603.566) (-601.691) [-600.316] (-603.645) * [-603.695] (-601.612) (-603.849) (-600.685) -- 0:00:35
414500 -- (-603.274) [-600.620] (-601.008) (-606.359) * (-602.591) (-601.400) (-603.456) [-602.527] -- 0:00:35
415000 -- (-603.267) (-600.152) (-605.026) [-604.263] * [-604.124] (-603.490) (-603.320) (-603.758) -- 0:00:35
Average standard deviation of split frequencies: 0.013882
415500 -- (-602.986) (-600.682) [-600.866] (-605.836) * [-602.271] (-603.833) (-600.676) (-604.856) -- 0:00:35
416000 -- (-603.406) (-600.853) [-601.447] (-604.638) * (-602.104) (-600.126) [-603.257] (-606.457) -- 0:00:35
416500 -- (-601.460) [-607.341] (-604.961) (-604.529) * (-605.740) (-600.984) (-601.894) [-602.060] -- 0:00:35
417000 -- (-601.792) [-601.339] (-602.026) (-604.309) * [-606.260] (-602.596) (-601.964) (-603.013) -- 0:00:34
417500 -- (-603.361) [-601.102] (-601.072) (-601.552) * (-600.558) [-604.054] (-602.312) (-609.168) -- 0:00:34
418000 -- (-603.568) (-603.655) [-600.568] (-600.040) * (-601.014) (-600.719) (-608.920) [-603.058] -- 0:00:34
418500 -- (-602.174) (-604.042) (-600.889) [-599.992] * (-609.956) (-601.709) (-601.406) [-601.376] -- 0:00:34
419000 -- [-603.628] (-602.929) (-604.283) (-602.790) * (-601.075) (-608.024) (-602.926) [-602.452] -- 0:00:34
419500 -- (-602.985) [-602.246] (-600.702) (-603.242) * (-601.587) (-605.671) (-603.374) [-601.032] -- 0:00:35
420000 -- [-601.604] (-600.969) (-601.288) (-601.968) * (-605.178) (-602.369) (-603.592) [-601.389] -- 0:00:35
Average standard deviation of split frequencies: 0.013167
420500 -- [-601.161] (-601.238) (-601.666) (-603.913) * (-600.426) (-610.026) [-604.396] (-602.648) -- 0:00:35
421000 -- [-600.667] (-603.361) (-604.901) (-603.081) * [-601.981] (-603.297) (-606.752) (-602.335) -- 0:00:35
421500 -- [-600.795] (-601.214) (-603.873) (-602.824) * (-603.527) (-604.649) [-605.058] (-601.221) -- 0:00:35
422000 -- [-600.688] (-600.629) (-605.176) (-602.005) * (-604.020) [-603.900] (-600.589) (-603.054) -- 0:00:35
422500 -- (-601.382) [-600.606] (-605.612) (-602.435) * (-601.837) (-603.210) [-600.871] (-603.222) -- 0:00:35
423000 -- [-600.616] (-602.628) (-606.555) (-601.889) * (-601.132) (-607.290) (-602.210) [-600.754] -- 0:00:35
423500 -- (-601.413) [-602.425] (-602.183) (-601.078) * (-604.299) (-605.830) (-607.609) [-602.790] -- 0:00:35
424000 -- (-602.813) [-600.791] (-600.097) (-603.624) * (-605.090) (-606.817) (-604.392) [-603.962] -- 0:00:35
424500 -- [-604.408] (-605.403) (-601.314) (-604.131) * [-604.543] (-602.458) (-601.493) (-601.219) -- 0:00:35
425000 -- (-600.210) (-602.033) [-601.586] (-602.652) * (-610.339) (-601.180) (-600.165) [-602.586] -- 0:00:35
Average standard deviation of split frequencies: 0.013141
425500 -- (-605.327) (-602.517) [-601.854] (-602.959) * (-604.745) (-607.322) [-600.446] (-602.396) -- 0:00:35
426000 -- (-603.792) (-606.758) (-604.964) [-601.092] * (-603.078) [-603.894] (-601.460) (-607.629) -- 0:00:35
426500 -- (-602.142) (-602.814) (-604.759) [-601.242] * (-601.584) (-600.787) (-601.635) [-607.449] -- 0:00:34
427000 -- (-601.683) (-605.171) [-601.090] (-603.360) * (-603.862) (-601.080) [-603.831] (-600.882) -- 0:00:34
427500 -- (-601.664) (-604.091) (-601.463) [-602.143] * (-601.264) (-602.187) (-600.181) [-602.492] -- 0:00:34
428000 -- (-601.544) (-600.947) [-601.180] (-602.287) * (-600.478) [-602.283] (-602.963) (-603.165) -- 0:00:34
428500 -- (-600.669) [-600.392] (-602.616) (-602.771) * (-602.436) (-600.871) (-601.364) [-600.856] -- 0:00:34
429000 -- (-603.395) [-601.702] (-601.999) (-603.084) * (-600.525) (-602.364) [-601.910] (-600.733) -- 0:00:34
429500 -- (-601.087) (-602.072) [-602.463] (-602.944) * (-605.444) (-600.894) (-601.233) [-600.889] -- 0:00:34
430000 -- (-601.836) (-601.155) [-601.099] (-601.303) * (-603.340) (-601.914) (-604.889) [-605.874] -- 0:00:34
Average standard deviation of split frequencies: 0.012519
430500 -- (-603.840) (-600.674) (-602.741) [-600.830] * (-602.730) [-603.306] (-600.761) (-607.038) -- 0:00:34
431000 -- (-606.104) (-601.039) [-601.412] (-600.750) * (-601.966) [-602.736] (-601.765) (-602.957) -- 0:00:34
431500 -- [-603.367] (-604.318) (-602.381) (-601.840) * (-600.428) (-602.433) [-606.679] (-600.643) -- 0:00:34
432000 -- (-601.435) (-602.586) [-600.296] (-602.653) * (-601.079) [-602.689] (-601.878) (-600.677) -- 0:00:34
432500 -- (-602.498) [-601.486] (-606.484) (-602.239) * (-601.149) (-601.971) [-605.095] (-601.819) -- 0:00:34
433000 -- (-604.167) (-602.392) (-606.550) [-600.761] * (-602.269) (-602.182) [-602.217] (-602.135) -- 0:00:34
433500 -- [-604.667] (-601.793) (-603.715) (-602.202) * (-601.764) (-601.454) (-601.489) [-600.796] -- 0:00:33
434000 -- (-602.160) (-602.537) (-600.333) [-601.160] * (-603.871) [-602.466] (-601.538) (-600.759) -- 0:00:33
434500 -- (-604.186) (-600.218) [-600.896] (-602.438) * (-601.796) [-603.000] (-602.768) (-600.991) -- 0:00:33
435000 -- [-602.422] (-604.134) (-603.157) (-602.482) * (-602.742) (-604.003) [-602.660] (-602.307) -- 0:00:35
Average standard deviation of split frequencies: 0.012366
435500 -- (-603.202) (-603.038) [-600.131] (-604.301) * (-604.237) (-602.506) (-603.207) [-606.091] -- 0:00:34
436000 -- (-606.480) (-602.171) (-602.636) [-600.257] * (-602.614) [-601.001] (-602.882) (-601.659) -- 0:00:34
436500 -- (-607.741) [-604.981] (-601.940) (-602.684) * (-602.818) (-602.228) [-604.396] (-600.105) -- 0:00:34
437000 -- (-604.653) [-601.681] (-602.943) (-601.454) * (-602.266) (-605.143) [-605.193] (-603.120) -- 0:00:34
437500 -- (-602.949) (-601.147) [-602.182] (-601.890) * (-604.081) (-601.976) [-604.356] (-603.085) -- 0:00:34
438000 -- (-602.145) (-601.115) [-603.321] (-600.725) * (-605.146) (-603.051) [-600.250] (-604.007) -- 0:00:34
438500 -- [-604.935] (-602.607) (-602.065) (-603.730) * (-603.089) (-601.443) [-600.116] (-605.114) -- 0:00:34
439000 -- (-601.059) (-604.457) (-601.456) [-602.142] * [-601.048] (-600.940) (-600.831) (-600.016) -- 0:00:34
439500 -- (-602.817) (-601.661) (-601.771) [-601.066] * [-601.891] (-601.465) (-604.156) (-602.993) -- 0:00:34
440000 -- (-601.005) (-602.189) (-601.190) [-600.998] * (-600.988) (-604.175) (-603.040) [-603.317] -- 0:00:34
Average standard deviation of split frequencies: 0.012770
440500 -- (-601.331) (-607.139) [-602.548] (-602.136) * (-601.104) (-604.693) (-602.492) [-601.230] -- 0:00:34
441000 -- (-601.647) (-605.227) [-602.835] (-601.623) * (-602.626) (-600.335) [-604.400] (-601.455) -- 0:00:34
441500 -- (-604.565) (-607.994) [-600.855] (-601.328) * [-600.863] (-602.076) (-600.319) (-604.382) -- 0:00:34
442000 -- (-605.837) [-601.364] (-600.539) (-600.604) * (-602.668) (-600.514) [-601.427] (-602.081) -- 0:00:34
442500 -- (-600.799) (-603.695) (-600.608) [-602.347] * (-602.438) (-603.202) [-601.427] (-601.078) -- 0:00:34
443000 -- (-603.864) (-601.601) (-601.622) [-600.896] * (-613.090) (-607.763) [-605.379] (-602.080) -- 0:00:33
443500 -- (-605.791) [-601.004] (-602.247) (-603.586) * (-605.225) (-605.621) [-601.730] (-604.316) -- 0:00:33
444000 -- [-603.526] (-601.971) (-603.661) (-602.934) * (-600.749) (-603.825) (-603.385) [-603.573] -- 0:00:33
444500 -- (-602.349) [-600.760] (-602.353) (-602.173) * (-601.195) (-604.484) (-603.401) [-602.478] -- 0:00:33
445000 -- (-601.603) (-600.819) [-600.619] (-604.228) * (-604.575) (-605.982) [-603.585] (-601.874) -- 0:00:33
Average standard deviation of split frequencies: 0.012684
445500 -- (-603.972) (-602.228) [-600.115] (-602.699) * (-602.531) [-605.757] (-605.182) (-600.568) -- 0:00:33
446000 -- (-600.897) (-604.218) [-601.180] (-600.419) * (-602.048) (-605.226) (-608.101) [-603.919] -- 0:00:33
446500 -- [-601.704] (-603.232) (-601.555) (-601.966) * (-606.063) (-609.493) (-608.153) [-603.176] -- 0:00:33
447000 -- (-603.712) [-600.314] (-600.478) (-605.755) * (-605.569) (-602.128) [-601.867] (-603.014) -- 0:00:33
447500 -- (-601.964) (-603.060) (-601.105) [-604.321] * (-606.413) (-604.670) [-601.240] (-604.074) -- 0:00:33
448000 -- [-605.300] (-603.515) (-601.383) (-600.726) * (-605.586) [-600.715] (-603.389) (-601.745) -- 0:00:33
448500 -- (-608.589) (-603.810) [-600.713] (-601.455) * (-604.161) (-605.671) (-601.175) [-602.009] -- 0:00:33
449000 -- [-602.988] (-601.837) (-602.424) (-601.791) * [-601.481] (-602.964) (-602.946) (-602.224) -- 0:00:33
449500 -- (-601.740) (-602.474) (-605.180) [-601.069] * [-603.700] (-600.497) (-602.612) (-604.239) -- 0:00:33
450000 -- (-600.456) (-604.074) [-601.679] (-604.696) * (-601.333) [-600.453] (-606.259) (-601.010) -- 0:00:33
Average standard deviation of split frequencies: 0.013206
450500 -- (-600.404) (-600.576) (-600.910) [-603.829] * (-600.376) (-600.167) (-605.166) [-601.675] -- 0:00:32
451000 -- (-601.710) (-601.003) [-604.716] (-604.870) * (-603.121) (-601.556) (-602.371) [-601.170] -- 0:00:32
451500 -- [-600.822] (-603.824) (-601.923) (-601.822) * [-601.489] (-607.392) (-604.356) (-602.919) -- 0:00:32
452000 -- (-601.878) (-603.869) [-603.345] (-601.466) * [-601.583] (-601.280) (-604.086) (-601.028) -- 0:00:33
452500 -- (-605.471) (-604.359) [-600.695] (-602.866) * (-600.616) (-606.511) [-602.479] (-601.755) -- 0:00:33
453000 -- (-603.303) (-602.127) [-602.996] (-602.754) * (-600.405) [-606.115] (-600.932) (-600.652) -- 0:00:33
453500 -- (-602.190) (-602.611) (-603.571) [-602.245] * [-602.948] (-607.414) (-600.755) (-601.165) -- 0:00:33
454000 -- (-600.994) [-603.406] (-601.002) (-600.732) * [-604.501] (-602.829) (-602.920) (-602.534) -- 0:00:33
454500 -- [-604.608] (-605.964) (-600.585) (-601.409) * (-601.921) (-600.969) (-603.221) [-600.638] -- 0:00:33
455000 -- (-604.562) (-600.997) [-604.754] (-601.861) * [-601.486] (-602.960) (-605.594) (-603.581) -- 0:00:33
Average standard deviation of split frequencies: 0.013504
455500 -- [-602.741] (-602.699) (-602.528) (-604.277) * (-601.462) (-603.275) (-603.726) [-602.112] -- 0:00:33
456000 -- (-606.688) (-601.832) (-601.858) [-603.715] * [-601.637] (-600.604) (-602.365) (-603.444) -- 0:00:33
456500 -- (-602.736) (-601.942) [-603.029] (-602.226) * (-600.598) [-601.603] (-603.059) (-603.951) -- 0:00:33
457000 -- (-602.157) (-604.294) (-601.882) [-602.321] * (-600.370) (-601.771) [-600.106] (-604.085) -- 0:00:33
457500 -- (-600.678) [-600.456] (-604.519) (-604.406) * (-602.417) [-601.687] (-600.436) (-601.464) -- 0:00:33
458000 -- (-604.641) [-600.719] (-600.818) (-603.480) * (-603.985) (-601.263) [-604.348] (-602.105) -- 0:00:33
458500 -- [-602.311] (-602.323) (-605.420) (-609.015) * (-600.360) (-603.542) [-600.837] (-600.670) -- 0:00:33
459000 -- (-602.494) (-603.364) (-601.271) [-604.165] * (-606.002) (-607.153) (-601.742) [-604.234] -- 0:00:33
459500 -- (-607.430) [-603.331] (-600.298) (-603.330) * (-601.110) (-601.002) [-600.704] (-604.000) -- 0:00:32
460000 -- (-602.917) [-604.164] (-602.888) (-605.561) * [-601.604] (-600.950) (-600.246) (-602.160) -- 0:00:32
Average standard deviation of split frequencies: 0.013879
460500 -- (-601.895) (-603.500) [-600.776] (-601.639) * (-602.983) (-603.260) (-601.446) [-603.491] -- 0:00:32
461000 -- (-600.500) (-601.627) [-602.221] (-602.388) * (-603.662) (-602.413) (-603.770) [-602.607] -- 0:00:32
461500 -- (-602.250) [-600.557] (-601.852) (-602.498) * [-600.066] (-601.343) (-602.881) (-600.950) -- 0:00:32
462000 -- (-600.478) (-601.107) (-606.084) [-600.680] * (-602.259) [-600.768] (-603.946) (-602.137) -- 0:00:32
462500 -- [-601.055] (-600.609) (-602.577) (-600.340) * (-600.354) [-601.124] (-602.608) (-600.908) -- 0:00:32
463000 -- (-599.949) [-601.411] (-601.672) (-603.669) * [-602.508] (-603.317) (-601.565) (-601.693) -- 0:00:32
463500 -- (-600.450) (-601.650) [-602.863] (-602.921) * (-601.875) (-601.755) (-606.026) [-604.203] -- 0:00:32
464000 -- (-600.943) (-602.110) [-600.840] (-600.116) * (-602.832) [-602.301] (-602.344) (-602.240) -- 0:00:32
464500 -- (-602.224) (-600.664) [-601.695] (-600.438) * (-602.645) (-602.301) [-600.517] (-601.713) -- 0:00:32
465000 -- [-603.458] (-601.037) (-601.890) (-600.513) * (-602.002) (-600.929) (-600.735) [-601.375] -- 0:00:32
Average standard deviation of split frequencies: 0.013909
465500 -- [-605.098] (-601.378) (-601.208) (-603.848) * (-602.837) (-603.532) [-600.981] (-600.460) -- 0:00:32
466000 -- [-601.180] (-606.347) (-601.286) (-602.292) * (-602.794) (-602.574) (-605.213) [-599.979] -- 0:00:32
466500 -- [-601.917] (-602.892) (-601.522) (-601.149) * (-603.607) (-601.336) (-604.518) [-600.111] -- 0:00:32
467000 -- (-600.583) (-601.639) (-601.107) [-601.718] * (-606.446) (-604.853) (-605.708) [-600.598] -- 0:00:31
467500 -- [-601.854] (-602.532) (-603.424) (-601.636) * (-602.895) (-603.316) (-606.075) [-601.234] -- 0:00:31
468000 -- [-604.373] (-602.866) (-604.343) (-600.348) * [-602.867] (-603.500) (-602.135) (-602.830) -- 0:00:31
468500 -- (-602.696) [-600.417] (-606.664) (-602.570) * [-608.194] (-602.474) (-600.201) (-602.934) -- 0:00:32
469000 -- (-605.155) [-600.091] (-601.883) (-601.802) * (-602.352) (-605.502) [-601.851] (-600.837) -- 0:00:32
469500 -- (-601.576) (-603.546) [-603.022] (-602.501) * [-604.571] (-601.391) (-604.261) (-603.750) -- 0:00:32
470000 -- (-605.469) (-602.283) (-601.776) [-601.074] * (-604.202) [-605.878] (-604.600) (-602.452) -- 0:00:32
Average standard deviation of split frequencies: 0.013208
470500 -- (-603.100) [-602.112] (-603.733) (-602.166) * (-601.518) [-602.763] (-603.602) (-601.625) -- 0:00:32
471000 -- (-603.084) [-604.476] (-603.039) (-604.230) * [-603.735] (-601.749) (-601.625) (-605.709) -- 0:00:32
471500 -- (-601.636) [-602.749] (-603.355) (-602.777) * (-601.691) (-600.489) [-600.341] (-607.198) -- 0:00:32
472000 -- (-605.312) (-601.633) (-602.703) [-601.223] * (-606.820) [-600.490] (-601.642) (-602.984) -- 0:00:32
472500 -- [-601.418] (-600.645) (-604.873) (-604.496) * [-600.394] (-601.321) (-600.355) (-605.480) -- 0:00:32
473000 -- [-600.859] (-602.399) (-605.014) (-600.996) * (-601.690) (-605.156) [-600.177] (-601.371) -- 0:00:32
473500 -- (-602.401) (-601.700) (-600.615) [-601.478] * (-604.544) (-601.373) (-601.376) [-601.524] -- 0:00:32
474000 -- (-601.336) [-600.879] (-601.910) (-601.689) * (-603.131) (-601.682) (-601.141) [-600.290] -- 0:00:32
474500 -- (-603.103) (-602.620) [-604.140] (-601.330) * (-602.805) (-602.665) (-602.562) [-600.156] -- 0:00:32
475000 -- [-603.333] (-608.416) (-603.348) (-601.833) * (-605.382) (-601.839) [-604.191] (-600.091) -- 0:00:32
Average standard deviation of split frequencies: 0.012936
475500 -- (-600.764) [-605.590] (-602.013) (-603.121) * (-604.635) (-601.514) [-602.766] (-602.394) -- 0:00:31
476000 -- (-600.682) (-602.500) (-602.924) [-602.189] * (-605.687) (-600.395) [-604.862] (-602.900) -- 0:00:31
476500 -- [-600.265] (-603.082) (-600.789) (-602.219) * (-601.514) (-600.763) [-601.965] (-600.471) -- 0:00:31
477000 -- (-601.004) [-602.030] (-600.362) (-601.734) * [-601.158] (-601.111) (-601.523) (-600.971) -- 0:00:31
477500 -- (-602.280) (-602.323) [-601.369] (-602.383) * [-600.171] (-606.042) (-602.390) (-602.241) -- 0:00:31
478000 -- [-604.766] (-604.945) (-605.388) (-604.858) * (-600.789) [-602.858] (-601.768) (-600.330) -- 0:00:31
478500 -- (-603.358) (-603.017) (-601.586) [-601.112] * (-605.598) (-603.017) (-601.429) [-603.072] -- 0:00:31
479000 -- (-600.405) (-602.197) [-601.839] (-602.741) * [-602.394] (-602.514) (-602.511) (-603.860) -- 0:00:31
479500 -- [-602.594] (-604.100) (-604.443) (-605.058) * (-605.264) (-601.990) (-601.346) [-602.327] -- 0:00:31
480000 -- (-603.983) (-603.268) (-605.143) [-602.176] * (-602.603) (-602.844) (-601.815) [-601.646] -- 0:00:31
Average standard deviation of split frequencies: 0.013179
480500 -- (-601.945) [-600.945] (-603.350) (-601.790) * (-602.871) [-602.896] (-603.208) (-607.538) -- 0:00:31
481000 -- [-601.488] (-602.332) (-606.211) (-601.439) * (-601.986) (-601.441) (-602.288) [-602.952] -- 0:00:31
481500 -- (-600.565) (-604.465) [-600.183] (-600.801) * (-601.862) (-602.598) [-601.750] (-602.854) -- 0:00:31
482000 -- [-600.370] (-602.660) (-600.266) (-602.916) * (-602.061) (-603.493) [-604.576] (-607.050) -- 0:00:31
482500 -- (-608.883) [-605.535] (-608.146) (-601.223) * (-605.082) [-602.498] (-601.239) (-603.670) -- 0:00:31
483000 -- [-602.966] (-602.447) (-602.537) (-602.218) * (-603.918) (-601.740) (-602.072) [-604.193] -- 0:00:31
483500 -- (-604.759) (-602.250) (-601.754) [-602.937] * (-607.519) [-602.622] (-602.361) (-602.159) -- 0:00:30
484000 -- (-602.012) [-601.345] (-604.515) (-603.957) * (-600.999) (-601.108) (-602.582) [-603.849] -- 0:00:30
484500 -- (-601.124) [-602.220] (-602.183) (-603.673) * (-600.867) (-602.897) [-610.147] (-600.984) -- 0:00:30
485000 -- (-600.595) (-601.205) (-603.297) [-604.189] * (-603.165) (-606.463) (-614.946) [-601.309] -- 0:00:30
Average standard deviation of split frequencies: 0.012913
485500 -- (-600.550) (-600.907) (-601.113) [-604.389] * [-602.773] (-602.463) (-602.147) (-601.709) -- 0:00:31
486000 -- [-600.440] (-601.038) (-604.341) (-609.632) * (-603.067) [-601.772] (-600.739) (-600.925) -- 0:00:31
486500 -- (-602.986) (-600.635) (-603.180) [-600.294] * (-601.240) (-609.179) (-604.419) [-601.012] -- 0:00:31
487000 -- (-602.327) [-600.232] (-603.409) (-600.086) * [-603.542] (-601.979) (-602.601) (-600.860) -- 0:00:31
487500 -- [-602.001] (-601.972) (-606.445) (-600.318) * (-601.699) (-601.755) (-603.711) [-601.696] -- 0:00:31
488000 -- [-606.780] (-602.756) (-602.362) (-602.904) * (-601.486) (-602.140) [-604.956] (-600.917) -- 0:00:31
488500 -- (-601.454) (-600.632) [-600.374] (-606.952) * [-606.209] (-600.897) (-604.691) (-600.785) -- 0:00:31
489000 -- (-601.222) (-604.452) [-601.491] (-600.648) * [-602.721] (-604.105) (-600.730) (-607.184) -- 0:00:31
489500 -- [-600.028] (-600.188) (-604.202) (-605.970) * (-603.832) (-604.030) (-603.373) [-605.032] -- 0:00:31
490000 -- (-602.735) [-601.581] (-602.074) (-601.178) * (-600.585) [-602.279] (-602.768) (-602.405) -- 0:00:31
Average standard deviation of split frequencies: 0.013090
490500 -- (-601.887) (-603.030) [-600.696] (-600.443) * (-603.846) (-602.913) (-601.185) [-601.543] -- 0:00:31
491000 -- (-603.052) (-602.795) [-600.551] (-600.282) * (-600.366) [-605.880] (-603.905) (-601.484) -- 0:00:31
491500 -- (-600.113) [-603.694] (-603.129) (-601.054) * (-602.667) (-603.600) [-602.056] (-603.796) -- 0:00:31
492000 -- [-601.724] (-604.386) (-600.251) (-600.393) * (-600.984) [-600.487] (-600.884) (-604.805) -- 0:00:30
492500 -- [-603.353] (-600.665) (-605.008) (-604.864) * (-603.449) [-600.555] (-602.018) (-602.711) -- 0:00:30
493000 -- (-602.765) [-599.986] (-604.125) (-600.054) * (-606.557) (-600.484) [-603.034] (-602.095) -- 0:00:30
493500 -- [-605.613] (-601.999) (-605.078) (-602.647) * (-601.788) [-602.031] (-605.040) (-602.012) -- 0:00:30
494000 -- (-606.695) (-599.875) (-606.181) [-602.442] * (-602.517) (-602.163) [-601.313] (-608.105) -- 0:00:30
494500 -- (-604.709) (-601.429) (-602.563) [-600.647] * (-604.652) (-605.655) (-603.535) [-602.331] -- 0:00:30
495000 -- (-601.764) (-600.039) (-605.944) [-601.238] * (-601.449) (-603.426) (-601.612) [-605.914] -- 0:00:30
Average standard deviation of split frequencies: 0.012652
495500 -- (-600.220) (-601.596) [-600.620] (-602.440) * (-602.231) (-603.946) [-606.595] (-601.517) -- 0:00:30
496000 -- [-603.570] (-601.900) (-600.376) (-602.006) * (-601.377) [-604.556] (-602.924) (-601.331) -- 0:00:30
496500 -- (-600.945) [-601.934] (-600.212) (-601.079) * (-601.753) [-602.901] (-602.914) (-601.888) -- 0:00:30
497000 -- [-601.099] (-601.672) (-604.117) (-600.490) * (-603.437) (-601.239) [-602.296] (-601.733) -- 0:00:30
497500 -- (-601.214) (-602.495) (-602.756) [-602.176] * [-603.892] (-602.310) (-604.742) (-601.993) -- 0:00:30
498000 -- (-602.672) [-602.164] (-604.297) (-605.830) * [-602.397] (-602.275) (-602.656) (-600.863) -- 0:00:30
498500 -- (-601.754) (-601.696) (-601.993) [-601.746] * (-601.313) (-600.961) [-606.485] (-601.848) -- 0:00:30
499000 -- [-605.325] (-603.709) (-603.603) (-601.719) * (-600.973) (-606.264) (-602.710) [-601.008] -- 0:00:30
499500 -- (-602.105) (-601.566) (-602.340) [-601.580] * (-602.397) (-606.303) (-601.620) [-602.266] -- 0:00:30
500000 -- (-600.630) [-600.816] (-607.969) (-602.557) * [-602.109] (-603.816) (-601.543) (-601.699) -- 0:00:30
Average standard deviation of split frequencies: 0.012476
500500 -- (-601.489) [-602.994] (-607.331) (-604.155) * (-602.723) (-602.372) (-601.540) [-601.911] -- 0:00:29
501000 -- (-601.216) [-602.445] (-602.206) (-600.317) * (-601.969) [-601.749] (-602.390) (-602.509) -- 0:00:29
501500 -- (-600.406) (-603.235) (-602.279) [-600.995] * (-606.468) [-601.227] (-601.836) (-602.185) -- 0:00:29
502000 -- (-600.878) (-602.643) (-601.347) [-601.779] * (-605.385) (-601.305) (-604.803) [-600.780] -- 0:00:30
502500 -- [-603.021] (-604.064) (-602.660) (-601.526) * [-600.983] (-603.511) (-605.106) (-600.176) -- 0:00:30
503000 -- (-600.716) (-601.569) (-601.479) [-601.590] * (-603.167) (-601.598) [-600.794] (-600.121) -- 0:00:30
503500 -- (-600.489) [-601.148] (-600.844) (-606.032) * (-604.702) (-600.330) [-600.668] (-600.865) -- 0:00:30
504000 -- (-601.428) (-602.008) (-604.179) [-604.972] * [-603.690] (-602.560) (-601.136) (-600.857) -- 0:00:30
504500 -- (-604.324) (-601.099) (-605.905) [-601.127] * (-605.227) (-603.269) (-602.364) [-600.205] -- 0:00:30
505000 -- (-604.115) [-603.993] (-602.886) (-600.781) * (-601.127) (-602.621) [-602.813] (-601.159) -- 0:00:30
Average standard deviation of split frequencies: 0.012868
505500 -- (-607.683) (-602.097) [-603.122] (-603.923) * (-600.275) (-605.509) (-601.294) [-603.571] -- 0:00:30
506000 -- [-601.801] (-600.998) (-602.182) (-605.168) * (-601.397) (-600.168) [-605.024] (-602.253) -- 0:00:30
506500 -- [-602.245] (-600.549) (-601.476) (-601.364) * [-601.746] (-602.756) (-611.375) (-601.502) -- 0:00:30
507000 -- (-602.215) [-602.030] (-604.369) (-602.172) * (-600.552) (-603.201) [-600.537] (-604.276) -- 0:00:30
507500 -- (-602.950) (-600.438) [-601.220] (-603.047) * (-604.346) (-601.549) [-601.325] (-604.683) -- 0:00:30
508000 -- (-603.392) (-600.140) (-601.257) [-606.780] * [-603.269] (-600.277) (-601.596) (-604.504) -- 0:00:30
508500 -- (-607.779) [-601.466] (-614.887) (-603.587) * (-601.384) [-600.276] (-602.354) (-602.370) -- 0:00:29
509000 -- (-601.160) [-600.336] (-605.877) (-602.491) * [-600.184] (-605.659) (-603.649) (-601.818) -- 0:00:29
509500 -- (-604.063) (-605.461) [-600.783] (-602.317) * [-600.731] (-605.500) (-601.867) (-600.657) -- 0:00:29
510000 -- (-600.209) [-603.146] (-602.041) (-600.782) * [-605.764] (-605.401) (-601.237) (-604.771) -- 0:00:29
Average standard deviation of split frequencies: 0.012462
510500 -- (-600.219) (-603.081) (-601.628) [-602.812] * (-601.633) (-603.344) [-603.895] (-601.634) -- 0:00:29
511000 -- (-601.249) [-604.177] (-602.643) (-605.295) * (-600.808) (-603.986) [-604.252] (-603.138) -- 0:00:29
511500 -- (-602.006) [-604.268] (-602.814) (-607.642) * (-605.515) (-602.524) [-601.931] (-602.048) -- 0:00:29
512000 -- (-602.558) (-603.973) [-601.798] (-605.041) * [-603.761] (-601.052) (-604.362) (-601.270) -- 0:00:29
512500 -- (-601.728) (-600.844) [-602.925] (-601.286) * (-601.071) (-600.843) [-603.722] (-603.480) -- 0:00:29
513000 -- (-602.548) (-602.461) (-600.578) [-601.087] * [-603.111] (-605.328) (-601.634) (-602.693) -- 0:00:29
513500 -- [-605.762] (-606.123) (-601.557) (-605.686) * (-601.484) [-601.429] (-605.788) (-605.883) -- 0:00:29
514000 -- [-599.981] (-600.321) (-601.311) (-606.320) * (-601.564) (-605.271) [-601.594] (-604.124) -- 0:00:29
514500 -- [-601.621] (-602.908) (-601.567) (-606.636) * (-601.445) (-602.575) [-603.259] (-603.375) -- 0:00:29
515000 -- [-601.343] (-604.269) (-603.273) (-601.284) * (-602.694) [-605.445] (-602.549) (-603.099) -- 0:00:29
Average standard deviation of split frequencies: 0.012105
515500 -- (-600.384) [-601.266] (-603.359) (-603.145) * (-610.166) (-602.107) (-602.724) [-602.934] -- 0:00:29
516000 -- (-603.475) (-601.092) [-601.455] (-600.662) * (-604.005) (-602.947) [-601.536] (-602.998) -- 0:00:29
516500 -- (-604.157) (-600.960) (-600.945) [-604.474] * (-601.595) [-602.947] (-601.853) (-601.608) -- 0:00:29
517000 -- (-601.840) (-600.814) (-601.193) [-602.535] * (-602.361) (-601.435) (-604.757) [-601.189] -- 0:00:28
517500 -- (-607.788) [-603.728] (-601.854) (-603.497) * [-599.957] (-602.781) (-601.337) (-600.327) -- 0:00:28
518000 -- [-601.644] (-604.619) (-602.388) (-607.475) * (-603.029) (-603.047) (-603.369) [-600.154] -- 0:00:29
518500 -- (-603.204) (-601.663) [-600.937] (-606.762) * (-603.760) [-603.075] (-600.919) (-601.552) -- 0:00:29
519000 -- [-603.673] (-603.443) (-601.134) (-603.245) * [-601.284] (-602.829) (-604.322) (-601.489) -- 0:00:29
519500 -- (-601.646) [-601.594] (-601.117) (-601.604) * (-602.628) (-605.307) [-607.859] (-600.960) -- 0:00:29
520000 -- (-602.731) (-603.486) [-600.125] (-602.985) * (-605.130) [-605.014] (-603.918) (-602.041) -- 0:00:29
Average standard deviation of split frequencies: 0.011408
520500 -- (-602.897) [-604.368] (-600.332) (-602.511) * [-602.875] (-600.103) (-601.267) (-600.491) -- 0:00:29
521000 -- (-602.144) (-605.104) [-600.492] (-600.754) * [-603.821] (-602.651) (-604.142) (-601.249) -- 0:00:29
521500 -- (-604.030) (-601.110) [-602.119] (-601.624) * (-603.650) (-611.456) [-603.352] (-603.826) -- 0:00:29
522000 -- [-602.915] (-600.934) (-607.106) (-600.887) * [-600.756] (-606.727) (-601.035) (-600.094) -- 0:00:29
522500 -- [-601.286] (-603.062) (-604.586) (-603.436) * (-601.212) (-605.506) (-603.231) [-601.311] -- 0:00:29
523000 -- (-604.299) (-605.347) [-602.104] (-600.806) * (-602.233) (-602.747) (-605.911) [-603.565] -- 0:00:29
523500 -- (-601.579) (-602.079) [-604.243] (-606.897) * (-601.781) (-604.401) [-601.868] (-601.663) -- 0:00:29
524000 -- (-602.173) (-601.510) [-604.542] (-604.875) * [-603.307] (-600.260) (-602.599) (-602.183) -- 0:00:29
524500 -- (-604.381) (-602.492) [-605.436] (-602.379) * (-600.623) [-600.452] (-601.217) (-603.969) -- 0:00:29
525000 -- (-604.837) (-602.350) [-606.995] (-601.195) * (-600.294) (-603.875) [-605.543] (-603.745) -- 0:00:28
Average standard deviation of split frequencies: 0.010695
525500 -- (-600.777) (-602.022) (-605.415) [-601.302] * [-600.240] (-603.721) (-606.705) (-603.934) -- 0:00:28
526000 -- (-601.759) [-602.583] (-603.768) (-601.420) * (-602.440) (-602.712) [-602.635] (-604.916) -- 0:00:28
526500 -- (-601.252) (-601.102) (-604.943) [-600.341] * (-605.705) (-600.912) (-604.031) [-602.607] -- 0:00:28
527000 -- (-602.411) [-603.499] (-602.251) (-600.533) * (-601.445) [-600.479] (-603.360) (-605.545) -- 0:00:28
527500 -- (-605.869) (-604.816) [-603.134] (-605.009) * [-602.640] (-601.062) (-602.785) (-605.176) -- 0:00:28
528000 -- (-605.780) (-601.388) [-600.908] (-601.181) * (-600.007) (-603.906) [-600.362] (-600.868) -- 0:00:28
528500 -- (-601.681) (-600.679) [-603.547] (-602.120) * [-600.927] (-601.386) (-601.077) (-603.297) -- 0:00:28
529000 -- [-601.241] (-602.500) (-603.547) (-603.866) * (-604.683) [-602.702] (-603.661) (-601.173) -- 0:00:28
529500 -- (-602.717) (-603.867) [-601.341] (-602.976) * (-602.202) (-601.165) [-600.781] (-601.188) -- 0:00:28
530000 -- [-600.155] (-600.776) (-602.305) (-604.531) * [-600.856] (-602.098) (-601.847) (-602.548) -- 0:00:28
Average standard deviation of split frequencies: 0.010956
530500 -- [-602.715] (-601.948) (-603.492) (-602.003) * (-601.410) (-600.842) [-601.818] (-601.980) -- 0:00:28
531000 -- (-601.614) (-601.907) [-603.236] (-601.753) * (-601.859) (-600.539) (-602.610) [-601.252] -- 0:00:28
531500 -- (-607.972) (-601.200) (-604.510) [-602.327] * (-605.141) (-601.882) [-603.274] (-602.200) -- 0:00:28
532000 -- [-603.561] (-605.141) (-602.943) (-602.360) * [-602.824] (-604.020) (-605.882) (-602.930) -- 0:00:28
532500 -- [-602.925] (-604.813) (-604.161) (-604.529) * (-605.364) (-603.067) [-601.999] (-601.692) -- 0:00:28
533000 -- (-604.036) (-604.362) [-605.915] (-602.988) * (-603.353) (-604.023) [-602.909] (-600.883) -- 0:00:28
533500 -- (-602.658) (-601.442) [-606.916] (-605.303) * (-601.664) [-601.348] (-604.276) (-601.720) -- 0:00:27
534000 -- (-601.216) [-602.467] (-602.031) (-604.601) * (-601.553) (-608.777) [-602.443] (-602.307) -- 0:00:28
534500 -- (-603.774) (-602.179) (-600.909) [-601.235] * (-601.700) [-600.187] (-604.577) (-600.693) -- 0:00:28
535000 -- (-605.098) (-603.659) [-600.744] (-603.236) * (-603.959) (-605.274) (-601.727) [-603.153] -- 0:00:28
Average standard deviation of split frequencies: 0.010847
535500 -- (-602.361) [-605.506] (-603.964) (-605.187) * (-603.998) [-604.176] (-603.617) (-608.045) -- 0:00:28
536000 -- [-601.435] (-603.974) (-604.458) (-605.149) * (-604.567) (-602.259) [-602.349] (-603.928) -- 0:00:28
536500 -- (-600.949) (-602.826) [-600.515] (-604.422) * (-600.333) (-601.850) [-602.273] (-604.912) -- 0:00:28
537000 -- (-601.239) [-601.260] (-600.046) (-607.382) * (-600.274) [-602.277] (-603.441) (-606.300) -- 0:00:28
537500 -- (-601.381) [-600.622] (-601.743) (-605.152) * [-600.572] (-602.001) (-602.138) (-603.982) -- 0:00:28
538000 -- (-602.953) [-604.615] (-600.844) (-603.319) * (-601.192) (-603.257) [-601.132] (-601.556) -- 0:00:28
538500 -- (-600.019) [-602.095] (-602.959) (-605.452) * (-601.302) (-603.727) (-600.874) [-600.476] -- 0:00:28
539000 -- (-603.248) [-602.761] (-602.072) (-604.948) * (-605.504) (-602.663) (-600.565) [-605.022] -- 0:00:28
539500 -- (-604.609) (-602.772) [-600.843] (-601.218) * (-609.309) (-603.318) [-600.822] (-600.813) -- 0:00:28
540000 -- (-600.769) [-602.675] (-601.496) (-603.545) * (-604.942) (-603.463) [-605.267] (-601.414) -- 0:00:28
Average standard deviation of split frequencies: 0.010870
540500 -- [-603.804] (-603.176) (-601.944) (-600.573) * [-603.727] (-601.584) (-603.824) (-604.532) -- 0:00:28
541000 -- [-604.053] (-602.938) (-603.255) (-601.840) * (-602.451) (-601.481) (-603.465) [-603.847] -- 0:00:27
541500 -- [-601.740] (-604.722) (-604.197) (-602.144) * (-601.268) (-603.259) (-603.490) [-601.755] -- 0:00:27
542000 -- (-603.559) [-601.767] (-603.952) (-601.363) * (-600.891) (-602.118) (-601.888) [-601.695] -- 0:00:27
542500 -- (-606.991) (-601.671) (-601.221) [-604.206] * (-600.961) (-603.247) [-607.188] (-602.165) -- 0:00:27
543000 -- (-600.703) (-602.433) [-602.231] (-603.683) * [-602.794] (-604.410) (-603.776) (-604.472) -- 0:00:27
543500 -- [-601.034] (-601.352) (-600.614) (-603.522) * (-600.734) [-600.882] (-603.091) (-601.976) -- 0:00:27
544000 -- (-600.949) (-603.502) [-601.347] (-602.254) * (-601.244) [-601.297] (-605.988) (-600.984) -- 0:00:27
544500 -- [-600.588] (-606.291) (-601.466) (-600.496) * [-605.187] (-602.871) (-600.824) (-600.512) -- 0:00:27
545000 -- (-602.005) (-601.124) (-601.160) [-601.839] * [-601.274] (-600.589) (-603.801) (-603.772) -- 0:00:27
Average standard deviation of split frequencies: 0.010576
545500 -- (-601.414) (-603.123) (-603.542) [-603.995] * [-600.831] (-600.520) (-605.234) (-603.295) -- 0:00:27
546000 -- (-602.764) [-602.715] (-614.122) (-600.760) * (-601.266) (-603.556) (-601.131) [-601.946] -- 0:00:27
546500 -- (-604.589) [-606.159] (-601.388) (-601.455) * (-603.677) (-601.046) (-602.723) [-601.360] -- 0:00:27
547000 -- (-608.058) (-601.268) (-600.947) [-600.607] * (-602.938) (-601.737) (-607.800) [-602.904] -- 0:00:27
547500 -- (-600.507) (-600.992) (-601.778) [-602.964] * (-603.109) (-601.378) [-607.307] (-601.583) -- 0:00:27
548000 -- (-601.928) [-600.760] (-603.075) (-601.864) * (-604.960) (-601.690) (-601.149) [-600.670] -- 0:00:27
548500 -- (-601.013) (-600.471) (-603.857) [-601.254] * (-607.883) [-601.250] (-600.799) (-603.979) -- 0:00:27
549000 -- (-601.833) [-600.128] (-606.351) (-601.995) * (-605.409) [-599.980] (-601.079) (-604.955) -- 0:00:27
549500 -- (-599.997) (-601.153) (-607.010) [-601.317] * (-602.598) (-601.094) (-602.098) [-602.432] -- 0:00:27
550000 -- [-600.157] (-600.939) (-609.568) (-602.029) * (-600.580) (-604.190) [-601.773] (-600.995) -- 0:00:27
Average standard deviation of split frequencies: 0.010166
550500 -- (-604.363) [-601.870] (-606.480) (-603.080) * (-602.671) (-602.627) [-603.024] (-605.027) -- 0:00:27
551000 -- (-601.077) (-600.424) (-600.334) [-603.351] * (-600.255) [-605.865] (-606.748) (-601.072) -- 0:00:27
551500 -- (-600.721) (-602.330) (-600.670) [-600.116] * (-600.195) (-605.081) (-607.158) [-600.308] -- 0:00:27
552000 -- [-603.713] (-600.189) (-603.933) (-605.170) * (-602.466) [-603.237] (-601.234) (-603.424) -- 0:00:27
552500 -- (-601.933) [-600.404] (-601.379) (-600.527) * (-601.468) (-602.277) (-602.119) [-601.326] -- 0:00:27
553000 -- (-603.428) (-602.979) [-601.463] (-600.764) * (-601.861) (-602.229) (-602.469) [-603.240] -- 0:00:27
553500 -- (-602.243) (-605.880) [-603.483] (-600.441) * [-600.984] (-601.434) (-606.526) (-606.060) -- 0:00:27
554000 -- (-601.354) (-603.852) [-603.457] (-602.669) * (-601.859) (-608.114) (-607.655) [-605.581] -- 0:00:27
554500 -- (-601.043) (-604.407) (-602.958) [-600.950] * (-602.596) (-607.171) [-600.512] (-603.223) -- 0:00:27
555000 -- [-600.562] (-603.384) (-601.375) (-605.016) * (-602.954) (-602.219) (-602.919) [-602.984] -- 0:00:27
Average standard deviation of split frequencies: 0.010280
555500 -- [-602.333] (-602.101) (-608.613) (-604.578) * (-602.084) (-600.462) [-601.578] (-600.420) -- 0:00:27
556000 -- [-603.094] (-604.449) (-603.477) (-602.741) * (-600.871) (-602.543) [-601.253] (-601.053) -- 0:00:27
556500 -- (-605.845) (-601.734) [-601.023] (-601.599) * (-600.755) (-603.988) (-602.873) [-602.534] -- 0:00:27
557000 -- (-604.718) (-601.866) [-604.043] (-600.120) * (-600.027) (-601.340) (-604.941) [-601.872] -- 0:00:27
557500 -- [-603.578] (-605.684) (-602.306) (-602.550) * (-600.388) (-601.629) [-603.060] (-601.308) -- 0:00:26
558000 -- (-601.120) (-601.589) (-603.691) [-600.255] * (-605.195) [-602.191] (-605.495) (-602.547) -- 0:00:26
558500 -- [-601.139] (-600.244) (-603.709) (-601.740) * (-603.512) [-603.001] (-602.003) (-600.897) -- 0:00:26
559000 -- (-602.509) [-602.321] (-603.365) (-603.559) * [-604.480] (-604.095) (-602.175) (-602.063) -- 0:00:26
559500 -- (-602.672) [-602.885] (-602.025) (-601.690) * (-602.514) [-602.681] (-602.441) (-601.135) -- 0:00:26
560000 -- (-606.449) (-602.044) [-602.948] (-601.015) * [-602.152] (-604.225) (-602.633) (-605.911) -- 0:00:26
Average standard deviation of split frequencies: 0.009722
560500 -- (-601.603) [-601.884] (-608.171) (-601.873) * (-601.383) (-602.527) (-603.355) [-605.600] -- 0:00:26
561000 -- [-603.720] (-601.003) (-608.806) (-604.691) * (-605.846) (-604.253) [-602.928] (-602.347) -- 0:00:26
561500 -- (-600.660) [-601.459] (-606.900) (-604.060) * (-606.847) [-601.424] (-602.889) (-600.235) -- 0:00:26
562000 -- (-600.985) [-604.361] (-600.945) (-603.655) * (-602.208) [-601.302] (-601.706) (-601.081) -- 0:00:26
562500 -- (-601.136) (-604.022) [-600.528] (-601.771) * (-602.304) [-601.148] (-601.298) (-602.211) -- 0:00:26
563000 -- (-603.884) (-602.031) [-601.197] (-600.718) * [-601.297] (-601.367) (-601.199) (-603.155) -- 0:00:26
563500 -- (-606.890) (-602.973) [-602.091] (-605.855) * (-601.247) (-601.741) (-604.094) [-603.149] -- 0:00:26
564000 -- (-602.640) (-600.863) [-602.674] (-603.702) * (-603.821) (-601.622) (-602.558) [-601.108] -- 0:00:26
564500 -- (-600.743) (-601.683) [-601.995] (-604.071) * (-601.929) [-601.738] (-600.844) (-600.979) -- 0:00:26
565000 -- (-600.511) (-604.516) (-603.073) [-600.657] * (-601.033) (-603.263) [-600.691] (-601.380) -- 0:00:26
Average standard deviation of split frequencies: 0.010046
565500 -- (-601.744) (-601.527) [-602.284] (-601.401) * (-604.087) (-601.316) [-602.704] (-607.811) -- 0:00:26
566000 -- (-601.388) (-603.508) [-602.389] (-602.012) * [-605.167] (-601.709) (-604.238) (-607.505) -- 0:00:26
566500 -- (-602.411) [-600.808] (-602.252) (-601.713) * (-601.560) (-602.284) [-604.643] (-601.435) -- 0:00:26
567000 -- (-604.261) (-600.887) [-603.138] (-600.938) * (-609.797) [-602.806] (-601.160) (-604.018) -- 0:00:26
567500 -- (-603.910) [-600.594] (-601.883) (-600.067) * (-601.479) [-600.792] (-601.005) (-605.773) -- 0:00:26
568000 -- (-601.550) [-602.062] (-612.861) (-602.345) * [-605.781] (-601.323) (-603.558) (-601.523) -- 0:00:26
568500 -- (-601.757) (-603.502) [-601.410] (-601.347) * (-602.035) (-602.592) [-600.944] (-606.592) -- 0:00:26
569000 -- (-601.660) [-602.597] (-601.586) (-600.821) * (-602.316) (-603.959) (-603.880) [-607.369] -- 0:00:26
569500 -- (-603.998) (-601.494) [-601.886] (-602.886) * (-601.555) [-605.748] (-602.065) (-603.305) -- 0:00:26
570000 -- [-602.365] (-601.466) (-601.462) (-602.002) * (-601.416) [-600.852] (-602.851) (-600.639) -- 0:00:26
Average standard deviation of split frequencies: 0.009706
570500 -- (-602.422) (-603.246) [-601.800] (-602.698) * [-601.691] (-607.229) (-603.389) (-600.810) -- 0:00:26
571000 -- (-601.407) [-600.556] (-600.871) (-602.691) * [-601.616] (-601.153) (-601.565) (-603.217) -- 0:00:26
571500 -- (-601.152) (-603.733) (-600.593) [-603.561] * (-603.499) [-602.664] (-602.983) (-604.690) -- 0:00:26
572000 -- [-601.550] (-602.617) (-601.204) (-605.205) * (-602.321) (-609.923) (-603.822) [-602.861] -- 0:00:26
572500 -- (-600.845) (-602.032) [-604.183] (-600.498) * [-602.681] (-603.917) (-602.731) (-601.953) -- 0:00:26
573000 -- [-603.457] (-602.965) (-601.553) (-601.980) * (-601.044) (-602.199) (-602.611) [-600.922] -- 0:00:26
573500 -- (-606.310) [-600.911] (-601.581) (-601.988) * (-601.616) (-600.432) [-603.167] (-600.298) -- 0:00:26
574000 -- (-603.739) (-602.600) [-602.108] (-604.111) * (-607.473) (-600.693) [-602.477] (-603.831) -- 0:00:25
574500 -- (-601.582) (-600.730) (-602.514) [-607.657] * [-603.210] (-601.675) (-601.717) (-601.380) -- 0:00:25
575000 -- (-602.432) (-603.310) [-602.696] (-600.586) * (-604.576) (-602.772) [-600.644] (-602.150) -- 0:00:25
Average standard deviation of split frequencies: 0.009514
575500 -- (-602.116) (-605.103) (-601.705) [-601.631] * (-602.044) (-603.825) [-601.317] (-602.160) -- 0:00:25
576000 -- (-602.121) (-602.107) (-600.622) [-601.922] * (-601.338) [-604.556] (-603.839) (-600.859) -- 0:00:25
576500 -- [-603.215] (-606.754) (-601.089) (-603.567) * (-603.048) (-604.420) [-601.930] (-601.786) -- 0:00:25
577000 -- (-602.320) (-602.993) [-601.598] (-603.061) * (-600.318) (-601.873) [-602.618] (-600.332) -- 0:00:25
577500 -- (-604.607) (-602.200) (-601.852) [-602.921] * [-601.129] (-600.551) (-600.654) (-600.588) -- 0:00:25
578000 -- (-601.864) [-601.217] (-601.165) (-604.234) * (-601.924) [-600.940] (-600.636) (-600.862) -- 0:00:25
578500 -- [-601.598] (-604.195) (-601.899) (-602.511) * (-601.007) (-600.844) (-601.221) [-601.536] -- 0:00:25
579000 -- (-604.529) (-605.192) [-601.009] (-604.377) * (-604.986) [-603.759] (-601.508) (-603.648) -- 0:00:25
579500 -- (-601.682) [-601.150] (-603.468) (-603.381) * (-603.881) (-606.014) (-600.379) [-600.585] -- 0:00:25
580000 -- (-604.439) (-601.628) [-603.534] (-600.527) * [-605.321] (-602.502) (-602.057) (-603.649) -- 0:00:25
Average standard deviation of split frequencies: 0.009691
580500 -- (-601.621) (-603.126) (-601.376) [-601.599] * (-605.001) (-601.212) [-602.017] (-602.694) -- 0:00:25
581000 -- (-601.437) [-603.847] (-602.484) (-600.082) * (-605.791) [-602.007] (-605.496) (-601.895) -- 0:00:25
581500 -- (-602.226) (-604.390) (-602.678) [-600.733] * (-600.967) (-602.659) [-602.168] (-602.261) -- 0:00:25
582000 -- (-601.431) (-603.780) (-606.778) [-603.594] * (-602.002) (-601.625) (-603.748) [-602.243] -- 0:00:25
582500 -- (-604.848) (-608.377) (-601.125) [-602.661] * [-600.731] (-605.624) (-601.398) (-601.287) -- 0:00:25
583000 -- (-602.018) [-600.751] (-602.188) (-601.826) * [-603.044] (-603.142) (-601.304) (-600.227) -- 0:00:25
583500 -- (-603.142) [-603.215] (-600.868) (-608.454) * (-603.055) [-601.248] (-608.939) (-601.647) -- 0:00:25
584000 -- (-605.145) (-601.561) [-601.499] (-601.002) * (-600.613) [-600.608] (-602.863) (-604.239) -- 0:00:25
584500 -- (-603.320) [-602.353] (-604.777) (-602.899) * (-601.001) [-601.595] (-601.129) (-603.946) -- 0:00:25
585000 -- (-604.582) [-602.277] (-602.053) (-600.860) * (-601.811) (-603.358) [-602.795] (-603.270) -- 0:00:25
Average standard deviation of split frequencies: 0.009151
585500 -- (-603.301) (-603.425) [-601.798] (-602.061) * (-599.814) (-603.455) (-602.787) [-601.849] -- 0:00:25
586000 -- [-602.805] (-604.750) (-601.861) (-602.814) * (-600.106) (-603.016) [-604.602] (-600.988) -- 0:00:25
586500 -- (-603.074) (-601.410) [-606.100] (-601.653) * (-600.743) (-600.272) [-604.857] (-600.455) -- 0:00:25
587000 -- (-603.362) (-605.212) (-605.776) [-602.137] * [-601.656] (-602.710) (-601.390) (-605.157) -- 0:00:25
587500 -- (-601.795) [-603.002] (-606.311) (-601.303) * (-604.229) (-602.307) (-600.845) [-601.784] -- 0:00:25
588000 -- (-607.342) [-600.263] (-600.879) (-600.808) * (-603.604) (-603.251) (-600.717) [-604.530] -- 0:00:25
588500 -- [-604.388] (-605.113) (-600.068) (-603.963) * [-600.859] (-603.404) (-600.290) (-600.912) -- 0:00:25
589000 -- (-601.058) [-602.403] (-602.170) (-604.670) * (-601.134) [-601.906] (-600.428) (-601.967) -- 0:00:25
589500 -- (-602.005) [-601.494] (-601.672) (-602.703) * (-602.616) [-602.024] (-600.854) (-601.951) -- 0:00:25
590000 -- (-603.508) (-604.162) [-606.335] (-602.409) * (-600.765) (-603.426) (-601.103) [-602.462] -- 0:00:25
Average standard deviation of split frequencies: 0.008979
590500 -- (-603.664) (-607.864) (-603.289) [-600.002] * [-602.238] (-602.064) (-604.585) (-601.749) -- 0:00:24
591000 -- [-602.761] (-606.160) (-606.715) (-605.694) * (-600.657) (-601.314) (-601.235) [-600.677] -- 0:00:24
591500 -- (-601.730) [-601.236] (-601.007) (-602.105) * (-603.753) (-601.479) (-604.282) [-600.650] -- 0:00:24
592000 -- [-603.179] (-603.333) (-602.501) (-605.641) * (-601.162) (-601.544) [-601.091] (-601.418) -- 0:00:24
592500 -- (-606.322) (-602.091) (-602.758) [-601.454] * (-604.212) (-602.135) (-604.123) [-601.879] -- 0:00:24
593000 -- (-604.352) (-603.544) (-601.893) [-602.400] * [-603.554] (-602.118) (-605.784) (-607.062) -- 0:00:24
593500 -- [-603.198] (-605.007) (-602.897) (-600.564) * (-601.585) [-601.389] (-604.881) (-600.414) -- 0:00:24
594000 -- (-601.958) [-600.569] (-601.835) (-605.369) * (-604.604) [-601.415] (-600.688) (-601.708) -- 0:00:24
594500 -- (-602.352) (-601.485) [-602.648] (-601.864) * (-605.682) [-601.162] (-601.188) (-601.800) -- 0:00:24
595000 -- (-601.486) (-602.078) (-600.400) [-601.155] * (-605.153) [-602.774] (-601.546) (-600.624) -- 0:00:24
Average standard deviation of split frequencies: 0.008700
595500 -- [-606.339] (-600.714) (-601.215) (-601.104) * (-600.533) (-605.943) (-600.983) [-603.746] -- 0:00:24
596000 -- (-603.830) (-602.418) [-602.359] (-602.323) * (-602.110) [-602.088] (-604.298) (-602.351) -- 0:00:24
596500 -- [-604.201] (-601.444) (-601.978) (-602.014) * [-601.658] (-606.225) (-600.970) (-602.165) -- 0:00:24
597000 -- (-603.735) (-602.545) (-601.931) [-601.932] * (-602.732) (-604.160) [-600.804] (-602.073) -- 0:00:24
597500 -- [-603.327] (-603.224) (-604.244) (-601.450) * (-600.843) (-601.701) (-600.778) [-601.460] -- 0:00:24
598000 -- (-601.263) (-610.680) (-604.709) [-602.206] * (-601.207) (-603.586) (-601.438) [-600.713] -- 0:00:24
598500 -- (-604.925) (-607.885) (-606.647) [-600.257] * [-600.988] (-602.853) (-601.353) (-601.617) -- 0:00:24
599000 -- (-601.365) [-602.616] (-602.561) (-602.893) * [-600.935] (-601.120) (-601.646) (-601.921) -- 0:00:24
599500 -- (-602.869) (-602.836) (-601.690) [-602.855] * (-604.041) [-602.144] (-602.419) (-613.735) -- 0:00:24
600000 -- (-603.226) (-601.064) (-603.596) [-602.832] * (-603.826) [-601.092] (-607.588) (-604.632) -- 0:00:24
Average standard deviation of split frequencies: 0.008682
600500 -- (-600.041) (-601.194) [-601.984] (-603.288) * (-604.362) [-600.821] (-601.343) (-604.165) -- 0:00:24
601000 -- (-600.464) (-600.887) (-601.604) [-608.619] * (-601.237) [-601.480] (-600.633) (-606.275) -- 0:00:24
601500 -- (-600.374) (-600.791) [-603.048] (-603.020) * [-601.729] (-606.251) (-600.471) (-604.733) -- 0:00:24
602000 -- (-603.346) (-602.279) [-600.960] (-602.299) * [-604.329] (-604.422) (-601.608) (-601.000) -- 0:00:24
602500 -- [-600.557] (-602.469) (-600.700) (-603.823) * (-605.375) (-601.562) [-601.356] (-602.955) -- 0:00:24
603000 -- [-601.659] (-600.912) (-603.065) (-604.871) * [-601.005] (-602.199) (-601.505) (-604.798) -- 0:00:24
603500 -- (-601.026) (-603.526) [-602.005] (-601.290) * (-602.802) (-603.365) [-601.190] (-602.414) -- 0:00:24
604000 -- (-603.770) (-603.836) (-601.950) [-604.230] * (-601.116) (-602.163) (-605.089) [-601.794] -- 0:00:24
604500 -- [-601.111] (-603.099) (-602.865) (-605.221) * (-604.283) [-602.132] (-603.423) (-602.540) -- 0:00:24
605000 -- (-603.443) (-602.051) (-600.746) [-602.416] * (-600.711) [-601.848] (-602.211) (-602.044) -- 0:00:24
Average standard deviation of split frequencies: 0.008508
605500 -- (-603.196) (-602.610) (-600.737) [-600.341] * (-600.179) (-606.537) (-606.354) [-605.269] -- 0:00:24
606000 -- (-602.628) [-601.315] (-601.685) (-602.748) * (-606.007) [-602.333] (-601.609) (-605.973) -- 0:00:24
606500 -- (-607.552) (-600.544) [-602.375] (-603.089) * [-602.070] (-601.041) (-602.721) (-604.921) -- 0:00:24
607000 -- (-600.305) [-603.023] (-601.368) (-605.764) * (-600.951) (-603.001) (-604.222) [-601.871] -- 0:00:23
607500 -- (-603.129) (-600.395) [-604.814] (-601.350) * (-602.582) [-600.825] (-604.192) (-602.550) -- 0:00:23
608000 -- (-602.265) [-601.815] (-603.272) (-602.124) * (-601.261) (-604.592) (-605.304) [-601.512] -- 0:00:23
608500 -- (-602.348) (-602.570) [-602.307] (-601.229) * [-601.287] (-602.266) (-604.510) (-602.462) -- 0:00:23
609000 -- (-604.783) (-605.399) (-603.405) [-600.724] * (-602.577) (-602.091) [-600.391] (-602.169) -- 0:00:23
609500 -- (-602.541) [-602.276] (-599.998) (-602.714) * (-606.203) (-600.774) [-600.984] (-601.383) -- 0:00:23
610000 -- (-609.156) (-602.810) (-602.214) [-603.849] * (-603.519) (-600.418) (-602.962) [-601.327] -- 0:00:23
Average standard deviation of split frequencies: 0.008684
610500 -- [-601.530] (-601.812) (-603.409) (-605.021) * (-607.095) (-600.632) (-600.856) [-600.583] -- 0:00:23
611000 -- (-604.126) (-602.530) [-602.455] (-600.768) * (-612.519) (-600.580) [-601.676] (-603.834) -- 0:00:23
611500 -- (-600.642) [-600.979] (-603.073) (-603.027) * (-602.527) (-603.236) [-602.159] (-602.904) -- 0:00:23
612000 -- (-608.866) (-601.104) [-605.029] (-602.982) * [-601.027] (-605.847) (-600.840) (-602.380) -- 0:00:23
612500 -- (-602.876) (-600.194) (-605.266) [-606.104] * (-603.119) [-601.789] (-600.959) (-603.163) -- 0:00:23
613000 -- (-602.361) [-599.959] (-605.449) (-604.640) * [-604.317] (-600.093) (-603.591) (-601.524) -- 0:00:23
613500 -- (-601.936) (-604.655) (-607.086) [-604.513] * (-607.540) [-601.912] (-600.270) (-603.293) -- 0:00:23
614000 -- (-602.481) [-601.820] (-601.020) (-601.995) * (-604.956) (-600.079) (-601.924) [-601.716] -- 0:00:23
614500 -- (-602.335) (-601.948) (-608.392) [-600.680] * (-600.787) [-601.146] (-601.343) (-603.946) -- 0:00:23
615000 -- (-600.503) (-602.172) [-600.265] (-604.460) * (-602.389) (-602.033) [-603.203] (-604.125) -- 0:00:23
Average standard deviation of split frequencies: 0.008778
615500 -- (-609.236) (-600.181) [-600.481] (-604.424) * [-601.036] (-601.694) (-601.499) (-601.805) -- 0:00:23
616000 -- (-602.435) [-602.226] (-600.401) (-603.214) * [-601.315] (-601.444) (-601.155) (-603.125) -- 0:00:23
616500 -- (-602.052) (-606.616) (-602.488) [-600.927] * (-603.635) [-601.542] (-604.366) (-602.376) -- 0:00:23
617000 -- (-606.298) (-604.629) (-602.954) [-600.536] * (-601.660) [-601.554] (-601.653) (-601.771) -- 0:00:23
617500 -- (-608.543) (-603.856) (-602.895) [-604.105] * (-604.246) (-602.271) (-602.333) [-600.845] -- 0:00:23
618000 -- [-603.035] (-601.889) (-601.763) (-605.297) * (-600.428) (-600.717) [-600.608] (-601.138) -- 0:00:23
618500 -- (-602.692) [-603.669] (-601.237) (-605.186) * (-602.914) [-603.246] (-601.346) (-610.071) -- 0:00:23
619000 -- (-607.207) (-603.572) (-601.813) [-603.380] * (-601.513) [-601.282] (-601.311) (-603.373) -- 0:00:23
619500 -- [-603.256] (-601.626) (-600.044) (-603.967) * (-602.655) (-601.279) (-602.856) [-600.335] -- 0:00:23
620000 -- [-601.371] (-601.482) (-603.872) (-601.489) * (-603.772) (-601.026) [-603.368] (-605.833) -- 0:00:23
Average standard deviation of split frequencies: 0.009541
620500 -- (-600.812) (-601.631) [-603.056] (-601.109) * (-602.168) (-600.197) [-601.016] (-603.138) -- 0:00:23
621000 -- (-602.126) (-601.610) (-604.720) [-605.096] * [-602.485] (-603.993) (-601.424) (-602.360) -- 0:00:23
621500 -- (-604.154) (-601.157) (-602.811) [-602.235] * (-602.609) [-601.773] (-601.092) (-604.136) -- 0:00:23
622000 -- [-602.120] (-602.328) (-600.070) (-601.167) * (-603.237) (-602.684) (-601.324) [-602.242] -- 0:00:23
622500 -- (-600.701) [-601.753] (-604.447) (-600.454) * (-603.889) (-603.122) (-600.612) [-601.409] -- 0:00:23
623000 -- [-601.159] (-599.850) (-604.028) (-602.036) * (-602.480) (-601.832) [-602.530] (-601.549) -- 0:00:22
623500 -- (-601.944) (-602.491) [-604.182] (-607.360) * [-601.943] (-602.585) (-602.868) (-605.215) -- 0:00:22
624000 -- (-601.321) (-602.808) (-602.570) [-602.680] * (-604.180) (-602.908) (-608.513) [-601.746] -- 0:00:22
624500 -- (-601.204) [-604.321] (-602.287) (-603.181) * (-606.777) (-600.603) [-607.334] (-600.501) -- 0:00:22
625000 -- [-601.846] (-602.236) (-601.827) (-602.517) * (-601.879) (-600.943) [-603.625] (-601.898) -- 0:00:22
Average standard deviation of split frequencies: 0.009084
625500 -- (-603.327) (-601.063) (-601.514) [-600.797] * (-601.884) [-602.338] (-604.845) (-602.149) -- 0:00:22
626000 -- (-603.517) (-600.898) (-603.036) [-602.701] * (-601.131) (-601.634) [-602.318] (-604.653) -- 0:00:22
626500 -- (-602.806) (-601.485) (-603.615) [-605.514] * (-600.860) [-602.347] (-603.120) (-606.694) -- 0:00:22
627000 -- (-601.111) (-602.848) (-603.149) [-601.995] * (-604.306) (-602.929) (-601.945) [-601.180] -- 0:00:22
627500 -- (-601.045) (-603.515) (-608.539) [-607.149] * (-601.619) [-600.974] (-604.219) (-601.557) -- 0:00:22
628000 -- [-600.435] (-601.394) (-606.539) (-602.243) * (-603.895) (-600.561) [-603.814] (-603.551) -- 0:00:22
628500 -- [-601.248] (-601.101) (-604.359) (-601.751) * (-600.821) (-602.304) (-603.235) [-604.520] -- 0:00:22
629000 -- [-600.803] (-604.140) (-603.811) (-603.099) * [-602.284] (-600.571) (-602.589) (-602.621) -- 0:00:22
629500 -- (-602.747) (-604.419) [-600.500] (-603.716) * (-603.673) (-601.145) (-601.909) [-602.044] -- 0:00:22
630000 -- (-601.758) [-601.781] (-600.498) (-601.665) * (-601.970) (-602.567) [-602.913] (-602.281) -- 0:00:22
Average standard deviation of split frequencies: 0.008643
630500 -- (-605.327) (-608.263) (-602.064) [-602.099] * [-604.064] (-601.026) (-600.569) (-601.727) -- 0:00:22
631000 -- [-600.571] (-606.609) (-602.755) (-600.633) * (-605.476) [-602.264] (-600.604) (-602.487) -- 0:00:22
631500 -- [-604.842] (-604.441) (-601.296) (-601.661) * (-603.201) (-603.816) [-602.752] (-603.589) -- 0:00:22
632000 -- (-600.574) [-602.999] (-603.659) (-600.457) * (-607.992) (-601.001) [-601.227] (-604.574) -- 0:00:22
632500 -- (-600.344) [-602.484] (-603.315) (-604.298) * (-606.602) [-601.252] (-603.589) (-601.370) -- 0:00:22
633000 -- (-602.060) [-601.114] (-602.765) (-603.640) * (-600.891) (-601.143) [-602.390] (-602.933) -- 0:00:22
633500 -- (-604.035) (-600.341) [-602.776] (-602.164) * (-600.603) (-602.528) [-600.664] (-602.686) -- 0:00:22
634000 -- [-601.010] (-606.879) (-603.549) (-604.202) * [-602.128] (-601.495) (-601.359) (-603.020) -- 0:00:22
634500 -- [-600.065] (-606.161) (-601.968) (-603.435) * (-601.648) (-601.732) [-601.945] (-603.459) -- 0:00:22
635000 -- (-601.680) (-603.262) [-601.916] (-602.644) * [-604.017] (-602.322) (-605.589) (-605.169) -- 0:00:22
Average standard deviation of split frequencies: 0.008848
635500 -- [-607.790] (-601.881) (-602.886) (-602.271) * (-601.609) (-604.713) (-602.010) [-601.621] -- 0:00:22
636000 -- (-606.423) (-603.455) [-602.384] (-601.388) * [-602.598] (-603.861) (-602.268) (-602.755) -- 0:00:22
636500 -- (-602.165) (-603.797) [-601.315] (-606.700) * (-602.141) [-601.391] (-601.065) (-602.512) -- 0:00:22
637000 -- (-601.485) [-601.518] (-603.849) (-603.187) * (-602.025) [-601.247] (-603.975) (-604.070) -- 0:00:22
637500 -- [-604.020] (-601.176) (-606.188) (-601.336) * (-609.351) (-606.240) [-604.280] (-602.787) -- 0:00:22
638000 -- (-602.064) [-600.554] (-600.585) (-601.713) * (-602.098) [-603.962] (-603.102) (-604.951) -- 0:00:22
638500 -- (-601.416) (-604.723) (-604.991) [-601.998] * (-600.928) (-601.339) (-603.969) [-601.814] -- 0:00:22
639000 -- [-600.919] (-602.412) (-602.471) (-604.414) * (-602.291) (-600.577) [-604.024] (-602.504) -- 0:00:22
639500 -- [-602.684] (-601.310) (-603.929) (-601.104) * (-603.062) (-602.801) [-602.252] (-601.699) -- 0:00:21
640000 -- (-602.988) [-601.486] (-602.910) (-603.322) * (-602.089) [-603.213] (-602.670) (-606.943) -- 0:00:21
Average standard deviation of split frequencies: 0.007849
640500 -- (-601.955) [-603.295] (-603.461) (-602.759) * (-601.178) (-602.724) [-602.773] (-601.674) -- 0:00:21
641000 -- [-601.438] (-602.587) (-601.258) (-601.359) * (-602.297) (-602.609) (-603.985) [-602.503] -- 0:00:21
641500 -- (-606.446) (-609.887) (-600.680) [-600.977] * (-603.284) [-601.653] (-603.071) (-603.825) -- 0:00:21
642000 -- (-601.636) (-608.690) [-601.310] (-601.268) * (-611.577) [-601.725] (-601.318) (-604.538) -- 0:00:21
642500 -- (-603.586) (-600.598) (-603.366) [-606.253] * (-604.776) (-604.214) [-605.078] (-603.550) -- 0:00:21
643000 -- (-600.272) (-600.084) (-602.616) [-603.227] * (-603.145) (-606.454) [-601.579] (-605.074) -- 0:00:21
643500 -- (-600.020) (-601.700) (-601.000) [-603.287] * (-604.060) (-604.628) (-600.512) [-600.973] -- 0:00:21
644000 -- (-604.094) (-601.431) [-601.696] (-602.924) * (-603.250) (-604.888) (-602.635) [-600.808] -- 0:00:21
644500 -- (-600.842) (-601.687) [-602.486] (-602.087) * [-602.887] (-602.378) (-604.806) (-603.342) -- 0:00:21
645000 -- (-603.147) (-602.905) (-601.355) [-601.112] * (-603.594) (-601.138) (-601.100) [-603.239] -- 0:00:21
Average standard deviation of split frequencies: 0.007684
645500 -- (-603.257) (-603.197) (-601.796) [-603.985] * (-604.032) (-600.623) (-601.204) [-600.928] -- 0:00:21
646000 -- [-605.842] (-602.659) (-601.395) (-605.273) * (-603.856) (-600.909) (-600.958) [-601.546] -- 0:00:21
646500 -- (-602.464) [-602.632] (-602.770) (-603.681) * [-604.850] (-601.232) (-602.021) (-600.358) -- 0:00:21
647000 -- (-602.947) (-602.104) (-603.546) [-606.158] * (-602.352) (-603.024) (-602.611) [-601.418] -- 0:00:21
647500 -- [-602.295] (-601.720) (-602.943) (-602.667) * (-604.174) (-602.351) [-600.868] (-603.512) -- 0:00:21
648000 -- [-601.595] (-601.197) (-600.925) (-600.662) * (-603.181) (-602.339) [-602.253] (-602.455) -- 0:00:21
648500 -- [-601.351] (-601.632) (-604.158) (-602.287) * (-601.734) [-602.244] (-602.589) (-602.671) -- 0:00:21
649000 -- (-601.524) (-600.659) (-602.263) [-601.757] * [-602.762] (-602.635) (-604.640) (-603.396) -- 0:00:21
649500 -- [-600.815] (-602.167) (-605.080) (-600.992) * (-603.740) (-600.914) (-606.202) [-600.108] -- 0:00:21
650000 -- (-605.082) [-605.564] (-602.816) (-602.967) * [-601.741] (-602.019) (-603.526) (-605.194) -- 0:00:21
Average standard deviation of split frequencies: 0.007842
650500 -- (-605.363) [-601.075] (-601.104) (-601.956) * (-601.526) [-602.713] (-604.941) (-604.723) -- 0:00:21
651000 -- (-601.004) (-604.674) (-601.078) [-601.930] * (-602.643) (-607.027) [-602.592] (-601.040) -- 0:00:21
651500 -- (-601.552) [-605.115] (-600.382) (-603.174) * (-603.618) (-606.907) [-601.553] (-600.979) -- 0:00:21
652000 -- (-604.303) (-602.460) (-602.037) [-601.513] * (-603.273) [-603.657] (-602.592) (-600.880) -- 0:00:21
652500 -- [-601.116] (-601.429) (-604.775) (-600.823) * [-603.697] (-600.869) (-600.877) (-605.564) -- 0:00:21
653000 -- (-602.217) (-600.913) [-605.748] (-608.376) * (-601.395) (-603.490) (-601.649) [-601.611] -- 0:00:21
653500 -- (-601.588) (-600.206) (-601.006) [-603.341] * (-605.360) [-604.556] (-605.482) (-601.685) -- 0:00:21
654000 -- (-603.911) [-604.081] (-603.590) (-601.776) * (-602.444) [-601.233] (-602.722) (-603.993) -- 0:00:21
654500 -- (-601.058) (-600.895) (-605.191) [-601.579] * (-606.585) (-600.391) [-603.123] (-601.129) -- 0:00:21
655000 -- (-601.812) (-604.262) (-604.563) [-601.173] * (-603.267) (-600.959) (-602.124) [-600.826] -- 0:00:21
Average standard deviation of split frequencies: 0.007860
655500 -- (-602.760) (-603.698) (-601.711) [-601.249] * (-603.009) (-601.838) (-601.019) [-601.325] -- 0:00:21
656000 -- [-604.882] (-601.443) (-601.039) (-603.515) * [-602.105] (-599.899) (-601.743) (-600.738) -- 0:00:20
656500 -- (-601.043) (-603.583) [-600.721] (-602.944) * (-600.792) [-605.848] (-601.417) (-603.228) -- 0:00:20
657000 -- (-601.349) (-604.205) [-601.880] (-600.852) * (-601.666) [-610.388] (-603.422) (-600.625) -- 0:00:20
657500 -- [-601.632] (-601.489) (-601.222) (-600.928) * (-607.554) (-603.472) [-601.076] (-602.906) -- 0:00:20
658000 -- [-602.483] (-602.870) (-601.422) (-602.013) * (-604.191) (-603.811) [-601.099] (-601.765) -- 0:00:20
658500 -- (-603.009) (-603.534) [-601.431] (-602.641) * (-601.318) (-600.726) (-602.087) [-602.885] -- 0:00:20
659000 -- [-600.989] (-603.476) (-601.233) (-602.568) * (-600.935) (-602.125) [-603.431] (-602.739) -- 0:00:20
659500 -- (-601.260) [-600.188] (-600.683) (-604.197) * [-602.110] (-602.000) (-602.714) (-601.857) -- 0:00:20
660000 -- [-602.545] (-600.319) (-600.434) (-602.724) * (-601.844) (-601.633) [-602.843] (-601.897) -- 0:00:20
Average standard deviation of split frequencies: 0.007893
660500 -- (-602.582) (-604.288) (-603.514) [-603.792] * (-607.886) (-602.838) [-600.029] (-603.306) -- 0:00:20
661000 -- [-601.709] (-601.616) (-602.309) (-600.993) * [-601.655] (-605.219) (-601.183) (-601.290) -- 0:00:20
661500 -- (-601.433) (-602.194) (-601.241) [-602.940] * (-600.836) (-601.872) [-601.067] (-601.448) -- 0:00:20
662000 -- (-600.997) (-601.538) [-600.503] (-603.271) * (-600.207) (-600.528) [-601.893] (-603.069) -- 0:00:20
662500 -- [-601.920] (-605.452) (-602.877) (-604.449) * (-602.096) (-603.238) [-604.500] (-608.778) -- 0:00:20
663000 -- (-604.780) [-602.460] (-602.323) (-601.943) * (-602.543) (-601.250) [-602.751] (-603.732) -- 0:00:20
663500 -- (-606.687) (-604.283) [-602.063] (-605.749) * (-600.345) [-601.348] (-602.275) (-603.634) -- 0:00:20
664000 -- [-606.742] (-602.799) (-606.126) (-603.715) * (-601.883) [-600.965] (-601.570) (-603.079) -- 0:00:20
664500 -- (-604.795) (-601.090) (-602.757) [-602.538] * [-601.405] (-603.489) (-601.936) (-603.991) -- 0:00:20
665000 -- [-603.492] (-605.629) (-602.715) (-601.326) * (-601.210) [-601.635] (-600.295) (-601.530) -- 0:00:20
Average standard deviation of split frequencies: 0.007874
665500 -- (-601.785) (-601.231) [-600.651] (-603.287) * (-602.538) (-605.954) (-606.925) [-600.836] -- 0:00:20
666000 -- (-603.298) [-602.497] (-601.096) (-603.026) * (-601.752) (-602.299) [-603.014] (-602.354) -- 0:00:20
666500 -- (-604.025) (-602.986) [-603.425] (-600.609) * [-601.629] (-602.011) (-603.823) (-602.050) -- 0:00:20
667000 -- (-602.333) (-607.714) [-606.437] (-600.954) * (-602.133) [-600.580] (-603.063) (-600.691) -- 0:00:20
667500 -- [-605.281] (-600.825) (-604.205) (-602.741) * [-601.355] (-600.112) (-603.135) (-600.931) -- 0:00:20
668000 -- (-600.424) (-603.102) [-600.172] (-602.991) * [-599.919] (-600.112) (-603.390) (-600.536) -- 0:00:20
668500 -- [-601.149] (-605.419) (-601.285) (-601.292) * (-603.453) [-605.143] (-604.897) (-602.567) -- 0:00:20
669000 -- (-603.065) (-604.512) (-601.331) [-601.656] * (-602.043) (-604.052) (-606.741) [-602.218] -- 0:00:20
669500 -- (-604.827) (-601.122) (-601.969) [-601.156] * (-601.263) [-601.848] (-602.221) (-601.497) -- 0:00:20
670000 -- [-600.770] (-601.302) (-602.085) (-601.648) * (-602.073) (-601.931) (-601.760) [-600.449] -- 0:00:20
Average standard deviation of split frequencies: 0.007688
670500 -- [-601.186] (-601.446) (-602.803) (-606.833) * (-601.241) [-606.653] (-601.335) (-602.345) -- 0:00:20
671000 -- (-600.579) (-601.354) [-600.980] (-601.148) * (-601.817) (-605.255) (-601.166) [-602.208] -- 0:00:20
671500 -- (-604.071) [-603.388] (-605.383) (-606.911) * (-601.614) [-602.776] (-605.291) (-601.088) -- 0:00:20
672000 -- (-600.979) (-601.494) [-602.533] (-601.540) * (-601.191) [-602.642] (-600.877) (-601.094) -- 0:00:20
672500 -- (-601.323) [-602.741] (-600.903) (-604.350) * (-601.274) (-603.700) (-601.995) [-599.994] -- 0:00:19
673000 -- (-601.562) [-604.494] (-600.507) (-604.652) * (-600.957) [-600.277] (-603.108) (-601.179) -- 0:00:19
673500 -- [-601.892] (-601.799) (-602.835) (-606.219) * (-602.297) [-601.408] (-604.759) (-601.747) -- 0:00:19
674000 -- [-605.163] (-603.080) (-602.681) (-601.375) * (-604.863) [-601.747] (-602.140) (-605.486) -- 0:00:19
674500 -- (-602.841) (-602.463) (-600.903) [-601.493] * [-601.545] (-601.481) (-600.904) (-600.891) -- 0:00:19
675000 -- [-602.405] (-601.877) (-602.312) (-603.509) * (-605.406) (-601.808) [-603.318] (-601.191) -- 0:00:19
Average standard deviation of split frequencies: 0.008368
675500 -- [-601.999] (-600.904) (-604.816) (-600.791) * [-602.602] (-601.922) (-601.475) (-600.509) -- 0:00:19
676000 -- [-602.864] (-601.669) (-603.103) (-601.044) * [-603.248] (-607.903) (-602.473) (-602.340) -- 0:00:19
676500 -- (-604.571) (-601.085) [-603.712] (-603.306) * (-602.893) [-603.511] (-601.491) (-601.481) -- 0:00:19
677000 -- (-601.921) [-602.186] (-603.219) (-601.806) * (-605.181) (-600.629) [-601.253] (-601.833) -- 0:00:19
677500 -- (-601.897) (-603.300) [-603.032] (-600.160) * (-601.681) (-602.555) (-601.834) [-601.018] -- 0:00:19
678000 -- [-603.705] (-601.317) (-603.769) (-601.137) * [-603.106] (-603.715) (-603.315) (-607.975) -- 0:00:19
678500 -- [-600.412] (-601.031) (-601.218) (-603.156) * (-603.681) [-604.232] (-605.029) (-607.861) -- 0:00:19
679000 -- (-601.649) (-602.945) (-601.044) [-601.177] * [-602.649] (-604.851) (-604.954) (-608.223) -- 0:00:19
679500 -- (-601.219) [-601.027] (-600.557) (-602.424) * (-603.567) [-601.532] (-602.092) (-601.861) -- 0:00:19
680000 -- (-606.973) [-600.471] (-601.922) (-601.904) * [-602.024] (-600.884) (-601.236) (-607.689) -- 0:00:19
Average standard deviation of split frequencies: 0.008397
680500 -- (-604.078) (-602.481) (-601.324) [-601.462] * (-602.614) (-600.647) [-601.501] (-607.567) -- 0:00:19
681000 -- (-602.571) [-600.930] (-606.960) (-601.245) * (-601.662) (-601.200) (-603.596) [-604.277] -- 0:00:19
681500 -- (-602.218) [-600.307] (-603.332) (-601.565) * [-604.171] (-602.398) (-604.716) (-601.891) -- 0:00:19
682000 -- (-603.342) [-601.705] (-600.875) (-602.856) * [-603.406] (-603.078) (-603.940) (-604.958) -- 0:00:19
682500 -- (-601.942) (-602.868) [-601.988] (-601.828) * (-602.294) (-602.093) (-604.229) [-601.943] -- 0:00:19
683000 -- (-602.389) (-601.826) [-601.163] (-599.993) * (-603.010) (-601.616) (-603.925) [-602.448] -- 0:00:19
683500 -- (-601.883) (-601.056) (-601.217) [-602.573] * (-605.729) [-601.372] (-601.714) (-609.059) -- 0:00:18
684000 -- [-601.422] (-601.274) (-602.490) (-601.682) * (-605.616) [-603.646] (-602.325) (-605.685) -- 0:00:19
684500 -- (-600.981) (-601.542) [-600.572] (-602.541) * (-606.511) (-603.988) (-603.895) [-601.255] -- 0:00:19
685000 -- (-600.687) (-603.114) [-601.401] (-602.094) * (-601.460) [-605.419] (-603.975) (-603.061) -- 0:00:19
Average standard deviation of split frequencies: 0.008031
685500 -- (-601.551) [-605.337] (-601.577) (-601.232) * [-600.681] (-603.553) (-602.162) (-603.138) -- 0:00:19
686000 -- (-600.668) (-600.981) [-601.826] (-603.000) * [-604.354] (-601.966) (-600.793) (-601.346) -- 0:00:19
686500 -- (-601.453) (-602.134) [-600.215] (-603.144) * (-605.935) [-601.200] (-605.396) (-601.919) -- 0:00:19
687000 -- (-600.758) [-601.844] (-601.103) (-605.200) * [-602.035] (-600.302) (-600.784) (-601.662) -- 0:00:19
687500 -- (-601.566) (-604.083) [-600.071] (-602.380) * (-602.818) (-600.033) (-600.748) [-602.900] -- 0:00:19
688000 -- [-601.113] (-608.577) (-600.444) (-602.727) * (-601.877) (-603.772) [-601.912] (-601.370) -- 0:00:19
688500 -- (-604.975) (-605.930) (-601.068) [-603.026] * (-600.299) (-610.381) [-602.584] (-601.671) -- 0:00:19
689000 -- (-602.238) (-601.208) (-602.213) [-600.901] * (-602.221) [-603.658] (-602.147) (-600.966) -- 0:00:18
689500 -- (-603.443) (-603.422) [-608.095] (-600.206) * (-606.468) (-601.757) (-604.787) [-603.251] -- 0:00:18
690000 -- (-601.293) (-604.682) [-601.821] (-600.272) * (-603.047) [-601.894] (-602.298) (-605.285) -- 0:00:18
Average standard deviation of split frequencies: 0.007892
690500 -- (-603.017) [-603.546] (-601.074) (-601.651) * (-603.266) (-604.196) [-602.575] (-602.022) -- 0:00:18
691000 -- (-603.104) (-603.506) [-602.573] (-602.122) * [-601.237] (-601.773) (-602.678) (-603.170) -- 0:00:18
691500 -- (-600.700) [-602.122] (-600.816) (-601.616) * [-602.059] (-603.738) (-602.170) (-602.780) -- 0:00:18
692000 -- [-600.898] (-601.113) (-603.369) (-603.028) * (-604.989) [-604.217] (-602.174) (-600.942) -- 0:00:18
692500 -- [-601.222] (-605.452) (-603.236) (-601.754) * (-601.998) [-600.200] (-601.494) (-603.389) -- 0:00:18
693000 -- [-602.049] (-602.911) (-601.437) (-601.910) * [-601.166] (-602.633) (-601.873) (-605.519) -- 0:00:18
693500 -- [-605.573] (-606.173) (-602.445) (-605.135) * (-601.533) (-604.902) [-602.060] (-604.490) -- 0:00:18
694000 -- (-600.294) (-602.341) (-602.893) [-600.475] * (-604.727) [-603.785] (-603.120) (-604.765) -- 0:00:18
694500 -- (-600.854) (-601.123) (-603.306) [-601.243] * (-607.128) (-605.238) (-602.771) [-601.148] -- 0:00:18
695000 -- (-601.094) (-604.661) [-600.887] (-603.945) * (-605.654) (-606.127) (-602.944) [-601.080] -- 0:00:18
Average standard deviation of split frequencies: 0.007874
695500 -- (-600.426) (-601.812) (-602.481) [-601.228] * [-602.767] (-604.116) (-602.207) (-602.146) -- 0:00:18
696000 -- (-603.055) (-601.014) [-601.318] (-603.073) * [-602.605] (-605.317) (-606.246) (-601.973) -- 0:00:18
696500 -- (-602.754) [-604.828] (-601.121) (-604.133) * (-601.776) [-601.762] (-605.625) (-607.147) -- 0:00:18
697000 -- [-602.313] (-600.516) (-602.451) (-602.946) * (-600.707) [-600.988] (-608.212) (-601.833) -- 0:00:18
697500 -- [-602.670] (-603.189) (-601.373) (-601.931) * (-601.179) [-604.320] (-603.336) (-600.399) -- 0:00:18
698000 -- (-602.032) (-607.269) [-600.323] (-601.568) * (-607.791) (-603.115) (-602.392) [-600.492] -- 0:00:18
698500 -- (-601.662) (-608.190) (-601.588) [-601.685] * (-601.095) (-603.958) [-602.426] (-601.204) -- 0:00:18
699000 -- (-601.519) (-608.381) (-601.651) [-600.482] * (-604.373) [-602.574] (-601.233) (-600.303) -- 0:00:18
699500 -- (-601.140) (-600.597) [-603.876] (-601.541) * (-603.172) (-601.529) (-601.578) [-607.948] -- 0:00:18
700000 -- (-601.929) (-600.894) (-604.134) [-601.370] * [-612.079] (-600.992) (-604.696) (-605.529) -- 0:00:18
Average standard deviation of split frequencies: 0.007695
700500 -- (-601.580) (-601.826) [-601.433] (-601.645) * (-602.597) [-600.191] (-603.595) (-604.539) -- 0:00:17
701000 -- (-601.941) (-603.406) (-600.538) [-600.481] * [-601.198] (-602.908) (-604.122) (-602.425) -- 0:00:18
701500 -- (-600.831) (-601.981) [-601.029] (-601.010) * (-601.804) (-603.083) [-606.753] (-604.259) -- 0:00:18
702000 -- [-605.893] (-603.615) (-600.902) (-601.044) * (-602.802) [-601.395] (-603.457) (-604.549) -- 0:00:18
702500 -- (-603.712) [-600.371] (-600.221) (-601.579) * (-602.807) (-607.320) [-603.282] (-602.228) -- 0:00:18
703000 -- (-606.945) [-600.333] (-601.836) (-601.254) * (-601.860) (-605.405) (-602.804) [-606.072] -- 0:00:18
703500 -- [-604.330] (-603.393) (-602.168) (-601.128) * (-601.322) (-602.245) (-601.289) [-601.760] -- 0:00:18
704000 -- (-603.615) (-603.083) [-602.396] (-603.848) * [-600.734] (-604.869) (-602.576) (-611.069) -- 0:00:18
704500 -- (-604.605) (-604.920) (-601.953) [-603.121] * (-602.153) [-602.235] (-602.388) (-603.094) -- 0:00:18
705000 -- (-602.034) [-611.699] (-600.478) (-607.119) * [-600.836] (-604.048) (-601.433) (-603.317) -- 0:00:17
Average standard deviation of split frequencies: 0.007553
705500 -- [-601.121] (-606.835) (-602.368) (-603.343) * (-603.920) (-603.160) (-601.434) [-601.538] -- 0:00:17
706000 -- (-603.518) (-605.961) [-603.498] (-606.396) * (-601.398) [-603.269] (-602.923) (-604.322) -- 0:00:17
706500 -- (-601.606) (-603.785) (-602.769) [-602.573] * (-605.209) (-601.724) [-601.647] (-601.451) -- 0:00:17
707000 -- (-600.289) (-602.424) [-601.775] (-607.614) * (-602.937) [-600.339] (-607.550) (-600.932) -- 0:00:17
707500 -- (-600.745) (-602.455) [-603.258] (-607.628) * [-600.208] (-603.783) (-603.832) (-601.204) -- 0:00:17
708000 -- (-601.156) [-601.232] (-605.042) (-610.797) * [-603.280] (-604.022) (-600.654) (-606.290) -- 0:00:17
708500 -- (-600.725) [-601.379] (-603.416) (-608.393) * (-601.841) [-608.063] (-601.229) (-604.806) -- 0:00:17
709000 -- (-607.327) (-603.938) [-600.087] (-602.761) * (-602.459) (-600.109) (-603.031) [-600.852] -- 0:00:17
709500 -- (-605.051) (-603.675) (-603.911) [-603.508] * (-603.815) (-605.971) [-604.989] (-600.790) -- 0:00:17
710000 -- (-605.296) [-600.823] (-601.737) (-603.766) * [-601.836] (-601.467) (-606.814) (-601.701) -- 0:00:17
Average standard deviation of split frequencies: 0.007628
710500 -- (-604.265) (-605.462) [-602.838] (-605.587) * (-602.513) [-601.140] (-602.653) (-600.397) -- 0:00:17
711000 -- [-601.654] (-603.591) (-601.683) (-603.568) * (-601.248) [-605.064] (-600.618) (-604.263) -- 0:00:17
711500 -- [-603.045] (-601.664) (-601.281) (-603.439) * (-601.084) (-601.842) [-600.688] (-604.648) -- 0:00:17
712000 -- (-601.623) [-601.151] (-602.248) (-605.426) * (-601.494) [-601.902] (-600.660) (-603.633) -- 0:00:17
712500 -- (-607.281) [-601.650] (-602.436) (-600.110) * (-601.978) (-602.206) [-601.137] (-607.963) -- 0:00:17
713000 -- (-601.257) (-603.848) (-600.461) [-603.230] * (-600.912) [-601.837] (-602.261) (-603.892) -- 0:00:17
713500 -- [-601.294] (-603.335) (-606.799) (-603.082) * [-600.489] (-604.516) (-605.016) (-602.700) -- 0:00:17
714000 -- (-601.893) (-603.130) (-602.264) [-601.211] * (-602.185) (-601.296) (-601.028) [-600.074] -- 0:00:17
714500 -- (-601.701) (-604.766) [-602.533] (-600.742) * (-602.497) (-606.433) [-602.690] (-601.393) -- 0:00:17
715000 -- [-600.694] (-601.669) (-603.081) (-604.977) * [-603.145] (-601.516) (-601.925) (-601.827) -- 0:00:17
Average standard deviation of split frequencies: 0.007818
715500 -- (-600.791) (-601.437) (-605.682) [-601.659] * (-603.155) [-602.158] (-601.224) (-601.441) -- 0:00:17
716000 -- (-601.518) [-601.312] (-601.564) (-603.055) * (-601.946) (-607.492) (-602.255) [-600.507] -- 0:00:17
716500 -- (-601.931) (-602.378) [-604.663] (-603.294) * [-600.982] (-602.398) (-604.390) (-602.838) -- 0:00:17
717000 -- (-603.543) (-604.196) (-603.668) [-600.457] * [-601.804] (-605.027) (-603.845) (-600.967) -- 0:00:16
717500 -- (-601.899) (-604.950) [-601.885] (-602.982) * (-603.764) (-604.765) [-600.513] (-604.935) -- 0:00:16
718000 -- [-601.572] (-604.351) (-601.812) (-600.860) * (-601.564) (-604.628) [-601.320] (-606.350) -- 0:00:17
718500 -- (-600.768) (-600.666) (-600.928) [-602.148] * [-604.083] (-600.912) (-604.193) (-601.314) -- 0:00:17
719000 -- (-600.414) [-603.012] (-600.630) (-601.382) * (-605.034) (-600.949) [-602.232] (-602.545) -- 0:00:17
719500 -- (-601.702) [-602.867] (-604.055) (-602.807) * [-601.092] (-600.587) (-605.936) (-602.795) -- 0:00:17
720000 -- (-601.135) (-604.465) [-601.362] (-600.915) * (-602.501) (-604.464) [-603.188] (-600.789) -- 0:00:17
Average standard deviation of split frequencies: 0.007972
720500 -- (-601.616) [-605.297] (-603.912) (-601.443) * (-601.722) [-602.223] (-602.681) (-601.959) -- 0:00:17
721000 -- (-603.089) (-604.922) [-601.378] (-601.822) * (-602.376) [-601.785] (-604.117) (-604.276) -- 0:00:17
721500 -- (-601.132) (-606.463) (-601.848) [-604.135] * (-603.803) (-604.422) (-603.738) [-601.014] -- 0:00:16
722000 -- (-603.168) (-600.459) (-601.535) [-603.676] * (-602.029) [-602.762] (-605.255) (-604.518) -- 0:00:16
722500 -- (-603.157) (-602.033) (-601.900) [-602.595] * (-603.319) (-601.059) (-601.922) [-604.705] -- 0:00:16
723000 -- (-602.172) (-601.439) [-602.028] (-608.018) * [-602.802] (-600.684) (-601.830) (-602.519) -- 0:00:16
723500 -- (-601.036) (-601.688) (-602.211) [-604.561] * (-604.326) (-602.909) (-602.227) [-601.126] -- 0:00:16
724000 -- [-601.635] (-604.160) (-608.380) (-602.838) * (-602.780) (-601.539) (-602.630) [-601.457] -- 0:00:16
724500 -- (-603.820) (-603.940) [-603.013] (-602.751) * (-602.140) (-600.944) [-602.340] (-603.832) -- 0:00:16
725000 -- [-602.354] (-602.540) (-601.048) (-605.285) * (-601.096) [-604.031] (-601.823) (-603.525) -- 0:00:16
Average standard deviation of split frequencies: 0.008522
725500 -- (-601.026) (-601.647) (-602.389) [-604.187] * (-605.033) (-603.603) (-602.575) [-601.805] -- 0:00:16
726000 -- [-601.622] (-602.245) (-601.827) (-600.822) * (-600.478) [-603.132] (-604.048) (-602.340) -- 0:00:16
726500 -- (-603.060) (-601.322) (-604.854) [-599.898] * (-604.387) (-604.669) (-602.369) [-603.853] -- 0:00:16
727000 -- (-601.124) (-600.816) [-600.530] (-599.938) * (-600.505) [-601.152] (-603.108) (-605.757) -- 0:00:16
727500 -- [-603.059] (-604.255) (-600.863) (-600.507) * (-600.342) [-602.021] (-600.887) (-604.678) -- 0:00:16
728000 -- (-602.161) (-605.825) [-602.591] (-603.493) * [-601.191] (-603.920) (-604.257) (-603.939) -- 0:00:16
728500 -- (-601.926) (-601.298) [-601.343] (-603.955) * (-600.145) (-602.531) [-600.766] (-603.708) -- 0:00:16
729000 -- (-602.081) (-606.263) [-600.838] (-601.184) * [-600.515] (-604.576) (-602.780) (-608.872) -- 0:00:16
729500 -- (-604.177) (-605.833) [-603.635] (-605.129) * (-601.915) [-601.400] (-601.462) (-604.827) -- 0:00:16
730000 -- (-607.110) [-603.138] (-601.790) (-602.196) * (-603.138) (-600.228) [-601.400] (-601.473) -- 0:00:16
Average standard deviation of split frequencies: 0.008508
730500 -- (-601.479) (-605.672) (-602.832) [-603.826] * [-601.879] (-607.039) (-602.931) (-604.292) -- 0:00:16
731000 -- (-601.388) (-601.362) [-600.383] (-602.004) * (-601.887) [-602.559] (-603.447) (-601.580) -- 0:00:16
731500 -- [-600.252] (-601.192) (-601.137) (-601.924) * [-601.183] (-600.767) (-601.958) (-601.023) -- 0:00:16
732000 -- [-601.427] (-602.613) (-605.061) (-600.738) * (-603.751) (-604.809) [-602.512] (-600.989) -- 0:00:16
732500 -- (-600.167) [-600.122] (-602.513) (-600.818) * (-603.347) (-605.122) (-600.999) [-602.642] -- 0:00:16
733000 -- [-602.655] (-603.499) (-610.499) (-601.218) * (-602.112) (-601.010) (-601.750) [-602.469] -- 0:00:16
733500 -- (-607.554) [-604.233] (-611.207) (-601.489) * (-601.601) (-599.981) [-601.552] (-601.508) -- 0:00:15
734000 -- (-605.357) (-601.763) (-600.693) [-601.614] * [-600.758] (-606.540) (-602.738) (-601.899) -- 0:00:15
734500 -- (-604.579) (-604.061) [-602.854] (-603.674) * [-602.624] (-601.094) (-601.128) (-600.602) -- 0:00:16
735000 -- (-605.765) [-600.642] (-600.867) (-600.711) * [-600.473] (-605.014) (-602.099) (-603.845) -- 0:00:16
Average standard deviation of split frequencies: 0.008447
735500 -- (-601.139) (-600.740) [-607.341] (-600.331) * (-601.608) (-601.390) (-602.563) [-606.776] -- 0:00:16
736000 -- (-601.037) [-606.669] (-602.520) (-604.022) * (-605.622) [-606.028] (-605.686) (-607.400) -- 0:00:16
736500 -- (-600.426) (-603.026) (-601.176) [-601.096] * [-601.245] (-604.250) (-602.816) (-601.944) -- 0:00:16
737000 -- (-605.742) (-602.369) [-601.082] (-600.873) * (-601.722) [-601.168] (-601.454) (-604.607) -- 0:00:16
737500 -- (-601.642) [-601.285] (-601.251) (-602.974) * [-603.664] (-604.564) (-602.278) (-605.386) -- 0:00:16
738000 -- [-601.794] (-602.786) (-601.871) (-602.588) * (-602.805) (-603.034) (-602.065) [-605.373] -- 0:00:15
738500 -- (-604.007) (-600.743) [-602.060] (-608.406) * (-600.750) (-603.070) (-601.194) [-605.228] -- 0:00:15
739000 -- (-601.979) (-601.278) [-600.710] (-601.892) * [-601.110] (-603.377) (-601.773) (-609.369) -- 0:00:15
739500 -- (-601.891) (-602.907) [-602.266] (-603.775) * (-601.702) [-601.278] (-605.514) (-612.591) -- 0:00:15
740000 -- [-602.084] (-601.143) (-602.594) (-604.894) * (-602.561) (-601.417) (-607.834) [-601.931] -- 0:00:15
Average standard deviation of split frequencies: 0.008672
740500 -- (-602.574) (-601.590) (-604.326) [-600.519] * [-602.449] (-602.023) (-603.008) (-601.878) -- 0:00:15
741000 -- (-601.515) (-603.494) (-602.237) [-601.921] * [-602.173] (-600.685) (-601.716) (-600.505) -- 0:00:15
741500 -- (-601.487) (-601.446) [-603.485] (-603.839) * (-604.858) (-605.365) [-602.701] (-603.768) -- 0:00:15
742000 -- [-605.844] (-600.677) (-601.734) (-601.905) * (-603.747) [-601.448] (-602.240) (-602.367) -- 0:00:15
742500 -- (-604.442) [-602.332] (-601.369) (-603.284) * (-601.101) (-600.977) [-603.736] (-600.598) -- 0:00:15
743000 -- [-600.486] (-601.250) (-600.319) (-601.271) * (-604.049) [-601.197] (-601.004) (-600.533) -- 0:00:15
743500 -- (-601.993) (-601.814) (-600.783) [-600.833] * (-602.892) (-602.387) [-601.854] (-602.287) -- 0:00:15
744000 -- (-601.216) (-606.661) [-600.829] (-602.034) * (-601.987) [-600.629] (-604.895) (-602.215) -- 0:00:15
744500 -- [-600.597] (-605.552) (-603.429) (-601.273) * (-600.866) (-601.613) [-606.331] (-601.514) -- 0:00:15
745000 -- (-602.443) (-601.558) (-604.416) [-601.336] * (-601.464) (-601.699) (-601.057) [-601.891] -- 0:00:15
Average standard deviation of split frequencies: 0.008610
745500 -- (-602.064) [-600.996] (-604.865) (-601.676) * [-602.725] (-601.532) (-601.013) (-602.648) -- 0:00:15
746000 -- (-602.268) (-602.079) (-602.316) [-600.607] * (-603.672) (-601.896) (-601.184) [-603.079] -- 0:00:15
746500 -- [-601.137] (-606.427) (-602.429) (-600.546) * (-604.633) [-600.059] (-602.720) (-602.950) -- 0:00:15
747000 -- (-601.319) [-601.272] (-601.991) (-601.016) * [-603.277] (-600.415) (-602.779) (-600.890) -- 0:00:15
747500 -- (-600.639) (-603.266) (-601.568) [-600.867] * (-603.148) (-601.476) (-602.452) [-601.035] -- 0:00:15
748000 -- [-603.005] (-602.168) (-601.477) (-604.678) * [-600.663] (-611.567) (-601.272) (-603.727) -- 0:00:15
748500 -- (-603.754) (-600.915) [-601.213] (-608.638) * (-605.464) (-605.410) (-601.894) [-604.998] -- 0:00:15
749000 -- [-604.255] (-606.779) (-603.683) (-603.239) * (-602.109) (-604.339) [-601.394] (-601.780) -- 0:00:15
749500 -- (-600.579) (-602.000) [-601.924] (-601.321) * (-604.347) [-602.631] (-602.888) (-600.959) -- 0:00:15
750000 -- (-600.820) [-601.070] (-600.265) (-601.938) * (-602.016) [-601.715] (-603.721) (-600.982) -- 0:00:15
Average standard deviation of split frequencies: 0.008275
750500 -- [-604.260] (-604.493) (-602.476) (-600.291) * (-601.250) [-602.777] (-600.525) (-601.223) -- 0:00:14
751000 -- (-602.093) [-603.822] (-603.209) (-602.158) * (-600.221) [-601.000] (-601.564) (-603.327) -- 0:00:14
751500 -- (-603.543) (-603.291) (-600.027) [-601.187] * [-601.147] (-601.177) (-602.628) (-603.274) -- 0:00:15
752000 -- [-601.352] (-601.059) (-607.180) (-604.287) * (-603.463) [-601.716] (-601.689) (-602.042) -- 0:00:15
752500 -- (-602.998) (-600.690) [-601.480] (-602.533) * (-604.856) (-601.734) [-601.791] (-602.361) -- 0:00:15
753000 -- (-600.858) (-600.493) (-601.025) [-601.589] * (-606.334) [-604.119] (-602.105) (-604.532) -- 0:00:15
753500 -- [-600.628] (-605.088) (-600.634) (-604.173) * (-605.005) (-601.639) [-602.462] (-604.964) -- 0:00:15
754000 -- [-600.689] (-601.690) (-601.011) (-603.314) * (-601.319) (-601.145) [-602.187] (-603.357) -- 0:00:15
754500 -- (-602.041) (-601.056) [-601.495] (-600.811) * (-605.050) (-601.343) [-602.278] (-602.653) -- 0:00:14
755000 -- (-600.476) [-601.547] (-601.495) (-601.664) * (-602.798) (-602.859) (-602.657) [-602.417] -- 0:00:14
Average standard deviation of split frequencies: 0.008979
755500 -- (-603.516) (-601.161) (-602.720) [-602.249] * (-600.999) [-601.923] (-604.386) (-602.026) -- 0:00:14
756000 -- (-603.924) (-601.712) [-601.509] (-600.938) * (-603.164) (-605.510) [-602.041] (-604.069) -- 0:00:14
756500 -- (-605.088) (-601.833) (-602.095) [-603.859] * (-601.308) (-601.516) (-600.646) [-601.164] -- 0:00:14
757000 -- (-601.787) (-601.247) (-603.316) [-603.284] * (-603.457) [-600.867] (-601.664) (-604.659) -- 0:00:14
757500 -- (-601.944) (-603.869) [-602.097] (-602.388) * (-601.765) [-600.789] (-602.681) (-602.317) -- 0:00:14
758000 -- (-602.030) [-600.507] (-601.031) (-602.999) * (-601.088) (-604.730) [-605.252] (-602.529) -- 0:00:14
758500 -- (-602.322) (-602.975) [-600.570] (-601.969) * (-600.888) (-601.699) (-601.530) [-601.106] -- 0:00:14
759000 -- (-601.361) (-602.647) (-603.003) [-604.292] * (-602.310) (-601.686) [-601.980] (-602.547) -- 0:00:14
759500 -- (-603.167) (-601.035) (-602.875) [-605.288] * (-604.210) [-602.725] (-601.573) (-602.552) -- 0:00:14
760000 -- [-603.130] (-601.307) (-600.695) (-603.916) * (-603.940) [-601.231] (-602.522) (-602.837) -- 0:00:14
Average standard deviation of split frequencies: 0.008841
760500 -- [-601.732] (-602.702) (-600.828) (-599.948) * (-601.821) (-602.188) (-600.548) [-603.551] -- 0:00:14
761000 -- [-604.174] (-610.027) (-602.789) (-602.550) * (-602.836) [-601.483] (-602.694) (-607.882) -- 0:00:14
761500 -- [-601.238] (-609.425) (-601.753) (-601.460) * (-603.553) (-603.140) [-601.964] (-607.699) -- 0:00:14
762000 -- [-603.124] (-605.114) (-600.579) (-603.267) * (-603.425) (-601.387) [-602.014] (-601.842) -- 0:00:14
762500 -- (-601.231) [-602.938] (-602.694) (-603.807) * (-603.952) (-601.313) (-602.408) [-607.424] -- 0:00:14
763000 -- [-603.779] (-601.109) (-603.032) (-606.456) * (-603.569) (-604.884) [-601.409] (-602.365) -- 0:00:14
763500 -- [-603.378] (-603.787) (-600.690) (-603.028) * (-603.947) [-602.121] (-603.464) (-600.441) -- 0:00:14
764000 -- (-608.373) (-601.611) (-601.438) [-604.529] * (-602.883) (-602.527) [-604.382] (-601.422) -- 0:00:14
764500 -- (-602.208) (-601.373) (-602.881) [-603.982] * (-603.451) (-602.267) (-601.383) [-601.178] -- 0:00:14
765000 -- (-602.363) [-600.236] (-603.279) (-603.493) * (-601.788) (-601.550) (-603.865) [-602.373] -- 0:00:14
Average standard deviation of split frequencies: 0.008308
765500 -- (-601.430) (-601.388) (-607.181) [-605.699] * (-600.819) (-601.022) (-601.694) [-601.478] -- 0:00:14
766000 -- (-601.467) [-602.430] (-602.186) (-602.151) * (-602.339) (-602.510) (-600.703) [-603.674] -- 0:00:14
766500 -- (-603.548) (-603.213) [-604.872] (-602.441) * [-602.214] (-600.636) (-603.016) (-602.146) -- 0:00:14
767000 -- (-601.645) (-604.447) [-603.983] (-603.802) * (-602.322) (-602.567) (-601.304) [-600.308] -- 0:00:13
767500 -- (-601.316) (-603.576) [-602.732] (-601.832) * (-605.753) (-602.584) (-603.180) [-600.800] -- 0:00:13
768000 -- [-600.746] (-601.069) (-601.678) (-602.370) * (-604.769) (-603.509) (-603.951) [-602.209] -- 0:00:13
768500 -- (-600.328) (-600.678) [-604.291] (-601.230) * [-600.947] (-601.276) (-601.756) (-603.072) -- 0:00:14
769000 -- (-602.426) (-604.856) (-602.512) [-600.967] * (-602.361) (-601.244) (-600.148) [-604.488] -- 0:00:14
769500 -- (-606.347) (-600.949) (-600.852) [-601.665] * (-600.333) [-600.895] (-602.090) (-600.874) -- 0:00:14
770000 -- (-603.516) [-601.484] (-600.970) (-607.041) * (-603.214) (-602.455) [-601.081] (-603.326) -- 0:00:14
Average standard deviation of split frequencies: 0.008931
770500 -- [-601.907] (-600.633) (-604.431) (-605.354) * (-600.530) (-607.977) [-603.813] (-606.058) -- 0:00:13
771000 -- (-603.813) (-602.627) (-600.770) [-601.205] * (-600.551) (-604.243) (-602.112) [-604.461] -- 0:00:13
771500 -- [-601.897] (-603.713) (-601.458) (-600.850) * (-601.011) [-604.444] (-602.196) (-602.059) -- 0:00:13
772000 -- (-601.837) (-604.441) (-600.618) [-601.371] * (-602.155) (-604.292) [-602.433] (-606.632) -- 0:00:13
772500 -- (-603.196) (-602.409) [-600.607] (-601.478) * [-601.445] (-601.038) (-606.471) (-601.878) -- 0:00:13
773000 -- [-602.042] (-608.115) (-603.036) (-601.657) * (-603.687) (-604.852) [-607.713] (-603.381) -- 0:00:13
773500 -- (-603.238) (-604.082) [-602.407] (-601.518) * (-601.023) (-604.168) (-600.044) [-601.076] -- 0:00:13
774000 -- (-605.289) (-600.911) (-600.708) [-600.698] * (-603.578) [-601.686] (-600.451) (-603.183) -- 0:00:13
774500 -- (-603.180) [-601.101] (-601.106) (-602.039) * (-602.664) [-600.747] (-601.530) (-600.729) -- 0:00:13
775000 -- (-604.101) (-601.098) [-605.308] (-603.408) * [-602.319] (-601.929) (-601.488) (-602.739) -- 0:00:13
Average standard deviation of split frequencies: 0.008201
775500 -- [-603.852] (-603.083) (-603.434) (-603.020) * (-601.437) (-601.747) (-604.035) [-602.992] -- 0:00:13
776000 -- (-602.894) (-602.738) (-605.389) [-602.645] * [-605.695] (-603.257) (-604.256) (-602.290) -- 0:00:13
776500 -- (-602.028) (-601.923) [-600.135] (-601.629) * (-605.300) (-605.919) (-601.695) [-603.864] -- 0:00:13
777000 -- (-604.972) [-601.424] (-606.026) (-600.866) * (-608.555) [-602.434] (-603.384) (-600.664) -- 0:00:13
777500 -- (-601.297) (-602.173) (-603.114) [-601.155] * (-602.229) (-604.509) (-603.292) [-600.612] -- 0:00:13
778000 -- (-600.421) (-603.356) [-600.933] (-603.113) * (-602.487) (-605.469) (-603.694) [-602.449] -- 0:00:13
778500 -- [-607.444] (-604.871) (-602.080) (-601.743) * (-601.798) [-600.675] (-602.933) (-605.312) -- 0:00:13
779000 -- (-601.285) (-602.871) [-601.516] (-604.101) * (-601.247) [-601.294] (-601.718) (-601.817) -- 0:00:13
779500 -- (-601.419) (-609.994) (-602.608) [-603.706] * [-601.604] (-602.833) (-602.407) (-601.492) -- 0:00:13
780000 -- (-601.365) (-604.843) (-604.126) [-601.244] * (-601.863) (-600.596) (-600.953) [-601.087] -- 0:00:13
Average standard deviation of split frequencies: 0.008529
780500 -- (-602.090) [-603.837] (-603.854) (-605.734) * (-603.139) (-601.026) [-603.178] (-601.999) -- 0:00:13
781000 -- (-605.064) [-600.295] (-602.368) (-602.560) * (-604.826) [-601.184] (-604.378) (-602.427) -- 0:00:13
781500 -- (-602.284) (-600.932) [-606.814] (-602.523) * [-607.251] (-601.695) (-600.832) (-605.396) -- 0:00:13
782000 -- (-600.359) (-600.866) [-601.828] (-602.132) * (-603.429) (-604.203) (-604.044) [-602.432] -- 0:00:13
782500 -- (-605.597) (-600.799) [-605.965] (-601.679) * (-602.043) (-605.172) [-600.028] (-604.125) -- 0:00:13
783000 -- (-601.548) (-603.653) [-601.468] (-602.613) * (-601.570) (-604.736) (-600.621) [-604.675] -- 0:00:13
783500 -- [-600.732] (-601.512) (-601.147) (-604.735) * (-603.063) (-600.702) [-602.252] (-603.332) -- 0:00:12
784000 -- [-601.704] (-601.992) (-601.761) (-600.163) * (-604.541) (-601.046) (-600.490) [-603.894] -- 0:00:12
784500 -- (-601.223) [-600.812] (-601.979) (-603.698) * [-601.493] (-604.689) (-600.703) (-603.005) -- 0:00:12
785000 -- (-601.018) (-600.798) (-603.905) [-605.639] * (-600.226) (-602.120) [-600.977] (-603.561) -- 0:00:12
Average standard deviation of split frequencies: 0.008471
785500 -- (-600.840) [-600.772] (-603.228) (-602.902) * (-602.636) (-600.676) [-605.098] (-604.945) -- 0:00:13
786000 -- (-600.405) (-603.039) [-600.439] (-601.284) * (-601.680) (-602.761) [-609.096] (-601.149) -- 0:00:13
786500 -- (-602.104) (-600.697) [-602.285] (-601.197) * (-603.838) (-603.799) (-605.507) [-601.191] -- 0:00:13
787000 -- (-603.161) (-601.080) [-601.610] (-601.647) * (-605.994) [-603.107] (-601.796) (-599.896) -- 0:00:12
787500 -- (-604.687) (-600.475) (-601.744) [-601.820] * (-608.567) (-603.559) (-600.982) [-600.773] -- 0:00:12
788000 -- [-601.037] (-600.507) (-601.760) (-603.390) * (-603.632) (-601.877) [-601.740] (-601.663) -- 0:00:12
788500 -- (-605.537) (-600.669) (-603.132) [-605.010] * (-603.558) (-603.168) (-601.723) [-603.139] -- 0:00:12
789000 -- (-600.525) [-601.216] (-602.585) (-602.889) * (-601.164) (-602.133) (-604.832) [-603.322] -- 0:00:12
789500 -- (-604.787) [-600.447] (-602.753) (-602.083) * (-603.184) (-601.746) (-602.545) [-601.802] -- 0:00:12
790000 -- (-600.852) [-602.702] (-602.371) (-603.745) * (-601.484) (-605.877) [-603.715] (-602.259) -- 0:00:12
Average standard deviation of split frequencies: 0.008347
790500 -- (-610.428) (-600.355) [-602.363] (-603.270) * (-601.637) [-603.856] (-602.957) (-603.480) -- 0:00:12
791000 -- (-602.877) (-603.768) [-604.875] (-602.493) * [-601.546] (-604.669) (-602.081) (-603.334) -- 0:00:12
791500 -- (-602.194) (-603.991) (-601.767) [-600.699] * (-601.562) [-604.463] (-604.652) (-600.603) -- 0:00:12
792000 -- [-601.217] (-602.257) (-602.629) (-603.007) * (-602.105) (-601.148) (-604.168) [-600.970] -- 0:00:12
792500 -- (-602.389) [-602.285] (-601.018) (-604.710) * [-600.993] (-602.545) (-609.293) (-601.104) -- 0:00:12
793000 -- [-602.935] (-601.316) (-601.131) (-601.950) * (-601.690) (-602.156) [-600.563] (-607.936) -- 0:00:12
793500 -- (-601.686) [-600.916] (-602.566) (-600.979) * (-603.363) [-599.965] (-600.583) (-602.894) -- 0:00:12
794000 -- (-601.579) (-600.903) (-600.960) [-600.832] * (-601.429) (-601.453) [-600.636] (-601.135) -- 0:00:12
794500 -- [-602.571] (-601.073) (-600.503) (-601.433) * (-601.492) [-600.693] (-605.342) (-600.565) -- 0:00:12
795000 -- (-602.527) (-604.330) (-604.379) [-600.598] * (-601.702) [-601.067] (-607.256) (-602.422) -- 0:00:12
Average standard deviation of split frequencies: 0.008488
795500 -- [-603.030] (-603.860) (-603.742) (-605.255) * [-601.722] (-600.911) (-601.458) (-600.952) -- 0:00:12
796000 -- (-604.765) (-601.879) [-603.243] (-605.110) * (-601.774) (-603.373) [-601.437] (-600.149) -- 0:00:12
796500 -- (-603.881) (-601.262) (-601.320) [-600.935] * (-602.365) (-602.215) [-601.929] (-603.097) -- 0:00:12
797000 -- (-602.124) [-601.990] (-605.580) (-602.680) * (-600.785) [-600.948] (-600.492) (-602.817) -- 0:00:12
797500 -- (-601.548) (-600.945) [-605.535] (-603.908) * (-605.668) (-601.032) (-605.605) [-604.308] -- 0:00:12
798000 -- (-601.582) (-600.931) [-601.091] (-606.195) * (-600.876) [-600.112] (-606.866) (-601.742) -- 0:00:12
798500 -- (-600.600) [-602.416] (-601.730) (-602.148) * (-601.621) (-603.803) [-603.214] (-609.620) -- 0:00:12
799000 -- (-602.903) (-602.550) (-606.552) [-601.462] * (-601.486) (-600.744) (-600.636) [-602.890] -- 0:00:12
799500 -- (-600.668) [-600.245] (-604.523) (-601.533) * (-606.555) (-604.346) (-605.041) [-603.519] -- 0:00:12
800000 -- (-601.561) (-602.543) (-609.419) [-602.879] * (-603.812) (-601.101) [-605.211] (-602.663) -- 0:00:12
Average standard deviation of split frequencies: 0.008360
800500 -- (-600.879) [-601.054] (-602.736) (-602.969) * (-605.512) (-602.379) [-603.537] (-601.973) -- 0:00:11
801000 -- (-602.489) (-603.974) (-602.013) [-601.971] * (-605.480) [-602.404] (-602.710) (-601.341) -- 0:00:11
801500 -- (-604.432) (-602.155) (-603.228) [-600.615] * (-603.543) [-604.531] (-604.745) (-603.795) -- 0:00:11
802000 -- (-603.800) [-605.731] (-600.787) (-605.244) * (-600.867) (-604.486) [-602.279] (-601.086) -- 0:00:12
802500 -- (-600.661) (-607.873) (-601.694) [-601.457] * (-602.037) [-601.721] (-605.737) (-603.774) -- 0:00:12
803000 -- (-602.889) (-605.211) [-600.822] (-604.073) * (-604.828) [-602.860] (-602.807) (-603.103) -- 0:00:12
803500 -- (-602.620) (-604.017) (-603.909) [-602.773] * [-601.927] (-600.206) (-601.006) (-600.932) -- 0:00:11
804000 -- (-601.850) (-601.926) [-601.080] (-606.343) * (-601.100) (-601.054) (-602.840) [-600.993] -- 0:00:11
804500 -- (-601.280) (-601.779) (-603.879) [-600.431] * (-601.859) (-604.163) (-600.730) [-601.154] -- 0:00:11
805000 -- [-601.865] (-601.695) (-601.879) (-602.969) * (-600.108) (-602.269) [-602.612] (-600.811) -- 0:00:11
Average standard deviation of split frequencies: 0.007759
805500 -- (-605.348) [-600.912] (-601.956) (-603.058) * (-601.570) (-602.359) [-603.547] (-602.466) -- 0:00:11
806000 -- [-600.842] (-601.407) (-603.484) (-601.153) * (-605.875) [-601.386] (-602.784) (-601.893) -- 0:00:11
806500 -- (-609.048) (-600.284) [-604.030] (-604.396) * [-601.790] (-601.533) (-603.899) (-601.236) -- 0:00:11
807000 -- (-605.667) (-601.593) (-601.272) [-601.348] * (-600.534) (-601.798) (-602.256) [-602.255] -- 0:00:11
807500 -- (-603.424) (-603.290) [-600.874] (-601.656) * (-600.389) [-600.831] (-601.192) (-601.787) -- 0:00:11
808000 -- (-604.055) (-605.204) (-601.886) [-603.351] * (-603.642) [-601.258] (-602.706) (-604.120) -- 0:00:11
808500 -- (-602.560) [-601.994] (-600.293) (-601.419) * [-612.166] (-606.599) (-600.177) (-603.193) -- 0:00:11
809000 -- (-602.223) (-602.291) [-600.443] (-603.235) * [-604.081] (-601.981) (-601.042) (-601.942) -- 0:00:11
809500 -- [-606.946] (-602.502) (-600.651) (-604.547) * [-601.411] (-606.425) (-601.710) (-603.492) -- 0:00:11
810000 -- [-603.867] (-608.404) (-601.013) (-606.096) * (-601.327) [-607.681] (-601.132) (-605.813) -- 0:00:11
Average standard deviation of split frequencies: 0.007560
810500 -- (-606.492) (-606.113) (-603.735) [-602.346] * (-600.017) (-602.449) [-600.019] (-601.929) -- 0:00:11
811000 -- (-604.901) [-601.956] (-606.031) (-602.657) * [-601.698] (-601.973) (-603.554) (-605.316) -- 0:00:11
811500 -- (-602.144) [-601.335] (-608.187) (-605.683) * (-602.228) (-603.796) (-605.042) [-602.348] -- 0:00:11
812000 -- (-602.960) (-600.152) [-601.869] (-600.632) * [-603.910] (-602.057) (-602.365) (-602.457) -- 0:00:11
812500 -- (-602.077) [-602.760] (-603.673) (-602.875) * (-602.641) (-600.704) (-601.372) [-602.376] -- 0:00:11
813000 -- (-602.060) (-602.403) (-601.219) [-603.158] * [-601.288] (-602.869) (-602.112) (-601.351) -- 0:00:11
813500 -- (-600.679) (-605.625) (-603.910) [-602.997] * (-600.995) (-602.247) [-602.147] (-602.317) -- 0:00:11
814000 -- (-604.952) (-602.900) [-602.498] (-603.759) * (-604.061) (-602.075) (-600.979) [-601.694] -- 0:00:11
814500 -- (-605.447) [-603.693] (-602.660) (-603.035) * [-605.944] (-600.780) (-604.341) (-601.173) -- 0:00:11
815000 -- (-602.170) (-600.955) (-601.907) [-601.782] * [-602.081] (-602.640) (-604.878) (-602.540) -- 0:00:11
Average standard deviation of split frequencies: 0.007780
815500 -- [-603.007] (-601.373) (-601.326) (-602.496) * [-602.138] (-601.959) (-605.079) (-603.233) -- 0:00:11
816000 -- (-603.835) (-603.216) [-601.290] (-603.831) * (-603.445) (-601.195) [-601.847] (-600.330) -- 0:00:11
816500 -- [-606.812] (-605.326) (-601.993) (-602.139) * (-602.285) (-604.760) [-605.249] (-603.122) -- 0:00:11
817000 -- [-600.320] (-605.018) (-603.231) (-602.150) * (-603.835) [-600.902] (-603.963) (-603.862) -- 0:00:10
817500 -- (-600.834) (-602.780) [-601.668] (-602.719) * (-601.398) (-602.131) (-603.647) [-606.889] -- 0:00:10
818000 -- (-600.506) [-604.611] (-602.006) (-604.015) * (-604.508) [-602.248] (-605.121) (-603.649) -- 0:00:10
818500 -- (-601.359) (-601.378) (-602.021) [-603.968] * (-600.572) (-604.746) (-607.714) [-606.572] -- 0:00:10
819000 -- (-601.815) (-603.564) [-601.499] (-602.873) * [-600.512] (-602.010) (-600.274) (-600.934) -- 0:00:11
819500 -- (-604.542) (-605.702) [-601.583] (-603.791) * [-605.071] (-605.592) (-604.642) (-601.456) -- 0:00:11
820000 -- (-610.503) [-605.704] (-601.026) (-600.668) * [-605.060] (-603.617) (-601.837) (-601.810) -- 0:00:10
Average standard deviation of split frequencies: 0.008233
820500 -- (-601.995) [-601.879] (-600.381) (-601.265) * (-604.744) [-602.194] (-603.306) (-603.443) -- 0:00:10
821000 -- (-600.912) (-605.075) [-600.565] (-600.816) * (-602.513) [-601.692] (-601.774) (-601.268) -- 0:00:10
821500 -- (-600.356) (-601.724) (-600.569) [-600.407] * [-601.041] (-603.210) (-601.287) (-601.537) -- 0:00:10
822000 -- (-603.267) (-603.937) [-601.911] (-602.829) * (-600.023) (-603.790) [-600.756] (-600.778) -- 0:00:10
822500 -- [-605.213] (-604.159) (-602.537) (-601.758) * (-600.906) (-601.520) (-602.167) [-601.457] -- 0:00:10
823000 -- (-604.385) (-603.616) [-604.850] (-602.779) * (-602.372) (-602.197) (-602.444) [-600.945] -- 0:00:10
823500 -- [-601.714] (-601.796) (-604.886) (-603.053) * (-601.402) (-600.227) [-601.922] (-601.112) -- 0:00:10
824000 -- (-603.749) [-602.354] (-603.606) (-603.997) * (-600.964) (-604.525) [-601.500] (-602.190) -- 0:00:10
824500 -- [-601.742] (-601.893) (-601.247) (-602.298) * [-600.648] (-606.021) (-603.665) (-601.924) -- 0:00:10
825000 -- [-601.405] (-603.104) (-601.480) (-601.666) * [-600.526] (-603.296) (-605.265) (-601.933) -- 0:00:10
Average standard deviation of split frequencies: 0.008066
825500 -- (-600.426) (-602.081) [-606.231] (-600.635) * (-600.568) [-601.968] (-603.421) (-605.280) -- 0:00:10
826000 -- [-600.320] (-601.197) (-607.057) (-601.310) * (-600.855) (-605.700) [-602.942] (-601.099) -- 0:00:10
826500 -- [-600.604] (-603.121) (-604.117) (-604.456) * [-602.376] (-601.692) (-600.448) (-602.899) -- 0:00:10
827000 -- [-605.346] (-602.221) (-601.618) (-604.926) * (-601.638) [-601.996] (-601.910) (-603.812) -- 0:00:10
827500 -- (-607.320) (-601.727) [-603.882] (-604.883) * [-601.002] (-600.867) (-607.442) (-601.511) -- 0:00:10
828000 -- [-607.794] (-603.001) (-603.282) (-600.135) * (-601.283) (-607.383) [-605.211] (-602.429) -- 0:00:10
828500 -- (-606.373) (-601.339) (-603.818) [-600.680] * (-601.496) (-600.233) [-604.608] (-600.846) -- 0:00:10
829000 -- [-608.090] (-602.226) (-606.817) (-602.527) * [-603.064] (-603.149) (-605.107) (-601.850) -- 0:00:10
829500 -- (-602.250) (-602.798) (-604.366) [-600.922] * (-602.026) [-601.865] (-601.068) (-600.800) -- 0:00:10
830000 -- (-604.021) (-603.248) [-601.597] (-603.425) * [-602.332] (-604.345) (-600.769) (-605.597) -- 0:00:10
Average standard deviation of split frequencies: 0.008021
830500 -- [-603.400] (-601.195) (-604.551) (-600.120) * [-601.879] (-601.329) (-605.491) (-602.024) -- 0:00:10
831000 -- (-604.220) (-602.049) [-600.303] (-601.686) * [-604.683] (-600.803) (-601.710) (-600.486) -- 0:00:10
831500 -- (-601.967) (-602.091) (-601.772) [-602.371] * (-603.129) (-603.140) [-602.266] (-600.920) -- 0:00:10
832000 -- (-607.368) (-602.413) [-602.187] (-601.172) * (-601.155) (-601.245) (-601.812) [-604.228] -- 0:00:10
832500 -- (-604.355) (-601.629) (-604.066) [-601.715] * [-602.987] (-602.525) (-605.943) (-602.891) -- 0:00:10
833000 -- (-602.728) [-603.152] (-601.392) (-602.251) * (-604.380) [-603.014] (-603.464) (-601.355) -- 0:00:10
833500 -- [-602.565] (-603.692) (-602.061) (-601.515) * (-602.724) (-602.582) [-601.952] (-602.974) -- 0:00:09
834000 -- [-600.724] (-602.158) (-602.302) (-603.742) * [-603.031] (-601.483) (-606.131) (-602.472) -- 0:00:09
834500 -- [-601.430] (-602.158) (-603.269) (-604.079) * (-602.178) (-604.352) (-602.615) [-601.769] -- 0:00:09
835000 -- (-601.864) (-603.207) (-602.798) [-601.730] * (-602.972) [-604.912] (-601.131) (-602.038) -- 0:00:09
Average standard deviation of split frequencies: 0.008157
835500 -- [-601.503] (-600.784) (-603.358) (-601.955) * [-603.900] (-601.490) (-602.252) (-602.155) -- 0:00:10
836000 -- (-602.933) [-603.729] (-602.159) (-603.279) * (-604.891) (-601.920) (-601.578) [-604.009] -- 0:00:10
836500 -- (-601.338) (-600.763) (-606.399) [-602.435] * (-604.850) (-603.502) [-600.993] (-603.577) -- 0:00:09
837000 -- (-600.918) (-601.683) [-602.370] (-604.053) * (-605.018) [-603.615] (-602.451) (-602.737) -- 0:00:09
837500 -- (-601.084) [-600.740] (-601.145) (-600.732) * (-602.373) [-603.379] (-603.174) (-603.698) -- 0:00:09
838000 -- [-602.396] (-601.342) (-602.554) (-600.285) * (-601.400) (-602.010) (-602.086) [-601.040] -- 0:00:09
838500 -- (-602.703) (-601.605) (-601.225) [-601.000] * (-601.445) [-602.776] (-602.261) (-606.716) -- 0:00:09
839000 -- (-601.081) [-600.717] (-601.949) (-601.693) * (-602.920) [-602.306] (-601.556) (-604.791) -- 0:00:09
839500 -- (-602.868) [-600.878] (-603.060) (-601.869) * (-601.527) [-603.669] (-602.903) (-602.474) -- 0:00:09
840000 -- [-600.503] (-602.595) (-602.030) (-601.395) * (-601.558) [-601.465] (-601.505) (-601.677) -- 0:00:09
Average standard deviation of split frequencies: 0.008306
840500 -- (-602.746) (-602.887) [-602.465] (-603.841) * (-602.830) (-601.913) [-602.104] (-600.574) -- 0:00:09
841000 -- (-601.885) (-601.052) [-601.456] (-601.352) * (-602.892) [-601.673] (-603.885) (-601.260) -- 0:00:09
841500 -- (-604.619) [-602.637] (-602.276) (-602.716) * (-602.347) (-604.243) (-602.524) [-601.838] -- 0:00:09
842000 -- (-602.774) (-600.546) (-601.012) [-601.262] * (-602.088) (-602.626) (-602.326) [-603.411] -- 0:00:09
842500 -- (-601.632) (-600.744) [-606.675] (-601.356) * [-601.176] (-601.655) (-603.480) (-600.374) -- 0:00:09
843000 -- [-605.904] (-602.824) (-605.691) (-603.273) * (-601.201) (-602.129) [-601.296] (-601.950) -- 0:00:09
843500 -- (-603.556) (-604.816) [-602.208] (-602.566) * [-605.015] (-605.307) (-603.438) (-602.222) -- 0:00:09
844000 -- (-604.708) (-601.425) (-604.018) [-601.361] * (-603.073) (-603.318) [-603.935] (-604.275) -- 0:00:09
844500 -- (-603.647) [-601.151] (-605.938) (-601.538) * [-602.824] (-601.396) (-603.319) (-601.198) -- 0:00:09
845000 -- (-601.540) (-600.888) (-606.102) [-600.784] * (-602.219) (-602.080) (-603.381) [-600.544] -- 0:00:09
Average standard deviation of split frequencies: 0.007836
845500 -- (-601.868) (-600.647) [-601.352] (-605.164) * (-602.987) (-601.187) (-603.596) [-603.204] -- 0:00:09
846000 -- (-602.060) (-603.984) (-600.891) [-604.030] * (-603.883) [-601.266] (-601.172) (-600.594) -- 0:00:09
846500 -- [-604.718] (-603.663) (-603.832) (-604.624) * (-601.898) (-601.881) (-604.456) [-600.206] -- 0:00:09
847000 -- [-601.811] (-601.893) (-600.843) (-603.039) * (-602.585) [-601.570] (-603.600) (-603.602) -- 0:00:09
847500 -- (-601.670) [-601.448] (-601.868) (-610.914) * (-601.817) (-601.080) [-602.038] (-600.224) -- 0:00:09
848000 -- (-600.773) (-606.858) [-602.302] (-607.934) * (-601.656) (-601.330) (-603.762) [-601.507] -- 0:00:09
848500 -- [-600.732] (-600.433) (-601.904) (-607.458) * (-604.114) (-602.150) (-602.531) [-601.431] -- 0:00:09
849000 -- (-601.683) (-601.574) (-602.942) [-605.912] * [-601.382] (-601.317) (-601.968) (-605.184) -- 0:00:09
849500 -- (-602.555) [-602.057] (-600.256) (-607.307) * (-600.922) [-600.825] (-600.491) (-609.303) -- 0:00:09
850000 -- [-602.776] (-603.550) (-601.782) (-603.197) * (-601.154) (-603.518) [-600.467] (-604.440) -- 0:00:09
Average standard deviation of split frequencies: 0.007758
850500 -- (-605.247) (-602.851) [-603.140] (-611.883) * (-603.441) (-602.091) [-600.301] (-603.314) -- 0:00:08
851000 -- (-603.447) (-602.407) [-602.820] (-603.082) * (-603.811) (-601.279) (-601.740) [-602.416] -- 0:00:08
851500 -- (-603.802) [-606.591] (-600.946) (-605.883) * (-603.760) (-603.479) [-601.611] (-600.522) -- 0:00:08
852000 -- (-602.753) (-604.168) [-601.359] (-604.717) * (-601.248) (-602.424) (-604.226) [-601.747] -- 0:00:08
852500 -- [-603.567] (-601.616) (-603.417) (-604.108) * (-600.808) (-607.769) (-601.719) [-600.199] -- 0:00:08
853000 -- (-603.309) (-603.456) (-601.518) [-608.069] * (-603.723) (-606.427) (-601.437) [-600.974] -- 0:00:08
853500 -- (-600.357) (-602.879) (-601.807) [-603.241] * (-601.867) (-602.412) (-602.787) [-605.573] -- 0:00:08
854000 -- [-603.080] (-602.072) (-601.440) (-601.625) * (-602.828) (-602.984) [-601.242] (-602.134) -- 0:00:08
854500 -- (-601.837) (-601.765) [-602.164] (-602.968) * (-601.655) [-603.348] (-603.781) (-601.245) -- 0:00:08
855000 -- [-600.655] (-600.888) (-600.332) (-602.588) * (-601.183) (-601.224) (-602.114) [-601.755] -- 0:00:08
Average standard deviation of split frequencies: 0.008077
855500 -- (-602.044) (-603.569) [-600.977] (-604.072) * (-602.969) (-600.310) (-603.973) [-602.872] -- 0:00:08
856000 -- [-601.351] (-602.725) (-601.751) (-603.253) * (-605.008) (-600.146) (-603.925) [-604.549] -- 0:00:08
856500 -- [-602.188] (-604.791) (-600.856) (-601.868) * [-602.615] (-602.703) (-605.168) (-604.800) -- 0:00:08
857000 -- [-602.003] (-602.469) (-607.970) (-601.361) * (-603.399) [-600.937] (-602.517) (-606.982) -- 0:00:08
857500 -- (-605.553) (-601.031) (-602.424) [-601.128] * (-605.676) (-602.439) [-603.218] (-602.271) -- 0:00:08
858000 -- [-603.578] (-603.993) (-602.256) (-600.755) * (-601.053) (-605.908) (-605.253) [-608.106] -- 0:00:08
858500 -- (-601.213) [-602.029] (-602.332) (-600.943) * (-602.761) (-604.471) [-603.341] (-603.093) -- 0:00:08
859000 -- [-602.092] (-601.918) (-604.951) (-601.547) * (-601.004) (-602.540) [-603.230] (-601.843) -- 0:00:08
859500 -- (-601.797) (-601.239) (-600.896) [-602.700] * (-601.575) (-603.144) (-601.836) [-606.205] -- 0:00:08
860000 -- (-603.097) [-601.725] (-604.394) (-605.927) * (-602.543) (-606.734) [-602.482] (-606.190) -- 0:00:08
Average standard deviation of split frequencies: 0.008033
860500 -- (-602.009) (-601.532) (-602.129) [-603.511] * (-604.808) (-603.855) [-604.211] (-601.078) -- 0:00:08
861000 -- [-602.967] (-604.211) (-606.806) (-603.278) * (-601.136) (-602.284) (-600.697) [-600.842] -- 0:00:08
861500 -- (-601.629) [-604.251] (-601.725) (-607.395) * (-604.116) [-603.955] (-603.143) (-602.417) -- 0:00:08
862000 -- [-600.536] (-601.643) (-601.818) (-600.819) * (-606.360) [-600.548] (-601.847) (-601.635) -- 0:00:08
862500 -- [-601.778] (-602.991) (-602.810) (-603.374) * (-601.778) [-604.484] (-600.841) (-601.948) -- 0:00:08
863000 -- (-604.659) [-600.824] (-603.232) (-603.472) * [-602.884] (-604.577) (-602.159) (-600.708) -- 0:00:08
863500 -- [-602.147] (-601.047) (-603.644) (-603.008) * [-602.286] (-602.929) (-603.101) (-602.983) -- 0:00:08
864000 -- [-601.840] (-600.807) (-608.290) (-602.510) * (-603.291) [-601.572] (-603.027) (-606.263) -- 0:00:08
864500 -- [-600.765] (-601.298) (-602.381) (-603.910) * [-603.404] (-602.491) (-601.841) (-612.201) -- 0:00:08
865000 -- (-605.223) (-601.788) [-601.938] (-603.455) * (-601.103) (-601.893) (-601.314) [-600.866] -- 0:00:08
Average standard deviation of split frequencies: 0.007585
865500 -- (-602.379) [-601.204] (-602.139) (-603.747) * [-601.923] (-604.040) (-600.636) (-601.406) -- 0:00:08
866000 -- [-600.419] (-602.265) (-600.886) (-600.860) * (-601.308) (-601.888) [-604.811] (-603.408) -- 0:00:08
866500 -- (-602.197) [-603.975] (-604.972) (-600.979) * [-605.612] (-601.464) (-601.330) (-601.932) -- 0:00:08
867000 -- (-603.445) [-604.764] (-601.900) (-601.265) * [-602.841] (-603.953) (-603.900) (-601.501) -- 0:00:07
867500 -- (-601.457) (-602.504) (-600.742) [-603.057] * (-602.364) (-606.026) [-602.834] (-603.402) -- 0:00:07
868000 -- (-611.023) [-603.331] (-602.099) (-601.780) * [-601.822] (-601.666) (-604.123) (-602.656) -- 0:00:07
868500 -- (-602.837) [-601.737] (-603.483) (-600.946) * (-600.570) (-602.052) [-601.700] (-600.632) -- 0:00:07
869000 -- [-600.868] (-601.393) (-604.466) (-600.966) * [-601.394] (-605.399) (-602.197) (-600.925) -- 0:00:07
869500 -- (-601.833) [-604.687] (-604.649) (-602.289) * (-600.640) (-601.033) (-600.645) [-600.925] -- 0:00:07
870000 -- (-601.592) [-602.821] (-606.054) (-601.769) * (-603.531) (-601.612) (-600.868) [-601.024] -- 0:00:07
Average standard deviation of split frequencies: 0.008049
870500 -- [-600.181] (-606.431) (-601.716) (-600.518) * [-603.283] (-603.519) (-601.811) (-602.097) -- 0:00:07
871000 -- (-603.005) [-605.960] (-604.462) (-600.982) * (-601.416) (-606.535) (-602.304) [-602.993] -- 0:00:07
871500 -- (-601.062) (-601.117) (-604.611) [-601.469] * (-604.187) (-600.415) (-602.421) [-601.807] -- 0:00:07
872000 -- (-600.307) (-602.304) [-603.412] (-603.734) * (-601.996) (-601.233) [-603.178] (-603.952) -- 0:00:07
872500 -- (-602.640) [-602.486] (-603.457) (-602.851) * (-601.999) [-600.494] (-604.728) (-603.649) -- 0:00:07
873000 -- (-600.831) (-604.290) (-601.063) [-603.295] * [-600.784] (-601.396) (-603.086) (-600.973) -- 0:00:07
873500 -- (-601.330) (-601.484) (-600.831) [-604.818] * (-607.399) (-602.054) (-602.467) [-600.371] -- 0:00:07
874000 -- [-601.585] (-601.370) (-601.659) (-604.567) * (-603.388) [-602.319] (-601.397) (-601.367) -- 0:00:07
874500 -- (-600.088) (-602.550) [-600.924] (-600.770) * (-603.554) (-602.926) [-601.302] (-600.044) -- 0:00:07
875000 -- (-601.519) (-604.726) (-605.209) [-601.320] * (-601.607) [-601.211] (-602.367) (-600.317) -- 0:00:07
Average standard deviation of split frequencies: 0.008000
875500 -- (-601.297) (-602.086) [-603.227] (-601.753) * (-602.766) [-601.187] (-602.557) (-601.550) -- 0:00:07
876000 -- (-601.897) [-600.519] (-609.195) (-601.692) * (-604.490) (-602.157) [-602.153] (-603.243) -- 0:00:07
876500 -- [-601.567] (-602.935) (-608.367) (-603.748) * [-601.511] (-601.538) (-604.636) (-608.167) -- 0:00:07
877000 -- (-602.437) [-602.937] (-605.300) (-603.557) * [-604.014] (-603.399) (-606.986) (-601.816) -- 0:00:07
877500 -- (-601.380) (-605.488) (-603.344) [-603.830] * (-603.397) (-603.371) [-601.651] (-600.960) -- 0:00:07
878000 -- (-600.328) (-602.917) (-602.875) [-603.585] * (-602.423) [-603.509] (-601.826) (-600.528) -- 0:00:07
878500 -- (-601.882) [-602.935] (-600.414) (-601.119) * (-601.341) (-602.722) [-600.216] (-601.777) -- 0:00:07
879000 -- [-601.109] (-603.353) (-600.646) (-601.188) * (-603.496) (-602.636) (-601.481) [-601.314] -- 0:00:07
879500 -- (-602.237) (-605.239) (-601.712) [-601.592] * (-605.193) (-602.472) [-605.600] (-603.629) -- 0:00:07
880000 -- [-601.322] (-603.236) (-604.554) (-602.025) * (-600.939) (-602.559) [-603.046] (-601.065) -- 0:00:07
Average standard deviation of split frequencies: 0.007744
880500 -- (-603.658) (-603.239) (-606.319) [-601.621] * (-602.137) (-600.819) (-600.770) [-602.321] -- 0:00:07
881000 -- [-601.641] (-602.432) (-604.594) (-601.644) * (-602.172) (-601.242) (-601.147) [-601.462] -- 0:00:07
881500 -- (-600.987) (-602.248) [-602.055] (-601.588) * (-604.242) [-601.561] (-601.319) (-602.733) -- 0:00:07
882000 -- (-603.796) [-601.405] (-603.299) (-600.418) * (-602.708) [-604.593] (-604.248) (-603.075) -- 0:00:07
882500 -- (-601.700) (-601.395) (-601.777) [-602.292] * (-601.546) (-607.536) (-601.277) [-600.856] -- 0:00:07
883000 -- (-600.237) (-601.392) [-602.829] (-602.549) * (-601.239) (-603.863) [-602.235] (-605.686) -- 0:00:07
883500 -- (-602.202) [-600.742] (-603.412) (-603.676) * [-603.379] (-601.335) (-604.960) (-602.450) -- 0:00:06
884000 -- [-601.526] (-602.581) (-601.440) (-605.996) * [-601.811] (-603.836) (-600.966) (-601.421) -- 0:00:06
884500 -- (-600.781) (-602.166) [-603.989] (-600.350) * [-603.996] (-607.634) (-604.064) (-602.075) -- 0:00:06
885000 -- (-600.929) (-600.775) (-601.560) [-607.540] * [-600.594] (-603.037) (-608.459) (-600.552) -- 0:00:06
Average standard deviation of split frequencies: 0.007484
885500 -- (-600.393) (-602.482) (-601.033) [-602.642] * (-602.298) (-601.422) [-603.030] (-601.037) -- 0:00:06
886000 -- (-606.637) [-602.069] (-601.021) (-600.904) * (-601.265) [-600.480] (-602.059) (-601.017) -- 0:00:06
886500 -- [-602.632] (-601.708) (-601.174) (-601.542) * (-601.012) (-600.368) [-602.041] (-600.205) -- 0:00:06
887000 -- [-602.561] (-601.651) (-602.250) (-602.842) * (-600.460) [-602.237] (-605.997) (-600.083) -- 0:00:06
887500 -- (-600.721) (-600.652) [-601.682] (-607.925) * [-601.701] (-604.881) (-603.380) (-603.738) -- 0:00:06
888000 -- [-603.089] (-606.164) (-600.044) (-606.050) * (-601.209) (-601.974) [-602.012] (-601.999) -- 0:00:06
888500 -- (-601.470) (-600.624) (-603.347) [-605.175] * [-600.981] (-605.535) (-600.401) (-601.201) -- 0:00:06
889000 -- (-604.544) (-600.966) (-603.928) [-603.936] * [-602.210] (-601.539) (-604.015) (-602.687) -- 0:00:06
889500 -- (-604.891) [-601.049] (-601.735) (-601.041) * (-604.539) (-601.883) (-606.151) [-601.395] -- 0:00:06
890000 -- [-603.099] (-601.744) (-602.907) (-604.785) * (-601.378) [-602.986] (-600.403) (-600.994) -- 0:00:06
Average standard deviation of split frequencies: 0.007727
890500 -- (-602.860) (-602.205) (-600.973) [-603.248] * (-601.501) (-601.394) (-602.538) [-602.690] -- 0:00:06
891000 -- (-602.486) (-603.246) [-602.346] (-602.600) * [-601.451] (-603.227) (-602.661) (-603.794) -- 0:00:06
891500 -- [-600.987] (-600.627) (-603.554) (-601.259) * (-602.789) (-604.153) (-600.831) [-600.888] -- 0:00:06
892000 -- [-602.853] (-601.063) (-600.732) (-600.719) * [-603.991] (-604.552) (-602.701) (-601.107) -- 0:00:06
892500 -- (-601.444) (-607.394) [-602.469] (-600.233) * (-601.370) [-606.616] (-600.672) (-602.523) -- 0:00:06
893000 -- [-600.828] (-600.681) (-601.792) (-604.148) * [-600.995] (-601.399) (-604.957) (-600.663) -- 0:00:06
893500 -- [-603.770] (-603.438) (-600.858) (-601.311) * [-600.656] (-601.716) (-602.302) (-601.553) -- 0:00:06
894000 -- (-602.270) [-603.846] (-601.344) (-603.614) * (-607.585) (-601.382) [-601.560] (-607.694) -- 0:00:06
894500 -- (-601.980) (-602.938) (-600.863) [-600.675] * [-602.376] (-601.237) (-603.613) (-601.745) -- 0:00:06
895000 -- (-604.324) [-603.042] (-601.680) (-602.035) * (-600.753) (-604.743) [-603.660] (-600.755) -- 0:00:06
Average standard deviation of split frequencies: 0.007646
895500 -- (-603.870) (-603.536) (-601.312) [-602.179] * (-612.882) (-605.191) [-604.613] (-602.862) -- 0:00:06
896000 -- (-603.913) (-604.000) (-602.428) [-602.075] * (-613.066) [-603.231] (-601.524) (-602.344) -- 0:00:06
896500 -- (-600.202) (-602.112) (-604.373) [-601.436] * [-606.193] (-602.811) (-602.910) (-601.333) -- 0:00:06
897000 -- [-601.820] (-604.632) (-606.491) (-600.375) * [-601.770] (-606.871) (-603.061) (-601.616) -- 0:00:06
897500 -- [-601.600] (-601.691) (-608.913) (-603.621) * (-600.696) (-605.611) (-605.214) [-603.908] -- 0:00:06
898000 -- [-603.931] (-604.115) (-602.540) (-603.016) * [-601.910] (-600.075) (-607.510) (-602.281) -- 0:00:06
898500 -- (-602.544) (-601.427) [-601.208] (-602.242) * (-602.517) (-601.710) [-602.485] (-600.720) -- 0:00:06
899000 -- (-601.674) [-602.281] (-600.623) (-603.184) * (-604.066) (-601.983) [-602.720] (-600.720) -- 0:00:06
899500 -- (-602.780) (-601.474) (-603.842) [-603.498] * (-602.782) [-601.654] (-602.182) (-602.650) -- 0:00:06
900000 -- [-601.790] (-604.137) (-605.487) (-603.778) * (-602.917) (-601.018) (-600.686) [-601.374] -- 0:00:06
Average standard deviation of split frequencies: 0.007990
900500 -- (-603.953) [-601.656] (-602.718) (-604.945) * [-601.270] (-600.939) (-600.636) (-601.202) -- 0:00:05
901000 -- (-606.553) (-601.775) [-606.287] (-603.044) * (-601.173) (-602.288) [-601.573] (-603.151) -- 0:00:05
901500 -- (-601.485) [-600.698] (-602.554) (-601.749) * [-601.524] (-604.371) (-602.583) (-603.307) -- 0:00:05
902000 -- [-601.680] (-603.362) (-602.621) (-601.276) * (-602.995) (-601.426) [-600.467] (-600.828) -- 0:00:05
902500 -- [-600.355] (-601.580) (-602.105) (-601.666) * [-603.000] (-605.399) (-603.179) (-602.607) -- 0:00:05
903000 -- (-600.583) (-601.982) [-601.588] (-602.137) * (-601.429) [-600.750] (-602.741) (-600.962) -- 0:00:05
903500 -- (-602.776) (-601.194) (-602.424) [-601.765] * (-606.139) (-600.773) (-606.623) [-603.707] -- 0:00:05
904000 -- (-605.942) [-601.730] (-601.526) (-602.619) * (-603.323) (-603.685) [-601.308] (-603.263) -- 0:00:05
904500 -- (-604.714) (-602.084) [-600.531] (-600.515) * (-610.546) (-601.538) [-601.043] (-601.126) -- 0:00:05
905000 -- (-607.040) [-604.905] (-601.323) (-601.103) * (-608.512) [-601.888] (-603.001) (-600.665) -- 0:00:05
Average standard deviation of split frequencies: 0.007740
905500 -- (-601.389) (-604.006) (-603.042) [-600.547] * [-603.472] (-604.459) (-601.752) (-602.468) -- 0:00:05
906000 -- (-601.790) [-606.659] (-604.970) (-604.228) * (-601.208) (-601.383) [-600.711] (-603.985) -- 0:00:05
906500 -- (-604.470) (-601.755) (-605.489) [-601.119] * [-602.407] (-604.010) (-600.816) (-605.419) -- 0:00:05
907000 -- (-601.877) (-601.110) [-605.014] (-600.957) * (-605.158) (-601.187) (-600.497) [-605.789] -- 0:00:05
907500 -- (-602.079) (-601.085) (-604.580) [-602.336] * (-609.561) (-602.545) (-600.092) [-605.474] -- 0:00:05
908000 -- (-601.449) (-603.243) (-603.969) [-603.336] * (-604.911) (-603.491) [-600.106] (-601.776) -- 0:00:05
908500 -- (-600.831) [-601.106] (-605.216) (-603.635) * (-601.598) [-603.429] (-600.533) (-601.021) -- 0:00:05
909000 -- (-605.933) (-603.071) (-600.255) [-601.350] * (-606.350) (-601.718) (-601.386) [-601.219] -- 0:00:05
909500 -- (-602.834) (-603.184) [-602.236] (-600.245) * [-603.104] (-601.027) (-600.533) (-602.386) -- 0:00:05
910000 -- [-601.917] (-603.701) (-600.343) (-603.763) * (-602.741) [-600.204] (-600.459) (-602.852) -- 0:00:05
Average standard deviation of split frequencies: 0.007959
910500 -- (-600.857) (-603.263) (-600.413) [-601.606] * (-602.431) (-600.386) [-601.840] (-601.938) -- 0:00:05
911000 -- (-601.326) (-606.229) [-601.929] (-601.828) * (-600.461) (-602.091) (-601.864) [-601.204] -- 0:00:05
911500 -- (-601.028) (-601.599) [-602.045] (-601.887) * (-602.787) (-601.696) [-601.316] (-607.325) -- 0:00:05
912000 -- (-600.683) (-603.043) [-602.073] (-602.033) * (-602.764) (-601.499) [-602.391] (-603.224) -- 0:00:05
912500 -- (-600.620) (-602.188) [-603.739] (-603.341) * (-603.216) [-602.608] (-602.574) (-604.407) -- 0:00:05
913000 -- (-600.653) (-603.175) [-602.900] (-603.903) * (-604.893) (-602.936) (-602.524) [-602.009] -- 0:00:05
913500 -- (-602.310) (-602.652) (-603.334) [-602.464] * (-605.724) [-603.267] (-603.514) (-603.836) -- 0:00:05
914000 -- [-600.898] (-602.839) (-601.527) (-601.240) * (-605.683) (-604.026) (-603.939) [-601.880] -- 0:00:05
914500 -- (-602.148) (-602.680) [-601.724] (-601.823) * (-604.112) [-604.137] (-601.079) (-604.145) -- 0:00:05
915000 -- (-600.930) (-601.284) [-607.183] (-603.587) * (-601.613) [-603.027] (-602.338) (-602.103) -- 0:00:05
Average standard deviation of split frequencies: 0.008105
915500 -- (-600.625) [-600.755] (-602.298) (-602.241) * (-602.772) (-601.684) (-601.861) [-600.198] -- 0:00:05
916000 -- (-600.437) (-601.856) [-603.090] (-601.167) * (-601.040) [-601.436] (-605.487) (-601.728) -- 0:00:05
916500 -- (-601.709) [-602.044] (-601.668) (-604.012) * (-600.639) (-604.527) (-605.003) [-601.335] -- 0:00:05
917000 -- (-602.522) (-602.039) [-600.804] (-602.385) * (-601.531) (-603.906) [-600.718] (-601.028) -- 0:00:04
917500 -- (-601.264) (-600.716) [-600.356] (-603.189) * (-601.539) (-601.356) (-602.193) [-600.792] -- 0:00:04
918000 -- (-600.794) [-605.356] (-601.750) (-603.637) * (-601.113) (-605.606) [-601.044] (-606.962) -- 0:00:04
918500 -- (-604.365) (-608.961) (-601.770) [-601.451] * [-601.902] (-603.730) (-602.825) (-603.487) -- 0:00:04
919000 -- (-602.428) [-610.022] (-601.729) (-602.306) * (-601.439) (-601.270) (-602.754) [-603.123] -- 0:00:04
919500 -- (-604.409) (-603.053) (-600.913) [-601.131] * (-605.301) (-600.648) (-602.136) [-602.614] -- 0:00:04
920000 -- (-604.126) (-607.404) [-601.627] (-604.022) * [-603.923] (-602.509) (-603.876) (-604.365) -- 0:00:04
Average standard deviation of split frequencies: 0.008032
920500 -- (-600.772) (-600.816) [-601.784] (-603.796) * [-604.651] (-602.971) (-601.904) (-600.169) -- 0:00:04
921000 -- (-601.032) (-606.091) [-603.989] (-602.468) * (-602.279) (-604.125) [-602.710] (-603.175) -- 0:00:04
921500 -- (-602.014) (-605.688) [-603.332] (-604.600) * (-604.174) (-601.894) (-600.121) [-604.451] -- 0:00:04
922000 -- (-600.768) (-606.218) [-601.735] (-600.215) * [-605.328] (-600.554) (-600.272) (-602.529) -- 0:00:04
922500 -- [-601.227] (-600.798) (-603.146) (-601.428) * (-601.426) [-601.358] (-604.343) (-602.421) -- 0:00:04
923000 -- (-603.303) [-601.244] (-604.260) (-604.657) * [-603.155] (-601.026) (-601.817) (-602.867) -- 0:00:04
923500 -- [-601.124] (-600.980) (-600.777) (-600.505) * (-603.028) [-601.367] (-604.134) (-603.789) -- 0:00:04
924000 -- (-601.189) (-602.505) (-600.373) [-602.321] * [-605.489] (-603.090) (-602.125) (-601.374) -- 0:00:04
924500 -- (-605.025) [-601.244] (-600.619) (-601.061) * (-604.067) (-605.832) [-600.987] (-604.016) -- 0:00:04
925000 -- [-601.028] (-600.333) (-602.465) (-600.800) * (-602.143) (-606.849) [-601.626] (-602.750) -- 0:00:04
Average standard deviation of split frequencies: 0.008018
925500 -- [-601.439] (-605.467) (-605.447) (-600.629) * (-602.418) (-603.117) [-601.093] (-602.111) -- 0:00:04
926000 -- (-600.722) [-605.034] (-601.397) (-601.922) * (-604.297) (-607.274) [-602.405] (-601.403) -- 0:00:04
926500 -- (-604.309) (-603.716) [-603.385] (-600.684) * (-603.524) (-603.653) [-600.833] (-602.780) -- 0:00:04
927000 -- (-603.554) (-602.172) (-602.608) [-601.248] * (-603.519) (-603.603) (-600.810) [-604.018] -- 0:00:04
927500 -- (-606.744) (-605.104) [-601.954] (-604.090) * (-601.372) [-601.459] (-601.088) (-606.511) -- 0:00:04
928000 -- (-606.523) [-602.926] (-600.940) (-602.056) * (-601.769) [-602.910] (-601.279) (-611.659) -- 0:00:04
928500 -- [-600.304] (-601.839) (-603.429) (-604.692) * [-601.466] (-602.568) (-601.951) (-602.938) -- 0:00:04
929000 -- (-601.325) [-602.320] (-604.730) (-601.555) * (-604.370) [-600.798] (-605.447) (-602.537) -- 0:00:04
929500 -- (-601.817) (-602.017) [-602.213] (-602.779) * (-605.331) (-600.754) [-601.356] (-604.763) -- 0:00:04
930000 -- (-601.210) [-601.125] (-603.484) (-603.259) * [-601.384] (-608.330) (-603.949) (-604.900) -- 0:00:04
Average standard deviation of split frequencies: 0.007788
930500 -- (-603.798) (-602.635) [-601.330] (-604.381) * (-600.814) (-605.085) (-606.907) [-603.066] -- 0:00:04
931000 -- (-605.239) (-604.659) [-602.766] (-603.477) * (-600.404) (-606.201) [-609.592] (-602.973) -- 0:00:04
931500 -- [-601.571] (-604.801) (-601.933) (-604.749) * (-604.078) [-602.417] (-601.265) (-602.667) -- 0:00:04
932000 -- (-600.951) [-600.504] (-600.815) (-602.497) * (-604.889) (-603.640) [-601.374] (-603.575) -- 0:00:04
932500 -- (-602.246) (-601.008) [-604.380] (-606.343) * (-600.505) (-603.189) (-600.861) [-603.617] -- 0:00:04
933000 -- [-599.904] (-600.183) (-605.701) (-602.819) * [-602.320] (-601.539) (-603.111) (-602.757) -- 0:00:04
933500 -- (-601.031) (-600.918) (-603.101) [-601.530] * (-602.925) (-601.913) (-603.612) [-602.693] -- 0:00:03
934000 -- (-603.920) [-603.255] (-602.910) (-600.340) * (-606.116) [-600.095] (-601.240) (-601.920) -- 0:00:03
934500 -- [-602.779] (-603.296) (-600.700) (-604.750) * (-601.198) (-600.642) (-602.838) [-603.315] -- 0:00:03
935000 -- (-603.878) (-602.610) [-601.395] (-606.644) * (-602.490) [-601.647] (-602.370) (-605.726) -- 0:00:03
Average standard deviation of split frequencies: 0.007712
935500 -- (-600.004) (-606.363) [-601.164] (-602.690) * (-601.586) (-601.713) (-602.348) [-603.253] -- 0:00:03
936000 -- (-601.357) (-605.011) [-600.583] (-602.664) * (-602.114) (-600.926) [-600.661] (-601.008) -- 0:00:03
936500 -- (-601.946) [-602.014] (-605.411) (-605.402) * [-603.192] (-600.671) (-601.243) (-601.113) -- 0:00:03
937000 -- (-601.586) [-601.491] (-603.021) (-602.531) * [-603.840] (-601.192) (-602.738) (-604.272) -- 0:00:03
937500 -- (-603.153) (-605.149) [-602.171] (-600.852) * (-602.113) [-601.767] (-603.796) (-604.024) -- 0:00:03
938000 -- (-601.075) (-603.758) (-603.253) [-601.505] * [-601.742] (-606.556) (-607.240) (-603.130) -- 0:00:03
938500 -- (-602.210) (-601.618) [-604.315] (-601.640) * (-605.409) (-604.892) [-602.765] (-603.303) -- 0:00:03
939000 -- (-603.443) (-601.016) [-604.742] (-601.247) * (-601.883) (-604.488) (-601.281) [-604.571] -- 0:00:03
939500 -- [-603.686] (-602.703) (-602.267) (-603.970) * (-606.688) (-601.240) [-601.269] (-601.103) -- 0:00:03
940000 -- (-602.949) (-602.020) [-600.465] (-605.316) * (-603.569) (-600.138) [-602.505] (-605.321) -- 0:00:03
Average standard deviation of split frequencies: 0.007360
940500 -- [-602.849] (-601.973) (-600.948) (-604.196) * (-601.564) [-603.633] (-601.412) (-601.705) -- 0:00:03
941000 -- [-603.035] (-603.606) (-602.336) (-606.331) * (-601.152) [-605.862] (-601.441) (-604.893) -- 0:00:03
941500 -- (-602.961) [-601.585] (-601.908) (-601.702) * (-601.451) (-602.832) [-600.899] (-604.593) -- 0:00:03
942000 -- [-601.740] (-601.246) (-604.084) (-601.606) * (-603.781) (-601.213) (-602.181) [-604.303] -- 0:00:03
942500 -- (-601.598) [-601.141] (-602.509) (-600.108) * (-605.379) (-600.804) [-602.681] (-601.187) -- 0:00:03
943000 -- (-602.223) (-600.014) [-601.121] (-602.058) * (-604.874) (-602.563) (-602.324) [-601.522] -- 0:00:03
943500 -- (-605.442) (-606.275) [-601.767] (-604.712) * (-604.275) (-606.358) [-600.914] (-602.734) -- 0:00:03
944000 -- (-604.664) (-601.983) (-607.561) [-602.664] * (-602.674) (-601.745) (-603.271) [-602.232] -- 0:00:03
944500 -- (-604.548) (-600.141) (-602.139) [-600.603] * (-602.893) (-601.134) (-601.707) [-601.767] -- 0:00:03
945000 -- [-603.147] (-601.402) (-601.657) (-602.646) * (-601.740) (-602.772) (-603.067) [-601.982] -- 0:00:03
Average standard deviation of split frequencies: 0.007132
945500 -- (-603.327) [-605.713] (-602.724) (-602.370) * (-603.035) [-602.161] (-600.375) (-601.089) -- 0:00:03
946000 -- [-602.016] (-601.831) (-600.789) (-603.176) * (-602.249) (-600.549) [-601.741] (-603.912) -- 0:00:03
946500 -- [-603.665] (-604.219) (-600.926) (-600.730) * (-601.620) (-601.164) (-603.009) [-602.211] -- 0:00:03
947000 -- (-603.110) [-605.193] (-604.214) (-600.930) * (-602.003) (-601.582) (-601.284) [-604.304] -- 0:00:03
947500 -- [-600.900] (-603.641) (-604.391) (-601.288) * (-602.547) (-601.982) [-601.777] (-602.241) -- 0:00:03
948000 -- [-601.874] (-603.314) (-604.254) (-601.245) * (-604.149) (-602.081) [-600.548] (-603.533) -- 0:00:03
948500 -- (-604.077) [-604.608] (-603.810) (-603.020) * (-607.709) [-604.278] (-600.333) (-609.443) -- 0:00:03
949000 -- (-600.162) (-602.872) (-605.556) [-602.835] * (-603.347) [-601.180] (-601.767) (-605.801) -- 0:00:03
949500 -- (-600.618) (-604.932) [-603.849] (-601.486) * (-605.188) (-604.416) [-604.449] (-600.671) -- 0:00:03
950000 -- [-604.971] (-604.078) (-604.222) (-602.878) * (-606.505) (-604.151) (-608.594) [-600.292] -- 0:00:03
Average standard deviation of split frequencies: 0.006942
950500 -- [-602.739] (-602.703) (-602.987) (-602.830) * (-602.938) [-603.490] (-601.000) (-601.535) -- 0:00:02
951000 -- [-602.752] (-603.013) (-602.995) (-600.977) * (-600.752) (-606.724) (-603.150) [-606.020] -- 0:00:02
951500 -- (-602.570) (-602.839) [-602.088] (-600.701) * [-600.727] (-602.141) (-601.601) (-604.100) -- 0:00:02
952000 -- (-602.120) (-603.075) (-602.722) [-605.018] * (-600.602) [-601.963] (-601.585) (-602.632) -- 0:00:02
952500 -- [-604.072] (-602.915) (-600.813) (-601.590) * [-603.034] (-601.039) (-603.655) (-601.771) -- 0:00:02
953000 -- (-600.661) (-606.620) [-600.397] (-603.306) * (-604.429) (-603.021) [-601.890] (-601.809) -- 0:00:02
953500 -- (-600.992) (-604.285) (-600.789) [-600.950] * (-601.076) (-602.240) [-601.358] (-606.367) -- 0:00:02
954000 -- [-603.881] (-601.830) (-600.713) (-600.633) * (-607.687) [-603.346] (-603.375) (-603.934) -- 0:00:02
954500 -- (-601.265) (-604.825) [-601.156] (-601.323) * [-602.676] (-601.470) (-602.938) (-600.720) -- 0:00:02
955000 -- (-600.148) (-606.270) [-603.325] (-600.138) * (-604.207) (-600.754) [-606.167] (-602.314) -- 0:00:02
Average standard deviation of split frequencies: 0.006811
955500 -- [-603.517] (-601.065) (-602.444) (-602.450) * [-601.051] (-600.779) (-600.336) (-600.943) -- 0:00:02
956000 -- (-600.640) (-600.134) [-601.101] (-603.225) * (-603.278) (-600.820) [-600.785] (-602.180) -- 0:00:02
956500 -- [-602.511] (-600.298) (-601.658) (-604.963) * (-601.276) (-600.238) (-604.172) [-602.242] -- 0:00:02
957000 -- (-602.556) [-600.342] (-600.739) (-601.103) * (-605.010) [-603.628] (-602.839) (-601.460) -- 0:00:02
957500 -- (-601.601) [-602.256] (-601.376) (-607.457) * [-602.621] (-600.095) (-603.502) (-603.672) -- 0:00:02
958000 -- (-601.635) (-605.342) [-601.586] (-602.767) * [-603.648] (-601.349) (-601.637) (-603.216) -- 0:00:02
958500 -- (-608.158) (-605.147) [-601.764] (-602.048) * (-602.236) (-602.969) [-601.880] (-602.357) -- 0:00:02
959000 -- (-608.856) [-603.913] (-600.731) (-600.755) * [-603.298] (-602.135) (-603.509) (-602.566) -- 0:00:02
959500 -- (-601.751) (-603.705) (-602.131) [-603.969] * [-602.193] (-602.803) (-603.691) (-605.008) -- 0:00:02
960000 -- (-601.896) (-603.485) [-605.421] (-603.169) * (-605.370) (-603.860) (-604.722) [-602.743] -- 0:00:02
Average standard deviation of split frequencies: 0.006901
960500 -- (-601.254) (-603.435) [-601.569] (-601.201) * (-600.917) [-602.076] (-602.757) (-603.960) -- 0:00:02
961000 -- (-603.142) (-602.222) [-605.784] (-602.787) * (-601.682) (-601.175) [-602.969] (-603.310) -- 0:00:02
961500 -- (-603.291) (-603.786) [-601.979] (-602.345) * [-601.585] (-602.215) (-600.737) (-602.422) -- 0:00:02
962000 -- [-600.629] (-602.833) (-600.798) (-600.438) * (-606.370) (-601.895) (-601.920) [-600.664] -- 0:00:02
962500 -- [-600.949] (-602.803) (-600.957) (-601.778) * [-602.883] (-602.381) (-600.300) (-602.227) -- 0:00:02
963000 -- (-601.582) (-600.091) (-604.356) [-601.102] * (-604.904) [-606.331] (-602.554) (-602.584) -- 0:00:02
963500 -- (-600.530) [-605.050] (-605.552) (-601.998) * [-603.147] (-605.580) (-603.809) (-602.145) -- 0:00:02
964000 -- (-600.570) (-602.905) (-604.175) [-600.977] * [-601.908] (-600.637) (-601.776) (-601.196) -- 0:00:02
964500 -- (-604.133) [-602.021] (-606.112) (-602.376) * (-601.484) [-600.165] (-600.983) (-601.000) -- 0:00:02
965000 -- (-603.795) [-601.112] (-600.234) (-601.264) * (-601.483) [-601.583] (-603.413) (-601.762) -- 0:00:02
Average standard deviation of split frequencies: 0.006649
965500 -- [-604.945] (-602.157) (-602.052) (-603.475) * (-602.933) (-601.513) [-603.467] (-603.697) -- 0:00:02
966000 -- (-601.065) (-601.504) [-604.353] (-601.682) * (-607.020) [-601.923] (-600.716) (-604.853) -- 0:00:02
966500 -- (-606.278) (-603.036) [-605.051] (-603.779) * (-603.772) (-601.646) [-600.400] (-601.122) -- 0:00:02
967000 -- [-603.523] (-603.555) (-602.850) (-601.000) * [-603.806] (-600.675) (-601.621) (-608.129) -- 0:00:01
967500 -- (-602.176) [-602.046] (-603.024) (-602.659) * (-602.572) [-600.570] (-602.193) (-606.214) -- 0:00:01
968000 -- (-604.862) (-601.572) [-600.357] (-603.795) * (-601.307) (-603.316) [-604.001] (-603.639) -- 0:00:01
968500 -- (-602.161) (-601.346) [-600.024] (-604.756) * [-600.772] (-605.195) (-601.452) (-601.248) -- 0:00:01
969000 -- (-607.778) [-601.654] (-601.132) (-603.147) * (-602.493) (-604.096) [-603.000] (-600.492) -- 0:00:01
969500 -- [-601.591] (-601.477) (-602.142) (-601.667) * [-603.847] (-601.494) (-601.408) (-600.607) -- 0:00:01
970000 -- (-605.337) (-601.360) (-605.989) [-601.191] * (-604.309) [-601.328] (-602.736) (-602.933) -- 0:00:01
Average standard deviation of split frequencies: 0.006637
970500 -- (-602.750) [-601.879] (-603.930) (-603.246) * (-604.103) (-601.730) (-600.540) [-600.900] -- 0:00:01
971000 -- (-603.375) [-602.282] (-600.032) (-601.494) * [-603.814] (-603.797) (-606.377) (-604.096) -- 0:00:01
971500 -- (-606.830) (-600.810) [-603.530] (-604.981) * (-607.277) (-605.078) (-600.848) [-602.221] -- 0:00:01
972000 -- [-601.468] (-602.062) (-603.614) (-603.821) * (-601.821) (-600.355) (-601.852) [-601.941] -- 0:00:01
972500 -- [-602.704] (-601.159) (-600.018) (-603.075) * (-602.082) (-600.355) (-600.588) [-603.771] -- 0:00:01
973000 -- (-601.620) [-602.009] (-600.677) (-602.675) * (-601.542) [-601.608] (-600.179) (-606.257) -- 0:00:01
973500 -- (-602.769) (-601.443) (-602.199) [-601.066] * (-604.298) (-603.889) (-600.342) [-604.569] -- 0:00:01
974000 -- (-600.814) (-600.988) (-601.580) [-601.795] * (-603.887) (-601.951) (-602.162) [-602.471] -- 0:00:01
974500 -- (-604.621) (-601.182) [-602.904] (-601.782) * [-602.099] (-602.111) (-601.715) (-600.915) -- 0:00:01
975000 -- [-601.454] (-600.828) (-603.037) (-602.673) * [-600.807] (-601.882) (-601.435) (-602.278) -- 0:00:01
Average standard deviation of split frequencies: 0.006794
975500 -- [-602.381] (-601.341) (-603.269) (-601.252) * (-600.886) (-603.121) (-601.232) [-603.409] -- 0:00:01
976000 -- (-602.567) (-602.674) [-601.887] (-600.422) * (-600.959) (-600.110) (-604.442) [-601.787] -- 0:00:01
976500 -- (-607.223) (-604.284) [-602.554] (-600.581) * [-600.356] (-600.018) (-602.570) (-604.902) -- 0:00:01
977000 -- [-602.249] (-600.863) (-600.981) (-607.494) * [-602.225] (-603.326) (-602.734) (-603.125) -- 0:00:01
977500 -- (-603.583) (-609.743) (-600.468) [-604.000] * (-604.739) (-601.048) (-600.343) [-600.600] -- 0:00:01
978000 -- (-604.090) (-608.096) [-601.543] (-603.331) * (-608.223) [-602.624] (-603.341) (-600.560) -- 0:00:01
978500 -- (-604.128) (-602.716) (-601.761) [-602.813] * (-604.510) [-600.362] (-601.277) (-602.310) -- 0:00:01
979000 -- (-607.529) [-603.897] (-606.333) (-605.443) * (-601.956) (-601.028) [-601.307] (-601.963) -- 0:00:01
979500 -- (-604.096) (-601.955) (-604.104) [-602.926] * [-602.755] (-604.443) (-603.386) (-603.527) -- 0:00:01
980000 -- [-603.490] (-602.094) (-604.112) (-600.595) * (-604.621) [-604.695] (-601.142) (-601.209) -- 0:00:01
Average standard deviation of split frequencies: 0.006345
980500 -- (-602.457) [-601.134] (-603.224) (-601.297) * [-602.080] (-605.411) (-602.181) (-601.771) -- 0:00:01
981000 -- [-602.072] (-600.952) (-603.577) (-603.740) * (-601.786) (-602.035) [-604.911] (-602.963) -- 0:00:01
981500 -- [-606.268] (-605.026) (-605.774) (-602.264) * [-604.727] (-602.149) (-605.009) (-604.335) -- 0:00:01
982000 -- [-603.590] (-604.657) (-602.824) (-602.188) * (-603.845) [-603.307] (-603.146) (-604.292) -- 0:00:01
982500 -- (-600.704) (-601.771) (-604.054) [-602.333] * (-602.488) (-602.306) [-600.956] (-602.974) -- 0:00:01
983000 -- [-601.357] (-604.295) (-601.475) (-601.825) * (-601.266) [-601.688] (-601.643) (-602.606) -- 0:00:01
983500 -- (-601.211) (-603.956) (-601.852) [-600.632] * [-602.384] (-603.334) (-601.785) (-601.307) -- 0:00:00
984000 -- (-605.998) (-603.628) [-604.604] (-600.851) * (-600.589) (-604.401) [-601.704] (-602.271) -- 0:00:00
984500 -- (-607.169) (-602.596) (-604.792) [-600.561] * [-600.363] (-605.621) (-601.464) (-603.515) -- 0:00:00
985000 -- (-604.857) (-603.648) (-601.079) [-599.933] * (-600.510) (-600.524) [-600.711] (-603.160) -- 0:00:00
Average standard deviation of split frequencies: 0.006514
985500 -- (-608.325) (-606.702) [-600.499] (-601.040) * (-603.147) [-603.946] (-602.039) (-604.329) -- 0:00:00
986000 -- (-605.181) (-609.553) (-600.755) [-609.214] * (-606.627) (-605.156) [-601.957] (-600.671) -- 0:00:00
986500 -- (-603.657) (-609.732) [-600.515] (-605.003) * (-600.880) (-604.753) (-602.508) [-601.454] -- 0:00:00
987000 -- (-602.807) (-604.635) [-600.470] (-602.194) * [-601.156] (-603.122) (-608.041) (-601.403) -- 0:00:00
987500 -- (-604.392) [-601.504] (-600.844) (-600.817) * [-605.201] (-603.636) (-601.367) (-601.640) -- 0:00:00
988000 -- [-603.460] (-602.407) (-600.809) (-600.792) * [-604.315] (-602.063) (-603.389) (-608.201) -- 0:00:00
988500 -- (-606.023) (-602.369) [-601.066] (-603.479) * [-602.742] (-602.187) (-605.347) (-601.258) -- 0:00:00
989000 -- (-602.349) [-603.661] (-600.003) (-602.169) * (-602.761) (-603.539) [-603.966] (-603.091) -- 0:00:00
989500 -- [-601.057] (-602.240) (-602.368) (-601.889) * [-602.109] (-601.673) (-602.437) (-601.701) -- 0:00:00
990000 -- [-605.698] (-602.776) (-605.577) (-602.654) * (-602.279) [-601.751] (-602.736) (-602.023) -- 0:00:00
Average standard deviation of split frequencies: 0.006662
990500 -- [-601.833] (-600.581) (-604.056) (-600.434) * (-600.786) (-600.605) (-601.163) [-601.977] -- 0:00:00
991000 -- [-602.358] (-602.529) (-603.038) (-604.054) * (-600.446) (-603.496) (-601.021) [-602.741] -- 0:00:00
991500 -- [-601.036] (-607.813) (-602.522) (-605.031) * (-603.017) (-606.153) (-601.468) [-602.650] -- 0:00:00
992000 -- (-602.822) (-605.049) [-601.112] (-601.273) * [-603.896] (-604.295) (-601.352) (-603.886) -- 0:00:00
992500 -- (-601.937) (-601.072) [-601.327] (-602.904) * [-603.084] (-602.299) (-602.648) (-603.378) -- 0:00:00
993000 -- (-605.258) (-603.053) [-601.120] (-605.477) * (-604.358) [-600.774] (-603.710) (-605.112) -- 0:00:00
993500 -- [-601.857] (-600.785) (-600.722) (-602.685) * (-603.869) [-600.839] (-601.110) (-601.423) -- 0:00:00
994000 -- (-602.918) (-600.940) [-601.113] (-603.393) * (-605.195) [-601.712] (-600.784) (-601.578) -- 0:00:00
994500 -- (-602.439) (-603.047) (-610.554) [-600.571] * (-611.269) [-600.290] (-602.140) (-602.752) -- 0:00:00
995000 -- (-603.511) (-602.811) (-601.480) [-600.504] * (-604.416) (-600.777) (-606.375) [-602.083] -- 0:00:00
Average standard deviation of split frequencies: 0.006390
995500 -- [-602.025] (-601.071) (-601.748) (-601.727) * [-600.225] (-600.019) (-603.346) (-602.744) -- 0:00:00
996000 -- (-601.884) (-601.821) [-600.823] (-600.772) * (-602.156) [-600.687] (-601.098) (-600.667) -- 0:00:00
996500 -- (-603.669) (-603.153) [-600.471] (-601.353) * (-603.644) (-602.785) (-601.738) [-601.472] -- 0:00:00
997000 -- (-601.091) (-602.477) [-602.313] (-603.249) * [-600.254] (-608.229) (-601.080) (-602.969) -- 0:00:00
997500 -- [-602.926] (-603.886) (-603.355) (-603.351) * (-602.289) (-610.116) (-600.892) [-602.796] -- 0:00:00
998000 -- [-602.390] (-602.694) (-601.466) (-601.659) * [-603.904] (-603.754) (-604.031) (-601.994) -- 0:00:00
998500 -- [-601.366] (-603.285) (-600.632) (-604.592) * [-600.648] (-602.601) (-601.687) (-601.884) -- 0:00:00
999000 -- [-600.978] (-603.411) (-602.506) (-602.222) * (-601.556) (-601.501) (-601.257) [-603.651] -- 0:00:00
999500 -- (-604.972) [-605.344] (-602.509) (-602.928) * (-600.021) (-603.123) (-601.156) [-605.213] -- 0:00:00
1000000 -- (-612.014) [-601.724] (-602.023) (-601.826) * (-602.090) (-601.448) (-601.347) [-602.324] -- 0:00:00
Average standard deviation of split frequencies: 0.006407
Analysis completed in 60 seconds
Analysis used 58.84 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -599.82
Likelihood of best state for "cold" chain of run 2 was -599.82
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 70 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
33.0 % ( 26 %) Dirichlet(Pi{all})
34.6 % ( 26 %) Slider(Pi{all})
78.6 % ( 47 %) Multiplier(Alpha{1,2})
77.6 % ( 44 %) Multiplier(Alpha{3})
24.2 % ( 21 %) Slider(Pinvar{all})
98.6 % ( 96 %) ExtSPR(Tau{all},V{all})
70.3 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 24 %) Multiplier(V{all})
97.3 % ( 97 %) Nodeslider(V{all})
30.6 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.7 % ( 68 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
33.4 % ( 30 %) Dirichlet(Pi{all})
34.5 % ( 27 %) Slider(Pi{all})
78.8 % ( 54 %) Multiplier(Alpha{1,2})
77.9 % ( 52 %) Multiplier(Alpha{3})
24.6 % ( 29 %) Slider(Pinvar{all})
98.6 % ( 96 %) ExtSPR(Tau{all},V{all})
70.0 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 91 %) ParsSPR(Tau{all},V{all})
28.1 % ( 30 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.4 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166347 0.82 0.67
3 | 166616 167001 0.84
4 | 167493 166124 166419
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166202 0.82 0.67
3 | 166530 166613 0.84
4 | 167157 166684 166814
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -601.61
| 1 1 2 |
| 2 1 |
| 2 1 2 1 2 1 1|
| 2 1 12 2 2 2 |
| 2 2 2 2 1 12 2 2 2 11 2 2 |
| 1 1 * 1 1112 1 2 1 2 1 1 |
| 1 2 2 1 1 * 1 1 2 2|
| 1 2 11 2 21 211 1 11 2 |
|2 12 1 111 1 2 1 2 1 * 2221 |
|1 2 21 22 212 2 1 2 2 1 |
| 1 1 1 |
| 1 1 2 2 2 2 |
| 2 2 2 |
| |
| 1 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -603.23
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -601.53 -605.37
2 -601.59 -605.91
--------------------------------------
TOTAL -601.56 -605.68
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.886563 0.089662 0.354160 1.461404 0.849453 1049.55 1210.64 1.000
r(A<->C){all} 0.156241 0.017958 0.000003 0.429621 0.118311 157.23 284.13 1.001
r(A<->G){all} 0.181389 0.022563 0.000043 0.478846 0.139931 186.83 291.04 1.000
r(A<->T){all} 0.171006 0.018833 0.000048 0.441819 0.140652 152.57 210.38 1.000
r(C<->G){all} 0.170506 0.022866 0.000070 0.479111 0.128981 97.26 119.55 1.005
r(C<->T){all} 0.158667 0.018525 0.000065 0.447954 0.122132 138.00 154.87 1.001
r(G<->T){all} 0.162191 0.018837 0.000183 0.445299 0.123893 241.03 251.08 1.000
pi(A){all} 0.219847 0.000386 0.182063 0.258193 0.219455 1111.18 1306.09 1.001
pi(C){all} 0.262723 0.000434 0.223421 0.303635 0.262276 1237.51 1353.83 1.000
pi(G){all} 0.318872 0.000491 0.278141 0.364499 0.318591 1283.12 1298.97 1.000
pi(T){all} 0.198557 0.000369 0.164891 0.239683 0.198101 1217.96 1313.06 1.000
alpha{1,2} 0.406443 0.215752 0.000156 1.369227 0.242433 1302.79 1401.90 1.001
alpha{3} 0.456536 0.232722 0.000128 1.424201 0.307486 1133.55 1224.74 1.000
pinvar{all} 0.996269 0.000021 0.987772 0.999998 0.997700 1276.75 1353.15 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ....**
8 -- .****.
9 -- ...*.*
10 -- ..****
11 -- .*..*.
12 -- ..*..*
13 -- .*.*..
14 -- ..*.*.
15 -- .**...
16 -- ..**..
17 -- .*.***
18 -- .***.*
19 -- ...**.
20 -- .**.**
21 -- .*...*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 460 0.153231 0.000000 0.153231 0.153231 2
8 456 0.151899 0.003769 0.149234 0.154564 2
9 453 0.150899 0.007066 0.145903 0.155896 2
10 452 0.150566 0.001884 0.149234 0.151899 2
11 451 0.150233 0.010835 0.142572 0.157895 2
12 436 0.145237 0.002827 0.143238 0.147235 2
13 433 0.144237 0.010835 0.136576 0.151899 2
14 431 0.143571 0.007066 0.138574 0.148568 2
15 431 0.143571 0.007066 0.138574 0.148568 2
16 428 0.142572 0.001884 0.141239 0.143904 2
17 415 0.138241 0.009893 0.131246 0.145237 2
18 410 0.136576 0.002827 0.134577 0.138574 2
19 408 0.135909 0.000942 0.135243 0.136576 2
20 399 0.132911 0.012719 0.123917 0.141905 2
21 381 0.126915 0.016488 0.115256 0.138574 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098060 0.009404 0.000042 0.298959 0.068866 1.000 2
length{all}[2] 0.097823 0.010215 0.000017 0.306605 0.066828 1.000 2
length{all}[3] 0.097074 0.010723 0.000000 0.300780 0.065204 1.000 2
length{all}[4] 0.097407 0.009578 0.000094 0.297237 0.067461 1.001 2
length{all}[5] 0.099700 0.009958 0.000019 0.295930 0.068474 1.000 2
length{all}[6] 0.098862 0.010090 0.000002 0.299410 0.068055 1.000 2
length{all}[7] 0.098563 0.009452 0.000080 0.313828 0.072798 1.006 2
length{all}[8] 0.098038 0.010664 0.000122 0.302470 0.062531 0.998 2
length{all}[9] 0.108959 0.013831 0.000549 0.333929 0.076557 0.999 2
length{all}[10] 0.093770 0.008411 0.000032 0.272413 0.066177 1.000 2
length{all}[11] 0.101618 0.009919 0.000481 0.268410 0.076140 1.000 2
length{all}[12] 0.102404 0.011664 0.000012 0.317936 0.070110 0.998 2
length{all}[13] 0.099903 0.008523 0.000143 0.293580 0.071522 1.013 2
length{all}[14] 0.098464 0.009835 0.000161 0.270147 0.072463 0.999 2
length{all}[15] 0.102062 0.011803 0.000073 0.299363 0.067462 0.998 2
length{all}[16] 0.098491 0.008783 0.000073 0.288455 0.070065 1.002 2
length{all}[17] 0.096222 0.010597 0.000050 0.277613 0.062543 0.999 2
length{all}[18] 0.103847 0.010408 0.000349 0.325642 0.073873 1.004 2
length{all}[19] 0.101298 0.009581 0.000054 0.309111 0.070384 0.998 2
length{all}[20] 0.091023 0.008289 0.000031 0.276252 0.061881 1.000 2
length{all}[21] 0.099020 0.008856 0.000280 0.283359 0.068890 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006407
Maximum standard deviation of split frequencies = 0.016488
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.013
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 44 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 438
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 47 patterns at 146 / 146 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 47 patterns at 146 / 146 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
45872 bytes for conP
4136 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.073328 0.036968 0.054135 0.054687 0.094408 0.086340 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -637.033445
Iterating by ming2
Initial: fx= 637.033445
x= 0.07333 0.03697 0.05413 0.05469 0.09441 0.08634 0.30000 1.30000
1 h-m-p 0.0000 0.0003 347.8467 +++ 605.599223 m 0.0003 14 | 1/8
2 h-m-p 0.0017 0.0095 48.4920 ------------.. | 1/8
3 h-m-p 0.0000 0.0001 319.2185 ++ 593.289063 m 0.0001 46 | 2/8
4 h-m-p 0.0010 0.0166 35.5973 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 286.1283 ++ 592.971344 m 0.0000 77 | 3/8
6 h-m-p 0.0000 0.0229 28.0063 ---------.. | 3/8
7 h-m-p 0.0000 0.0001 247.4993 ++ 584.908060 m 0.0001 106 | 4/8
8 h-m-p 0.0013 0.0322 21.0266 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 202.5294 ++ 581.132692 m 0.0001 137 | 5/8
10 h-m-p 0.0010 0.0660 13.4828 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 143.4297 ++ 579.957418 m 0.0001 168 | 6/8
12 h-m-p 0.2526 8.0000 0.0000 +++ 579.957418 m 8.0000 180 | 6/8
13 h-m-p 0.4677 8.0000 0.0000 +++ 579.957418 m 8.0000 194 | 6/8
14 h-m-p 0.0105 5.2452 0.0597 -----Y 579.957418 0 0.0000 212 | 6/8
15 h-m-p 0.0160 8.0000 0.0001 -C 579.957418 0 0.0010 226 | 6/8
16 h-m-p 0.0160 8.0000 0.0001 ---C 579.957418 0 0.0001 242
Out..
lnL = -579.957418
243 lfun, 243 eigenQcodon, 1458 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.024902 0.105679 0.067444 0.083196 0.069097 0.092045 0.300170 0.758689 0.301550
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 13.196039
np = 9
lnL0 = -641.592683
Iterating by ming2
Initial: fx= 641.592683
x= 0.02490 0.10568 0.06744 0.08320 0.06910 0.09204 0.30017 0.75869 0.30155
1 h-m-p 0.0000 0.0002 328.7444 +++ 621.513142 m 0.0002 15 | 1/9
2 h-m-p 0.0001 0.0006 285.3602 ++ 591.530201 m 0.0006 27 | 2/9
3 h-m-p 0.0000 0.0000 784.5088 ++ 590.513893 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0009 205.7341 +++ 583.764371 m 0.0009 52 | 4/9
5 h-m-p 0.0000 0.0000 110495.5737 ++ 583.585652 m 0.0000 64 | 5/9
6 h-m-p 0.0015 0.3590 1.9179 -----------.. | 5/9
7 h-m-p 0.0000 0.0000 202.5016 ++ 581.613406 m 0.0000 97 | 6/9
8 h-m-p 0.0020 0.1956 3.4865 ------------.. | 6/9
9 h-m-p 0.0000 0.0001 144.3540 ++ 579.957471 m 0.0001 131 | 7/9
10 h-m-p 0.4058 8.0000 0.0000 +++ 579.957471 m 8.0000 144 | 6/9
11 h-m-p 0.0000 0.0000 0.0172
h-m-p: 3.05825452e-15 1.52912726e-14 1.71964590e-02 579.957471
.. | 6/9
12 h-m-p 0.0160 8.0000 0.0002 +++++ 579.957471 m 8.0000 173 | 6/9
13 h-m-p 0.0066 3.2917 0.2284 +++++ 579.957426 m 3.2917 191 | 7/9
14 h-m-p 1.6000 8.0000 0.0025 ++ 579.957426 m 8.0000 206 | 7/9
15 h-m-p 0.0011 0.0323 17.9156 +++ 579.957426 m 0.0323 221 | 7/9
16 h-m-p 0.0045 0.0224 44.9093 -----------C 579.957426 0 0.0000 244 | 8/9
17 h-m-p 0.1842 8.0000 0.0000 -----C 579.957426 0 0.0000 261 | 8/9
18 h-m-p 0.1878 8.0000 0.0000 -------Y 579.957426 0 0.0000 281
Out..
lnL = -579.957426
282 lfun, 846 eigenQcodon, 3384 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.084227 0.075814 0.040193 0.084279 0.054653 0.049806 0.190960 1.099454 0.111011 0.115465 1.410137
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 12.411886
np = 11
lnL0 = -631.373857
Iterating by ming2
Initial: fx= 631.373857
x= 0.08423 0.07581 0.04019 0.08428 0.05465 0.04981 0.19096 1.09945 0.11101 0.11547 1.41014
1 h-m-p 0.0000 0.0003 295.9582 +++ 600.811065 m 0.0003 17 | 1/11
2 h-m-p 0.0001 0.0005 125.8776 ++ 594.066555 m 0.0005 31 | 2/11
3 h-m-p 0.0000 0.0000 1976.6400 ++ 591.079560 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0000 471344.5025 ++ 590.597248 m 0.0000 59 | 4/11
5 h-m-p 0.0002 0.0395 12.4727 ----------.. | 4/11
6 h-m-p 0.0000 0.0001 237.5926 ++ 582.348190 m 0.0001 95 | 5/11
7 h-m-p 0.0057 0.0932 4.8729 ------------.. | 5/11
8 h-m-p 0.0000 0.0001 202.5874 ++ 579.964867 m 0.0001 133 | 6/11
9 h-m-p 0.0043 0.2467 1.9422 ------------.. | 6/11
10 h-m-p 0.0000 0.0000 145.1829 ++ 579.957455 m 0.0000 171 | 7/11
11 h-m-p 0.0160 8.0000 0.0000 C 579.957455 0 0.0156 185 | 6/11
12 h-m-p 0.0160 8.0000 0.0002 +++++ 579.957455 m 8.0000 206 | 6/11
13 h-m-p 0.0017 0.0084 0.1558 -------C 579.957455 0 0.0000 232 | 6/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 579.957455 m 8.0000 254 | 6/11
15 h-m-p 0.0000 0.0001 33.3477 -------N 579.957455 0 0.0000 280 | 6/11
16 h-m-p 0.0160 8.0000 0.0007 +++++ 579.957455 m 8.0000 297 | 6/11
17 h-m-p 0.0004 0.0018 4.2049 ---------Y 579.957455 0 0.0000 325 | 6/11
18 h-m-p 0.0160 8.0000 0.0000 +++++ 579.957455 m 8.0000 342 | 6/11
19 h-m-p 0.0002 0.1152 2.5465 +++++ 579.957451 m 0.1152 364 | 7/11
20 h-m-p 0.0048 0.0317 47.5726 ++ 579.957436 m 0.0317 378 | 7/11
21 h-m-p -0.0000 -0.0000 2.1346
h-m-p: -0.00000000e+00 -0.00000000e+00 2.13464679e+00 579.957436
.. | 7/11
22 h-m-p 0.0160 8.0000 0.0000 +++++ 579.957436 m 8.0000 406 | 7/11
23 h-m-p 0.0045 0.0227 0.0132 -----Y 579.957436 0 0.0000 429 | 7/11
24 h-m-p 0.0160 8.0000 0.0003 +++++ 579.957436 m 8.0000 450 | 7/11
25 h-m-p 0.0030 0.7236 0.6879 ++++ 579.957422 m 0.7236 470 | 8/11
26 h-m-p 0.7894 8.0000 0.3161 ++ 579.957401 m 8.0000 488 | 8/11
27 h-m-p 0.6675 8.0000 3.7885 ++ 579.957382 m 8.0000 505 | 8/11
28 h-m-p 1.6000 8.0000 0.6413 ++ 579.957381 m 8.0000 519 | 8/11
29 h-m-p 1.6000 8.0000 2.8124 ++ 579.957381 m 8.0000 536 | 8/11
30 h-m-p 1.6000 8.0000 2.3178 ++ 579.957381 m 8.0000 550 | 8/11
31 h-m-p 0.7166 3.5832 22.1198 --------C 579.957381 0 0.0000 572 | 8/11
32 h-m-p 1.6000 8.0000 0.0000 ++ 579.957381 m 8.0000 586 | 8/11
33 h-m-p 1.2615 8.0000 0.0000 -C 579.957381 0 0.0788 604 | 8/11
34 h-m-p 0.0307 8.0000 0.0001 --------------.. | 8/11
35 h-m-p 0.0160 8.0000 0.0000 C 579.957381 0 0.0160 650
Out..
lnL = -579.957381
651 lfun, 2604 eigenQcodon, 11718 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -579.954112 S = -579.953988 -0.000047
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 47 patterns 0:05
did 20 / 47 patterns 0:05
did 30 / 47 patterns 0:05
did 40 / 47 patterns 0:05
did 47 / 47 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.033078 0.107648 0.033615 0.061896 0.044387 0.051823 0.000100 0.670774 1.866509
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 21.286627
np = 9
lnL0 = -626.588904
Iterating by ming2
Initial: fx= 626.588904
x= 0.03308 0.10765 0.03361 0.06190 0.04439 0.05182 0.00011 0.67077 1.86651
1 h-m-p 0.0000 0.0000 330.7604 ++ 626.101665 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0442 17.5157 ---------.. | 1/9
3 h-m-p 0.0000 0.0002 331.0414 +++ 599.392215 m 0.0002 46 | 2/9
4 h-m-p 0.0065 0.0799 11.0969 ------------.. | 2/9
5 h-m-p 0.0000 0.0000 316.0760 ++ 599.011903 m 0.0000 80 | 3/9
6 h-m-p 0.0007 0.3610 5.6168 -----------.. | 3/9
7 h-m-p 0.0000 0.0001 282.1573 ++ 592.868600 m 0.0001 113 | 4/9
8 h-m-p 0.0041 0.4404 4.5495 ------------.. | 4/9
9 h-m-p 0.0000 0.0001 246.6048 ++ 589.652882 m 0.0001 147 | 5/9
10 h-m-p 0.0029 0.5752 3.6489 ------------.. | 5/9
11 h-m-p 0.0000 0.0001 201.8822 ++ 586.732498 m 0.0001 181 | 6/9
12 h-m-p 0.0035 0.8146 2.8942 ------------.. | 6/9
13 h-m-p 0.0000 0.0003 142.5257 +++ 579.957486 m 0.0003 216 | 7/9
14 h-m-p 1.5504 8.0000 0.0000 ++ 579.957486 m 8.0000 228 | 7/9
15 h-m-p 0.0160 8.0000 0.0069 -------Y 579.957486 0 0.0000 249 | 7/9
16 h-m-p 0.0160 8.0000 0.0001 ----N 579.957486 0 0.0000 267 | 7/9
17 h-m-p 0.0160 8.0000 0.0000 +++++ 579.957486 m 8.0000 284 | 7/9
18 h-m-p 0.0160 8.0000 0.7190 +++++ 579.957469 m 8.0000 301 | 7/9
19 h-m-p 1.6000 8.0000 0.2574 ++ 579.957468 m 8.0000 315 | 7/9
20 h-m-p 0.6498 8.0000 3.1694 ++ 579.957466 m 8.0000 329 | 7/9
21 h-m-p 1.6000 8.0000 6.2364 ++ 579.957465 m 8.0000 341 | 7/9
22 h-m-p 1.6000 8.0000 4.7117 ----------C 579.957465 0 0.0000 363 | 7/9
23 h-m-p 0.4411 8.0000 0.0000 -----N 579.957465 0 0.0001 380
Out..
lnL = -579.957465
381 lfun, 4191 eigenQcodon, 22860 P(t)
Time used: 0:11
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.102515 0.100904 0.068266 0.014827 0.013608 0.095456 0.000100 0.900000 0.748492 1.818068 1.300221
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 17.187633
np = 11
lnL0 = -633.375819
Iterating by ming2
Initial: fx= 633.375819
x= 0.10251 0.10090 0.06827 0.01483 0.01361 0.09546 0.00011 0.90000 0.74849 1.81807 1.30022
1 h-m-p 0.0000 0.0000 310.5079 ++ 633.069210 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0004 183.8988 +++ 622.473019 m 0.0004 31 | 2/11
3 h-m-p 0.0000 0.0000 106.1054 ++ 621.628598 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0050 103.4504 ++++ 591.416188 m 0.0050 61 | 4/11
5 h-m-p 0.0000 0.0000 162148.0492 ++ 581.433597 m 0.0000 75 | 5/11
6 h-m-p 0.0003 0.0014 140.7433 ++ 580.123898 m 0.0014 89 | 6/11
7 h-m-p 0.0000 0.0000 2920.2340 ++ 579.957446 m 0.0000 103 | 7/11
8 h-m-p 1.6000 8.0000 0.0024 ++ 579.957446 m 8.0000 117 | 7/11
9 h-m-p 0.0080 0.0398 1.8428 ++ 579.957445 m 0.0398 135 | 7/11
10 h-m-p 0.5570 8.0000 0.1318 ---------------C 579.957445 0 0.0000 164 | 7/11
11 h-m-p 0.0000 0.0000 0.0001 ----.. | 7/11
12 h-m-p 0.0160 8.0000 0.0002 +++++ 579.957444 m 8.0000 205 | 7/11
13 h-m-p 0.0070 3.4838 0.2079 +++++ 579.957402 m 3.4838 226 | 8/11
14 h-m-p 1.2979 8.0000 0.0725 ++ 579.957398 m 8.0000 244 | 8/11
15 h-m-p 0.5140 8.0000 1.1279 ++ 579.957384 m 8.0000 261 | 8/11
16 h-m-p 1.6000 8.0000 0.6378 ++ 579.957383 m 8.0000 275 | 8/11
17 h-m-p 1.0466 8.0000 4.8751 ++ 579.957381 m 8.0000 292 | 8/11
18 h-m-p 1.6000 8.0000 7.5149 ++ 579.957380 m 8.0000 306 | 8/11
19 h-m-p 1.6000 8.0000 13.0765 ---------Y 579.957380 0 0.0000 329 | 8/11
20 h-m-p 1.6000 8.0000 0.0000 Y 579.957380 0 1.6000 343 | 8/11
21 h-m-p 0.0160 8.0000 0.0000 +C 579.957380 0 0.0640 361
Out..
lnL = -579.957380
362 lfun, 4344 eigenQcodon, 23892 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -579.954075 S = -579.953981 -0.000041
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 47 patterns 0:17
did 20 / 47 patterns 0:17
did 30 / 47 patterns 0:18
did 40 / 47 patterns 0:18
did 47 / 47 patterns 0:18
Time used: 0:18
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=146
NC_011896_1_WP_010908605_1_2033_MLBR_RS09645 VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NC_002677_1_NP_302284_1_1156_secE VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NZ_LVXE01000028_1_WP_010908605_1_1139_A3216_RS08545 VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NZ_LYPH01000031_1_WP_010908605_1_1221_A8144_RS05875 VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NZ_CP029543_1_WP_010908605_1_2057_DIJ64_RS10465 VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NZ_AP014567_1_WP_010908605_1_2112_secE VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
**************************************************
NC_011896_1_WP_010908605_1_2033_MLBR_RS09645 NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
NC_002677_1_NP_302284_1_1156_secE NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
NZ_LVXE01000028_1_WP_010908605_1_1139_A3216_RS08545 NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
NZ_LYPH01000031_1_WP_010908605_1_1221_A8144_RS05875 NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
NZ_CP029543_1_WP_010908605_1_2057_DIJ64_RS10465 NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
NZ_AP014567_1_WP_010908605_1_2112_secE NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
**************************************************
NC_011896_1_WP_010908605_1_2033_MLBR_RS09645 MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
NC_002677_1_NP_302284_1_1156_secE MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
NZ_LVXE01000028_1_WP_010908605_1_1139_A3216_RS08545 MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
NZ_LYPH01000031_1_WP_010908605_1_1221_A8144_RS05875 MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
NZ_CP029543_1_WP_010908605_1_2057_DIJ64_RS10465 MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
NZ_AP014567_1_WP_010908605_1_2112_secE MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
**********************************************
>NC_011896_1_WP_010908605_1_2033_MLBR_RS09645 GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC >NC_002677_1_NP_302284_1_1156_secE GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC >NZ_LVXE01000028_1_WP_010908605_1_1139_A3216_RS08545 GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC >NZ_LYPH01000031_1_WP_010908605_1_1221_A8144_RS05875 GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC >NZ_CP029543_1_WP_010908605_1_2057_DIJ64_RS10465 GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC >NZ_AP014567_1_WP_010908605_1_2112_secE GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC
>NC_011896_1_WP_010908605_1_2033_MLBR_RS09645 VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG >NC_002677_1_NP_302284_1_1156_secE VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG >NZ_LVXE01000028_1_WP_010908605_1_1139_A3216_RS08545 VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG >NZ_LYPH01000031_1_WP_010908605_1_1221_A8144_RS05875 VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG >NZ_CP029543_1_WP_010908605_1_2057_DIJ64_RS10465 VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG >NZ_AP014567_1_WP_010908605_1_2112_secE VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
#NEXUS
[ID: 0120562606]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908605_1_2033_MLBR_RS09645
NC_002677_1_NP_302284_1_1156_secE
NZ_LVXE01000028_1_WP_010908605_1_1139_A3216_RS08545
NZ_LYPH01000031_1_WP_010908605_1_1221_A8144_RS05875
NZ_CP029543_1_WP_010908605_1_2057_DIJ64_RS10465
NZ_AP014567_1_WP_010908605_1_2112_secE
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908605_1_2033_MLBR_RS09645,
2 NC_002677_1_NP_302284_1_1156_secE,
3 NZ_LVXE01000028_1_WP_010908605_1_1139_A3216_RS08545,
4 NZ_LYPH01000031_1_WP_010908605_1_1221_A8144_RS05875,
5 NZ_CP029543_1_WP_010908605_1_2057_DIJ64_RS10465,
6 NZ_AP014567_1_WP_010908605_1_2112_secE
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06886552,2:0.06682755,3:0.06520376,4:0.06746061,5:0.06847402,6:0.06805481);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06886552,2:0.06682755,3:0.06520376,4:0.06746061,5:0.06847402,6:0.06805481);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -601.53 -605.37
2 -601.59 -605.91
--------------------------------------
TOTAL -601.56 -605.68
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.886563 0.089662 0.354160 1.461404 0.849453 1049.55 1210.64 1.000
r(A<->C){all} 0.156241 0.017958 0.000003 0.429621 0.118311 157.23 284.13 1.001
r(A<->G){all} 0.181389 0.022563 0.000043 0.478846 0.139931 186.83 291.04 1.000
r(A<->T){all} 0.171006 0.018833 0.000048 0.441819 0.140652 152.57 210.38 1.000
r(C<->G){all} 0.170506 0.022866 0.000070 0.479111 0.128981 97.26 119.55 1.005
r(C<->T){all} 0.158667 0.018525 0.000065 0.447954 0.122132 138.00 154.87 1.001
r(G<->T){all} 0.162191 0.018837 0.000183 0.445299 0.123893 241.03 251.08 1.000
pi(A){all} 0.219847 0.000386 0.182063 0.258193 0.219455 1111.18 1306.09 1.001
pi(C){all} 0.262723 0.000434 0.223421 0.303635 0.262276 1237.51 1353.83 1.000
pi(G){all} 0.318872 0.000491 0.278141 0.364499 0.318591 1283.12 1298.97 1.000
pi(T){all} 0.198557 0.000369 0.164891 0.239683 0.198101 1217.96 1313.06 1.000
alpha{1,2} 0.406443 0.215752 0.000156 1.369227 0.242433 1302.79 1401.90 1.001
alpha{3} 0.456536 0.232722 0.000128 1.424201 0.307486 1133.55 1224.74 1.000
pinvar{all} 0.996269 0.000021 0.987772 0.999998 0.997700 1276.75 1353.15 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/12res/secE/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 146
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 0 0 0 0 0 0 | TAC 4 4 4 4 4 4 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 2 2 2 2 2 2 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 0 0 0 0
CTC 2 2 2 2 2 2 | CCC 0 0 0 0 0 0 | CAC 0 0 0 0 0 0 | CGC 4 4 4 4 4 4
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 2 2 2 2 2 2 | CGA 2 2 2 2 2 2
CTG 3 3 3 3 3 3 | CCG 4 4 4 4 4 4 | CAG 3 3 3 3 3 3 | CGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 4 4 4 4 4 4 | Asn AAT 3 3 3 3 3 3 | Ser AGT 1 1 1 1 1 1
ATC 2 2 2 2 2 2 | ACC 5 5 5 5 5 5 | AAC 3 3 3 3 3 3 | AGC 2 2 2 2 2 2
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 4 4 4 4 4 4 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 2 2 2 2 2 2 | AAG 8 8 8 8 8 8 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 4 4 4 4 4 4 | Asp GAT 2 2 2 2 2 2 | Gly GGT 1 1 1 1 1 1
GTC 7 7 7 7 7 7 | GCC 6 6 6 6 6 6 | GAC 2 2 2 2 2 2 | GGC 7 7 7 7 7 7
GTA 1 1 1 1 1 1 | GCA 3 3 3 3 3 3 | Glu GAA 3 3 3 3 3 3 | GGA 2 2 2 2 2 2
GTG 6 6 6 6 6 6 | GCG 4 4 4 4 4 4 | GAG 4 4 4 4 4 4 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908605_1_2033_MLBR_RS09645
position 1: T:0.13699 C:0.19178 A:0.27397 G:0.39726
position 2: T:0.26712 C:0.28082 A:0.26027 G:0.19178
position 3: T:0.19178 C:0.31507 A:0.12329 G:0.36986
Average T:0.19863 C:0.26256 A:0.21918 G:0.31963
#2: NC_002677_1_NP_302284_1_1156_secE
position 1: T:0.13699 C:0.19178 A:0.27397 G:0.39726
position 2: T:0.26712 C:0.28082 A:0.26027 G:0.19178
position 3: T:0.19178 C:0.31507 A:0.12329 G:0.36986
Average T:0.19863 C:0.26256 A:0.21918 G:0.31963
#3: NZ_LVXE01000028_1_WP_010908605_1_1139_A3216_RS08545
position 1: T:0.13699 C:0.19178 A:0.27397 G:0.39726
position 2: T:0.26712 C:0.28082 A:0.26027 G:0.19178
position 3: T:0.19178 C:0.31507 A:0.12329 G:0.36986
Average T:0.19863 C:0.26256 A:0.21918 G:0.31963
#4: NZ_LYPH01000031_1_WP_010908605_1_1221_A8144_RS05875
position 1: T:0.13699 C:0.19178 A:0.27397 G:0.39726
position 2: T:0.26712 C:0.28082 A:0.26027 G:0.19178
position 3: T:0.19178 C:0.31507 A:0.12329 G:0.36986
Average T:0.19863 C:0.26256 A:0.21918 G:0.31963
#5: NZ_CP029543_1_WP_010908605_1_2057_DIJ64_RS10465
position 1: T:0.13699 C:0.19178 A:0.27397 G:0.39726
position 2: T:0.26712 C:0.28082 A:0.26027 G:0.19178
position 3: T:0.19178 C:0.31507 A:0.12329 G:0.36986
Average T:0.19863 C:0.26256 A:0.21918 G:0.31963
#6: NZ_AP014567_1_WP_010908605_1_2112_secE
position 1: T:0.13699 C:0.19178 A:0.27397 G:0.39726
position 2: T:0.26712 C:0.28082 A:0.26027 G:0.19178
position 3: T:0.19178 C:0.31507 A:0.12329 G:0.36986
Average T:0.19863 C:0.26256 A:0.21918 G:0.31963
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 6 | Tyr Y TAT 0 | Cys C TGT 0
TTC 12 | TCC 0 | TAC 24 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 30 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 12 | His H CAT 0 | Arg R CGT 0
CTC 12 | CCC 0 | CAC 0 | CGC 24
CTA 0 | CCA 0 | Gln Q CAA 12 | CGA 12
CTG 18 | CCG 24 | CAG 18 | CGG 24
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 24 | Asn N AAT 18 | Ser S AGT 6
ATC 12 | ACC 30 | AAC 18 | AGC 12
ATA 0 | ACA 0 | Lys K AAA 24 | Arg R AGA 0
Met M ATG 18 | ACG 12 | AAG 48 | AGG 6
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 24 | Asp D GAT 12 | Gly G GGT 6
GTC 42 | GCC 36 | GAC 12 | GGC 42
GTA 6 | GCA 18 | Glu E GAA 18 | GGA 12
GTG 36 | GCG 24 | GAG 24 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13699 C:0.19178 A:0.27397 G:0.39726
position 2: T:0.26712 C:0.28082 A:0.26027 G:0.19178
position 3: T:0.19178 C:0.31507 A:0.12329 G:0.36986
Average T:0.19863 C:0.26256 A:0.21918 G:0.31963
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -579.957418 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300170 1.300221
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908605_1_2033_MLBR_RS09645: 0.000004, NC_002677_1_NP_302284_1_1156_secE: 0.000004, NZ_LVXE01000028_1_WP_010908605_1_1139_A3216_RS08545: 0.000004, NZ_LYPH01000031_1_WP_010908605_1_1221_A8144_RS05875: 0.000004, NZ_CP029543_1_WP_010908605_1_2057_DIJ64_RS10465: 0.000004, NZ_AP014567_1_WP_010908605_1_2112_secE: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30017
omega (dN/dS) = 1.30022
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 339.2 98.8 1.3002 0.0000 0.0000 0.0 0.0
7..2 0.000 339.2 98.8 1.3002 0.0000 0.0000 0.0 0.0
7..3 0.000 339.2 98.8 1.3002 0.0000 0.0000 0.0 0.0
7..4 0.000 339.2 98.8 1.3002 0.0000 0.0000 0.0 0.0
7..5 0.000 339.2 98.8 1.3002 0.0000 0.0000 0.0 0.0
7..6 0.000 339.2 98.8 1.3002 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -579.957426 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.190960 0.000010 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908605_1_2033_MLBR_RS09645: 0.000004, NC_002677_1_NP_302284_1_1156_secE: 0.000004, NZ_LVXE01000028_1_WP_010908605_1_1139_A3216_RS08545: 0.000004, NZ_LYPH01000031_1_WP_010908605_1_1221_A8144_RS05875: 0.000004, NZ_CP029543_1_WP_010908605_1_2057_DIJ64_RS10465: 0.000004, NZ_AP014567_1_WP_010908605_1_2112_secE: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.19096
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 340.5 97.5 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 340.5 97.5 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 340.5 97.5 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 340.5 97.5 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 340.5 97.5 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 340.5 97.5 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -579.957381 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000000 0.000000 1.000000 67.314542
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908605_1_2033_MLBR_RS09645: 0.000004, NC_002677_1_NP_302284_1_1156_secE: 0.000004, NZ_LVXE01000028_1_WP_010908605_1_1139_A3216_RS08545: 0.000004, NZ_LYPH01000031_1_WP_010908605_1_1221_A8144_RS05875: 0.000004, NZ_CP029543_1_WP_010908605_1_2057_DIJ64_RS10465: 0.000004, NZ_AP014567_1_WP_010908605_1_2112_secE: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 1.00000 1.00000 67.31454
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 343.0 95.0 67.3145 0.0000 0.0000 0.0 0.0
7..2 0.000 343.0 95.0 67.3145 0.0000 0.0000 0.0 0.0
7..3 0.000 343.0 95.0 67.3145 0.0000 0.0000 0.0 0.0
7..4 0.000 343.0 95.0 67.3145 0.0000 0.0000 0.0 0.0
7..5 0.000 343.0 95.0 67.3145 0.0000 0.0000 0.0 0.0
7..6 0.000 343.0 95.0 67.3145 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908605_1_2033_MLBR_RS09645)
Pr(w>1) post mean +- SE for w
1 V 1.000** 67.315
2 S 1.000** 67.315
3 D 1.000** 67.315
4 E 1.000** 67.315
5 R 1.000** 67.315
6 Y 1.000** 67.315
7 A 1.000** 67.315
8 A 1.000** 67.315
9 S 1.000** 67.315
10 D 1.000** 67.315
11 G 1.000** 67.315
12 G 1.000** 67.315
13 G 1.000** 67.315
14 T 1.000** 67.315
15 E 1.000** 67.315
16 V 1.000** 67.315
17 G 1.000** 67.315
18 S 1.000** 67.315
19 G 1.000** 67.315
20 T 1.000** 67.315
21 R 1.000** 67.315
22 G 1.000** 67.315
23 R 1.000** 67.315
24 T 1.000** 67.315
25 T 1.000** 67.315
26 V 1.000** 67.315
27 V 1.000** 67.315
28 T 1.000** 67.315
29 K 1.000** 67.315
30 P 1.000** 67.315
31 A 1.000** 67.315
32 T 1.000** 67.315
33 R 1.000** 67.315
34 P 1.000** 67.315
35 Q 1.000** 67.315
36 R 1.000** 67.315
37 P 1.000** 67.315
38 T 1.000** 67.315
39 G 1.000** 67.315
40 K 1.000** 67.315
41 R 1.000** 67.315
42 S 1.000** 67.315
43 R 1.000** 67.315
44 Q 1.000** 67.315
45 R 1.000** 67.315
46 A 1.000** 67.315
47 A 1.000** 67.315
48 N 1.000** 67.315
49 A 1.000** 67.315
50 S 1.000** 67.315
51 N 1.000** 67.315
52 T 1.000** 67.315
53 G 1.000** 67.315
54 A 1.000** 67.315
55 N 1.000** 67.315
56 V 1.000** 67.315
57 E 1.000** 67.315
58 V 1.000** 67.315
59 E 1.000** 67.315
60 E 1.000** 67.315
61 S 1.000** 67.315
62 S 1.000** 67.315
63 T 1.000** 67.315
64 Q 1.000** 67.315
65 A 1.000** 67.315
66 A 1.000** 67.315
67 I 1.000** 67.315
68 A 1.000** 67.315
69 K 1.000** 67.315
70 E 1.000** 67.315
71 G 1.000** 67.315
72 K 1.000** 67.315
73 V 1.000** 67.315
74 K 1.000** 67.315
75 K 1.000** 67.315
76 P 1.000** 67.315
77 K 1.000** 67.315
78 K 1.000** 67.315
79 S 1.000** 67.315
80 A 1.000** 67.315
81 D 1.000** 67.315
82 R 1.000** 67.315
83 S 1.000** 67.315
84 A 1.000** 67.315
85 N 1.000** 67.315
86 P 1.000** 67.315
87 I 1.000** 67.315
88 V 1.000** 67.315
89 F 1.000** 67.315
90 I 1.000** 67.315
91 Y 1.000** 67.315
92 N 1.000** 67.315
93 Y 1.000** 67.315
94 L 1.000** 67.315
95 K 1.000** 67.315
96 Q 1.000** 67.315
97 V 1.000** 67.315
98 V 1.000** 67.315
99 G 1.000** 67.315
100 E 1.000** 67.315
101 M 1.000** 67.315
102 R 1.000** 67.315
103 K 1.000** 67.315
104 V 1.000** 67.315
105 I 1.000** 67.315
106 W 1.000** 67.315
107 P 1.000** 67.315
108 N 1.000** 67.315
109 R 1.000** 67.315
110 K 1.000** 67.315
111 Q 1.000** 67.315
112 M 1.000** 67.315
113 L 1.000** 67.315
114 T 1.000** 67.315
115 Y 1.000** 67.315
116 T 1.000** 67.315
117 S 1.000** 67.315
118 V 1.000** 67.315
119 V 1.000** 67.315
120 L 1.000** 67.315
121 A 1.000** 67.315
122 F 1.000** 67.315
123 L 1.000** 67.315
124 A 1.000** 67.315
125 F 1.000** 67.315
126 M 1.000** 67.315
127 V 1.000** 67.315
128 A 1.000** 67.315
129 L 1.000** 67.315
130 V 1.000** 67.315
131 G 1.000** 67.315
132 L 1.000** 67.315
133 A 1.000** 67.315
134 D 1.000** 67.315
135 F 1.000** 67.315
136 G 1.000** 67.315
137 L 1.000** 67.315
138 A 1.000** 67.315
139 K 1.000** 67.315
140 L 1.000** 67.315
141 V 1.000** 67.315
142 L 1.000** 67.315
143 L 1.000** 67.315
144 V 1.000** 67.315
145 F 1.000** 67.315
146 G 1.000** 67.315
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908605_1_2033_MLBR_RS09645)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -579.957465 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 45.771768 71.613163
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908605_1_2033_MLBR_RS09645: 0.000004, NC_002677_1_NP_302284_1_1156_secE: 0.000004, NZ_LVXE01000028_1_WP_010908605_1_1139_A3216_RS08545: 0.000004, NZ_LYPH01000031_1_WP_010908605_1_1221_A8144_RS05875: 0.000004, NZ_CP029543_1_WP_010908605_1_2057_DIJ64_RS10465: 0.000004, NZ_AP014567_1_WP_010908605_1_2112_secE: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 45.77177 q = 71.61316
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.31724 0.34334 0.35920 0.37202 0.38364 0.39498 0.40677 0.41998 0.43661 0.46476
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 343.0 95.0 0.3899 0.0000 0.0000 0.0 0.0
7..2 0.000 343.0 95.0 0.3899 0.0000 0.0000 0.0 0.0
7..3 0.000 343.0 95.0 0.3899 0.0000 0.0000 0.0 0.0
7..4 0.000 343.0 95.0 0.3899 0.0000 0.0000 0.0 0.0
7..5 0.000 343.0 95.0 0.3899 0.0000 0.0000 0.0 0.0
7..6 0.000 343.0 95.0 0.3899 0.0000 0.0000 0.0 0.0
Time used: 0:11
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -579.957380 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.766196 2.032274 116.063290
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908605_1_2033_MLBR_RS09645: 0.000004, NC_002677_1_NP_302284_1_1156_secE: 0.000004, NZ_LVXE01000028_1_WP_010908605_1_1139_A3216_RS08545: 0.000004, NZ_LYPH01000031_1_WP_010908605_1_1221_A8144_RS05875: 0.000004, NZ_CP029543_1_WP_010908605_1_2057_DIJ64_RS10465: 0.000004, NZ_AP014567_1_WP_010908605_1_2112_secE: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.76620 q = 2.03227
(p1 = 0.99999) w = 116.06329
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00943 0.04030 0.08040 0.12845 0.18471 0.25039 0.32790 0.42196 0.54316 0.72852 116.06329
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 343.0 95.0 116.0621 0.0000 0.0000 0.0 0.0
7..2 0.000 343.0 95.0 116.0621 0.0000 0.0000 0.0 0.0
7..3 0.000 343.0 95.0 116.0621 0.0000 0.0000 0.0 0.0
7..4 0.000 343.0 95.0 116.0621 0.0000 0.0000 0.0 0.0
7..5 0.000 343.0 95.0 116.0621 0.0000 0.0000 0.0 0.0
7..6 0.000 343.0 95.0 116.0621 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908605_1_2033_MLBR_RS09645)
Pr(w>1) post mean +- SE for w
1 V 1.000** 116.062
2 S 1.000** 116.062
3 D 1.000** 116.062
4 E 1.000** 116.062
5 R 1.000** 116.062
6 Y 1.000** 116.062
7 A 1.000** 116.062
8 A 1.000** 116.062
9 S 1.000** 116.062
10 D 1.000** 116.062
11 G 1.000** 116.062
12 G 1.000** 116.062
13 G 1.000** 116.062
14 T 1.000** 116.062
15 E 1.000** 116.062
16 V 1.000** 116.062
17 G 1.000** 116.062
18 S 1.000** 116.062
19 G 1.000** 116.062
20 T 1.000** 116.062
21 R 1.000** 116.062
22 G 1.000** 116.062
23 R 1.000** 116.062
24 T 1.000** 116.062
25 T 1.000** 116.062
26 V 1.000** 116.062
27 V 1.000** 116.062
28 T 1.000** 116.062
29 K 1.000** 116.062
30 P 1.000** 116.062
31 A 1.000** 116.062
32 T 1.000** 116.062
33 R 1.000** 116.062
34 P 1.000** 116.062
35 Q 1.000** 116.062
36 R 1.000** 116.062
37 P 1.000** 116.062
38 T 1.000** 116.062
39 G 1.000** 116.062
40 K 1.000** 116.062
41 R 1.000** 116.062
42 S 1.000** 116.062
43 R 1.000** 116.062
44 Q 1.000** 116.062
45 R 1.000** 116.062
46 A 1.000** 116.062
47 A 1.000** 116.062
48 N 1.000** 116.062
49 A 1.000** 116.062
50 S 1.000** 116.062
51 N 1.000** 116.062
52 T 1.000** 116.062
53 G 1.000** 116.062
54 A 1.000** 116.062
55 N 1.000** 116.062
56 V 1.000** 116.062
57 E 1.000** 116.062
58 V 1.000** 116.062
59 E 1.000** 116.062
60 E 1.000** 116.062
61 S 1.000** 116.062
62 S 1.000** 116.062
63 T 1.000** 116.062
64 Q 1.000** 116.062
65 A 1.000** 116.062
66 A 1.000** 116.062
67 I 1.000** 116.062
68 A 1.000** 116.062
69 K 1.000** 116.062
70 E 1.000** 116.062
71 G 1.000** 116.062
72 K 1.000** 116.062
73 V 1.000** 116.062
74 K 1.000** 116.062
75 K 1.000** 116.062
76 P 1.000** 116.062
77 K 1.000** 116.062
78 K 1.000** 116.062
79 S 1.000** 116.062
80 A 1.000** 116.062
81 D 1.000** 116.062
82 R 1.000** 116.062
83 S 1.000** 116.062
84 A 1.000** 116.062
85 N 1.000** 116.062
86 P 1.000** 116.062
87 I 1.000** 116.062
88 V 1.000** 116.062
89 F 1.000** 116.062
90 I 1.000** 116.062
91 Y 1.000** 116.062
92 N 1.000** 116.062
93 Y 1.000** 116.062
94 L 1.000** 116.062
95 K 1.000** 116.062
96 Q 1.000** 116.062
97 V 1.000** 116.062
98 V 1.000** 116.062
99 G 1.000** 116.062
100 E 1.000** 116.062
101 M 1.000** 116.062
102 R 1.000** 116.062
103 K 1.000** 116.062
104 V 1.000** 116.062
105 I 1.000** 116.062
106 W 1.000** 116.062
107 P 1.000** 116.062
108 N 1.000** 116.062
109 R 1.000** 116.062
110 K 1.000** 116.062
111 Q 1.000** 116.062
112 M 1.000** 116.062
113 L 1.000** 116.062
114 T 1.000** 116.062
115 Y 1.000** 116.062
116 T 1.000** 116.062
117 S 1.000** 116.062
118 V 1.000** 116.062
119 V 1.000** 116.062
120 L 1.000** 116.062
121 A 1.000** 116.062
122 F 1.000** 116.062
123 L 1.000** 116.062
124 A 1.000** 116.062
125 F 1.000** 116.062
126 M 1.000** 116.062
127 V 1.000** 116.062
128 A 1.000** 116.062
129 L 1.000** 116.062
130 V 1.000** 116.062
131 G 1.000** 116.062
132 L 1.000** 116.062
133 A 1.000** 116.062
134 D 1.000** 116.062
135 F 1.000** 116.062
136 G 1.000** 116.062
137 L 1.000** 116.062
138 A 1.000** 116.062
139 K 1.000** 116.062
140 L 1.000** 116.062
141 V 1.000** 116.062
142 L 1.000** 116.062
143 L 1.000** 116.062
144 V 1.000** 116.062
145 F 1.000** 116.062
146 G 1.000** 116.062
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908605_1_2033_MLBR_RS09645)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:18
Model 1: NearlyNeutral -579.957426 Model 2: PositiveSelection -579.957381 Model 0: one-ratio -579.957418 Model 7: beta -579.957465 Model 8: beta&w>1 -579.95738 Model 0 vs 1 1.600000018697756E-5 Model 2 vs 1 9.000000000014552E-5 Model 8 vs 7 1.700000000255386E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
