--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:17:39 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/secE/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -601.53          -605.37
2       -601.59          -605.91
--------------------------------------
TOTAL     -601.56          -605.68
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.886563    0.089662    0.354160    1.461404    0.849453   1049.55   1210.64    1.000
r(A<->C){all}   0.156241    0.017958    0.000003    0.429621    0.118311    157.23    284.13    1.001
r(A<->G){all}   0.181389    0.022563    0.000043    0.478846    0.139931    186.83    291.04    1.000
r(A<->T){all}   0.171006    0.018833    0.000048    0.441819    0.140652    152.57    210.38    1.000
r(C<->G){all}   0.170506    0.022866    0.000070    0.479111    0.128981     97.26    119.55    1.005
r(C<->T){all}   0.158667    0.018525    0.000065    0.447954    0.122132    138.00    154.87    1.001
r(G<->T){all}   0.162191    0.018837    0.000183    0.445299    0.123893    241.03    251.08    1.000
pi(A){all}      0.219847    0.000386    0.182063    0.258193    0.219455   1111.18   1306.09    1.001
pi(C){all}      0.262723    0.000434    0.223421    0.303635    0.262276   1237.51   1353.83    1.000
pi(G){all}      0.318872    0.000491    0.278141    0.364499    0.318591   1283.12   1298.97    1.000
pi(T){all}      0.198557    0.000369    0.164891    0.239683    0.198101   1217.96   1313.06    1.000
alpha{1,2}      0.406443    0.215752    0.000156    1.369227    0.242433   1302.79   1401.90    1.001
alpha{3}        0.456536    0.232722    0.000128    1.424201    0.307486   1133.55   1224.74    1.000
pinvar{all}     0.996269    0.000021    0.987772    0.999998    0.997700   1276.75   1353.15    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-579.957426
Model 2: PositiveSelection	-579.957381
Model 0: one-ratio	-579.957418
Model 7: beta	-579.957465
Model 8: beta&w>1	-579.95738


Model 0 vs 1	1.600000018697756E-5

Model 2 vs 1	9.000000000014552E-5

Model 8 vs 7	1.700000000255386E-4
>C1
VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
>C2
VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
>C3
VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
>C4
VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
>C5
VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
>C6
VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=146 

C1              VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
C2              VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
C3              VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
C4              VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
C5              VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
C6              VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
                **************************************************

C1              NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
C2              NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
C3              NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
C4              NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
C5              NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
C6              NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
                **************************************************

C1              MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
C2              MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
C3              MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
C4              MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
C5              MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
C6              MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
                **********************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [4380]--->[4380]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.456 Mb, Max= 30.669 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
C2              VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
C3              VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
C4              VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
C5              VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
C6              VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
                **************************************************

C1              NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
C2              NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
C3              NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
C4              NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
C5              NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
C6              NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
                **************************************************

C1              MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
C2              MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
C3              MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
C4              MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
C5              MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
C6              MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
                **********************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG
C2              GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG
C3              GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG
C4              GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG
C5              GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG
C6              GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG
                **************************************************

C1              TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC
C2              TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC
C3              TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC
C4              TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC
C5              TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC
C6              TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC
                **************************************************

C1              CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG
C2              CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG
C3              CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG
C4              CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG
C5              CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG
C6              CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG
                **************************************************

C1              AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT
C2              AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT
C3              AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT
C4              AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT
C5              AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT
C6              AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT
                **************************************************

C1              TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG
C2              TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG
C3              TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG
C4              TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG
C5              TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG
C6              TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG
                **************************************************

C1              CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG
C2              CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG
C3              CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG
C4              CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG
C5              CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG
C6              CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG
                **************************************************

C1              ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC
C2              ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC
C3              ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC
C4              ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC
C5              ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC
C6              ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC
                **************************************************

C1              AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG
C2              AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG
C3              AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG
C4              AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG
C5              AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG
C6              AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG
                **************************************************

C1              ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC
C2              ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC
C3              ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC
C4              ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC
C5              ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC
C6              ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC
                **************************************



>C1
GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG
TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC
CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG
AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT
TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG
CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG
ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC
AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG
ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC
>C2
GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG
TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC
CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG
AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT
TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG
CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG
ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC
AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG
ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC
>C3
GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG
TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC
CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG
AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT
TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG
CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG
ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC
AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG
ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC
>C4
GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG
TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC
CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG
AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT
TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG
CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG
ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC
AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG
ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC
>C5
GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG
TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC
CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG
AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT
TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG
CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG
ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC
AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG
ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC
>C6
GTGAGCGACGAGAGGTACGCTGCCAGCGACGGCGGGGGAACCGAAGTCGG
TAGTGGGACCCGCGGCCGGACGACCGTGGTCACGAAACCGGCAACTCGAC
CGCAACGCCCTACCGGCAAGCGGTCTCGGCAGCGAGCAGCGAATGCCTCG
AATACTGGGGCCAACGTCGAGGTCGAAGAGTCGTCGACTCAGGCTGCGAT
TGCCAAGGAAGGCAAGGTCAAAAAGCCGAAGAAATCGGCGGATCGCTCGG
CTAACCCGATCGTATTCATTTACAATTACCTCAAGCAGGTCGTTGGAGAG
ATGCGGAAGGTTATCTGGCCTAACCGCAAACAAATGCTCACTTACACCTC
AGTCGTGTTGGCGTTTCTTGCCTTTATGGTGGCACTGGTTGGCCTTGCTG
ATTTTGGCCTGGCCAAGCTGGTGTTGTTGGTGTTCGGC
>C1
VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
>C2
VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
>C3
VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
>C4
VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
>C5
VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG
>C6
VSDERYAASDGGGTEVGSGTRGRTTVVTKPATRPQRPTGKRSRQRAANAS
NTGANVEVEESSTQAAIAKEGKVKKPKKSADRSANPIVFIYNYLKQVVGE
MRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 438 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579788980
      Setting output file names to "/data/12res/secE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 2063391820
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0120562606
      Seed = 2029700465
      Swapseed = 1579788980
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -980.264998 -- -24.965149
         Chain 2 -- -980.264998 -- -24.965149
         Chain 3 -- -980.264848 -- -24.965149
         Chain 4 -- -980.264998 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -980.264941 -- -24.965149
         Chain 2 -- -980.264941 -- -24.965149
         Chain 3 -- -980.264998 -- -24.965149
         Chain 4 -- -980.264998 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-980.265] (-980.265) (-980.265) (-980.265) * [-980.265] (-980.265) (-980.265) (-980.265) 
        500 -- (-615.492) [-611.479] (-608.488) (-615.700) * (-611.106) [-613.252] (-618.272) (-610.434) -- 0:00:00
       1000 -- (-611.103) [-605.480] (-611.733) (-606.942) * (-609.836) (-610.083) (-616.827) [-609.246] -- 0:00:00
       1500 -- (-611.622) (-618.990) (-608.732) [-606.195] * [-609.187] (-618.778) (-623.157) (-609.042) -- 0:00:00
       2000 -- (-605.930) (-612.523) (-611.126) [-605.142] * (-610.803) (-618.609) (-624.300) [-610.987] -- 0:00:00
       2500 -- (-614.218) (-618.282) (-608.425) [-612.202] * (-613.260) (-613.125) [-609.426] (-609.471) -- 0:00:00
       3000 -- (-615.288) [-608.237] (-613.226) (-615.809) * (-618.616) (-610.844) [-605.609] (-608.151) -- 0:00:00
       3500 -- (-609.017) (-617.622) (-611.874) [-608.903] * [-608.908] (-615.854) (-615.898) (-609.185) -- 0:00:00
       4000 -- [-612.569] (-617.958) (-614.124) (-620.074) * (-611.378) (-608.213) [-605.323] (-609.837) -- 0:00:00
       4500 -- [-610.308] (-618.354) (-618.955) (-614.137) * (-611.989) (-611.879) [-610.062] (-611.772) -- 0:00:00
       5000 -- (-616.535) [-608.958] (-613.551) (-611.388) * [-605.046] (-610.960) (-611.422) (-612.083) -- 0:00:00

      Average standard deviation of split frequencies: 0.078567

       5500 -- (-624.324) (-611.083) (-616.798) [-616.497] * (-614.645) [-610.495] (-610.824) (-610.192) -- 0:03:00
       6000 -- (-624.852) [-606.405] (-615.591) (-616.392) * (-608.424) (-621.631) [-610.908] (-629.557) -- 0:02:45
       6500 -- [-607.880] (-612.898) (-613.643) (-609.336) * (-610.324) (-610.736) [-612.234] (-615.593) -- 0:02:32
       7000 -- (-616.381) [-605.824] (-617.653) (-613.869) * (-614.145) (-611.874) [-605.661] (-619.394) -- 0:02:21
       7500 -- (-611.333) (-618.422) (-618.131) [-620.256] * (-611.327) (-608.156) (-612.764) [-606.771] -- 0:02:12
       8000 -- (-608.253) [-616.987] (-617.857) (-610.843) * (-607.567) (-614.920) [-617.818] (-612.203) -- 0:02:04
       8500 -- (-613.994) (-607.165) [-608.084] (-611.823) * [-608.431] (-615.787) (-604.894) (-613.298) -- 0:01:56
       9000 -- (-616.267) (-614.401) [-603.677] (-609.688) * [-609.963] (-608.435) (-621.552) (-613.696) -- 0:01:50
       9500 -- [-611.286] (-615.533) (-614.533) (-612.512) * (-609.690) (-613.458) (-621.266) [-609.603] -- 0:01:44
      10000 -- (-619.366) (-615.620) (-612.044) [-609.603] * (-615.971) (-610.697) (-612.822) [-610.087] -- 0:01:39

      Average standard deviation of split frequencies: 0.072920

      10500 -- [-605.865] (-608.447) (-609.012) (-615.003) * (-608.658) (-605.139) [-610.180] (-615.621) -- 0:01:34
      11000 -- (-612.658) (-613.692) [-613.597] (-607.336) * (-630.684) (-612.346) [-610.093] (-609.960) -- 0:01:29
      11500 -- (-617.539) (-612.445) (-613.652) [-610.280] * (-619.904) (-615.775) [-611.800] (-609.800) -- 0:01:25
      12000 -- (-611.569) (-612.779) (-604.067) [-612.282] * (-614.080) (-610.623) [-622.534] (-611.495) -- 0:01:22
      12500 -- (-614.812) (-617.654) [-611.867] (-609.042) * (-609.236) (-616.361) [-610.652] (-611.488) -- 0:01:19
      13000 -- [-612.085] (-610.330) (-613.745) (-612.530) * (-624.019) (-607.526) [-611.248] (-616.995) -- 0:01:15
      13500 -- (-606.201) [-606.289] (-614.419) (-610.384) * (-605.466) (-614.601) [-606.584] (-616.677) -- 0:01:13
      14000 -- (-614.905) [-605.394] (-611.599) (-609.365) * (-614.651) (-608.563) (-609.442) [-608.037] -- 0:01:10
      14500 -- (-617.248) [-617.179] (-611.261) (-614.986) * (-612.685) (-618.642) (-616.433) [-611.203] -- 0:01:07
      15000 -- (-611.081) (-609.797) [-608.553] (-618.558) * [-606.961] (-607.916) (-610.763) (-621.392) -- 0:01:05

      Average standard deviation of split frequencies: 0.061872

      15500 -- (-611.363) (-614.603) [-610.642] (-615.139) * (-629.311) [-610.883] (-609.079) (-611.303) -- 0:01:03
      16000 -- (-608.414) [-612.929] (-608.325) (-612.967) * (-612.614) [-614.155] (-607.916) (-606.805) -- 0:01:01
      16500 -- (-609.072) (-606.399) (-613.153) [-610.548] * (-603.074) (-616.006) [-604.097] (-614.237) -- 0:00:59
      17000 -- (-611.495) (-620.428) [-611.594] (-612.388) * [-602.377] (-614.084) (-607.366) (-610.576) -- 0:00:57
      17500 -- (-614.052) (-617.622) (-610.434) [-607.641] * (-601.268) (-613.964) [-609.861] (-609.903) -- 0:00:56
      18000 -- [-610.950] (-616.061) (-610.266) (-611.708) * (-603.897) (-614.250) [-606.540] (-605.855) -- 0:00:54
      18500 -- (-608.855) (-612.640) [-611.461] (-618.750) * (-600.300) [-609.649] (-615.346) (-605.082) -- 0:00:53
      19000 -- (-600.846) [-600.669] (-614.410) (-607.370) * (-601.903) (-613.603) [-608.746] (-618.060) -- 0:00:51
      19500 -- (-602.405) [-601.163] (-619.213) (-614.810) * (-601.374) (-616.490) [-607.086] (-610.330) -- 0:00:50
      20000 -- (-603.139) [-604.042] (-612.641) (-611.110) * (-603.300) (-620.663) (-605.787) [-610.593] -- 0:00:49

      Average standard deviation of split frequencies: 0.062094

      20500 -- (-601.321) (-603.895) (-617.478) [-608.717] * [-601.778] (-614.374) (-612.955) (-610.127) -- 0:00:47
      21000 -- (-600.622) [-601.414] (-613.463) (-609.534) * [-602.157] (-604.746) (-608.407) (-610.971) -- 0:01:33
      21500 -- (-602.805) [-603.580] (-600.288) (-608.718) * (-600.250) (-607.734) [-612.457] (-617.327) -- 0:01:31
      22000 -- (-602.608) (-600.910) (-605.963) [-614.211] * [-600.959] (-612.177) (-618.307) (-616.957) -- 0:01:28
      22500 -- (-600.940) (-606.870) (-603.530) [-610.488] * (-603.064) (-623.054) [-618.200] (-607.223) -- 0:01:26
      23000 -- [-603.532] (-602.615) (-600.807) (-624.389) * (-604.174) (-616.598) (-616.772) [-611.923] -- 0:01:24
      23500 -- [-602.109] (-603.958) (-600.702) (-612.191) * (-604.804) [-611.583] (-609.787) (-615.587) -- 0:01:23
      24000 -- (-601.090) [-600.914] (-602.853) (-606.580) * [-602.642] (-613.462) (-618.646) (-607.308) -- 0:01:21
      24500 -- (-602.395) (-601.677) [-602.865] (-602.302) * (-603.438) (-608.547) (-611.421) [-612.108] -- 0:01:19
      25000 -- (-600.749) (-601.617) (-602.014) [-600.449] * [-602.486] (-610.324) (-617.677) (-617.824) -- 0:01:18

      Average standard deviation of split frequencies: 0.051920

      25500 -- (-600.253) (-601.339) [-601.765] (-600.872) * (-601.635) (-626.756) [-607.613] (-607.787) -- 0:01:16
      26000 -- [-603.535] (-601.022) (-603.833) (-605.369) * (-605.284) (-609.907) (-615.267) [-609.350] -- 0:01:14
      26500 -- [-602.163] (-601.179) (-606.750) (-601.745) * (-605.957) [-607.563] (-615.468) (-612.048) -- 0:01:13
      27000 -- (-603.515) (-602.372) (-602.784) [-603.179] * (-601.523) [-605.185] (-611.064) (-612.250) -- 0:01:12
      27500 -- (-603.566) (-608.425) (-604.658) [-601.362] * (-605.118) (-603.492) (-608.595) [-607.209] -- 0:01:10
      28000 -- (-602.157) (-602.707) [-600.790] (-601.961) * (-600.953) (-600.435) [-609.989] (-614.938) -- 0:01:09
      28500 -- [-601.369] (-603.873) (-601.580) (-603.426) * (-603.122) (-600.850) (-606.316) [-607.519] -- 0:01:08
      29000 -- (-604.614) (-602.587) (-600.863) [-601.296] * (-605.117) (-600.538) [-613.345] (-619.655) -- 0:01:06
      29500 -- [-602.122] (-603.696) (-603.597) (-601.938) * (-604.068) (-601.733) (-616.733) [-609.911] -- 0:01:05
      30000 -- [-601.746] (-602.969) (-604.269) (-602.614) * [-604.600] (-600.634) (-614.913) (-615.545) -- 0:01:04

      Average standard deviation of split frequencies: 0.045417

      30500 -- (-602.502) (-601.190) [-601.631] (-602.469) * (-602.583) [-600.410] (-617.551) (-618.298) -- 0:01:03
      31000 -- (-603.235) [-601.122] (-602.151) (-602.689) * [-603.836] (-602.613) (-617.937) (-618.476) -- 0:01:02
      31500 -- (-604.730) [-601.662] (-602.089) (-602.696) * (-601.526) [-602.982] (-607.212) (-606.680) -- 0:01:01
      32000 -- (-604.069) [-601.863] (-601.314) (-603.363) * (-603.002) (-603.223) (-613.836) [-609.721] -- 0:01:00
      32500 -- (-604.287) [-603.831] (-601.079) (-601.933) * (-600.735) [-601.323] (-608.411) (-612.147) -- 0:00:59
      33000 -- (-605.231) (-602.268) [-601.047] (-602.409) * (-601.077) (-600.099) (-615.900) [-612.229] -- 0:00:58
      33500 -- (-602.579) (-607.117) [-600.509] (-602.648) * (-601.667) [-599.989] (-607.840) (-614.808) -- 0:00:57
      34000 -- [-602.523] (-607.505) (-605.735) (-602.038) * (-607.374) (-603.336) [-616.170] (-617.402) -- 0:00:56
      34500 -- (-600.555) (-610.964) [-605.518] (-600.737) * (-603.711) (-601.600) (-613.094) [-617.144] -- 0:00:55
      35000 -- (-601.169) (-608.098) [-600.132] (-601.194) * (-603.933) [-600.396] (-616.095) (-608.456) -- 0:01:22

      Average standard deviation of split frequencies: 0.045831

      35500 -- (-602.014) (-601.162) [-602.925] (-600.501) * [-600.630] (-601.273) (-613.134) (-609.536) -- 0:01:21
      36000 -- (-601.023) [-601.950] (-601.231) (-602.524) * (-602.449) (-601.733) [-610.719] (-606.267) -- 0:01:20
      36500 -- (-602.984) (-601.130) [-602.210] (-605.642) * (-604.578) (-600.612) (-610.112) [-611.245] -- 0:01:19
      37000 -- (-601.259) [-602.428] (-606.799) (-602.159) * (-603.940) (-600.963) (-614.965) [-610.712] -- 0:01:18
      37500 -- (-603.700) (-601.727) [-601.326] (-601.913) * (-603.876) (-601.952) (-614.928) [-605.004] -- 0:01:17
      38000 -- (-601.139) (-603.937) (-602.516) [-602.456] * (-601.826) (-601.960) [-602.524] (-608.573) -- 0:01:15
      38500 -- (-601.481) (-602.103) [-600.628] (-602.820) * (-602.741) (-602.195) [-600.765] (-612.200) -- 0:01:14
      39000 -- (-603.127) (-603.433) [-600.539] (-600.683) * (-602.101) [-601.287] (-601.385) (-623.161) -- 0:01:13
      39500 -- (-605.204) [-603.685] (-600.347) (-601.213) * (-601.192) (-601.568) [-601.699] (-615.356) -- 0:01:12
      40000 -- (-603.498) (-602.191) (-601.897) [-604.239] * (-600.591) [-600.643] (-602.031) (-606.253) -- 0:01:12

      Average standard deviation of split frequencies: 0.046368

      40500 -- (-604.659) (-601.990) (-605.214) [-601.927] * [-600.539] (-605.089) (-603.488) (-601.635) -- 0:01:11
      41000 -- (-603.001) [-600.731] (-603.408) (-602.496) * (-600.332) (-602.497) [-603.236] (-600.555) -- 0:01:10
      41500 -- (-601.632) [-600.834] (-600.746) (-603.394) * (-600.699) [-600.639] (-605.026) (-602.655) -- 0:01:09
      42000 -- (-604.356) (-600.687) (-602.474) [-602.615] * (-603.430) (-602.221) (-601.529) [-602.150] -- 0:01:08
      42500 -- (-602.343) (-604.119) (-604.725) [-601.810] * (-602.214) (-604.530) [-601.858] (-602.825) -- 0:01:07
      43000 -- (-607.969) (-604.118) (-603.134) [-602.263] * [-602.035] (-601.453) (-602.058) (-603.098) -- 0:01:06
      43500 -- (-605.870) (-602.793) (-601.286) [-603.762] * (-601.659) [-601.265] (-602.234) (-602.053) -- 0:01:05
      44000 -- [-604.081] (-601.343) (-603.644) (-604.317) * [-600.322] (-601.800) (-603.896) (-604.286) -- 0:01:05
      44500 -- (-600.333) (-603.719) (-604.399) [-603.804] * (-601.443) (-602.274) (-600.923) [-602.631] -- 0:01:04
      45000 -- (-600.278) (-600.985) [-601.995] (-603.899) * [-600.310] (-601.009) (-600.936) (-600.459) -- 0:01:03

      Average standard deviation of split frequencies: 0.044718

      45500 -- (-600.233) (-607.582) (-601.758) [-601.494] * (-601.872) (-601.911) [-601.967] (-600.190) -- 0:01:02
      46000 -- (-601.679) (-600.562) (-601.684) [-602.417] * (-600.554) (-611.218) [-604.154] (-601.018) -- 0:01:02
      46500 -- (-601.309) (-602.228) [-601.522] (-606.862) * [-602.356] (-604.102) (-600.207) (-600.259) -- 0:01:01
      47000 -- (-600.387) [-605.044] (-603.997) (-603.882) * (-602.909) (-602.132) [-604.573] (-601.067) -- 0:01:00
      47500 -- (-602.399) (-607.121) [-606.769] (-600.377) * (-603.747) [-601.189] (-605.384) (-600.575) -- 0:01:00
      48000 -- (-602.936) (-607.647) (-602.490) [-602.449] * (-604.956) (-601.059) [-605.007] (-601.852) -- 0:00:59
      48500 -- (-601.482) [-601.209] (-603.698) (-601.660) * (-605.685) [-601.301] (-602.916) (-608.522) -- 0:00:58
      49000 -- (-601.286) (-602.593) (-601.838) [-601.379] * (-602.741) (-601.991) (-601.923) [-600.992] -- 0:00:58
      49500 -- (-601.744) [-603.787] (-603.038) (-603.713) * [-603.810] (-602.548) (-604.072) (-600.682) -- 0:00:57
      50000 -- (-603.465) (-602.260) (-603.009) [-602.535] * [-605.149] (-604.306) (-603.379) (-600.663) -- 0:00:57

      Average standard deviation of split frequencies: 0.046030

      50500 -- [-600.828] (-603.173) (-601.783) (-601.059) * [-601.652] (-603.212) (-602.525) (-602.599) -- 0:00:56
      51000 -- [-601.053] (-602.027) (-602.287) (-601.002) * [-604.135] (-603.664) (-604.044) (-601.139) -- 0:00:55
      51500 -- (-601.682) [-603.360] (-601.230) (-602.342) * (-603.455) (-604.890) (-602.001) [-601.487] -- 0:01:13
      52000 -- (-600.834) (-602.785) [-604.233] (-601.046) * (-600.882) (-604.430) [-600.566] (-601.065) -- 0:01:12
      52500 -- [-600.251] (-601.374) (-604.589) (-603.648) * (-611.381) (-603.148) [-602.697] (-600.293) -- 0:01:12
      53000 -- [-602.954] (-600.790) (-601.643) (-601.330) * (-603.935) (-601.805) [-601.255] (-600.820) -- 0:01:11
      53500 -- (-602.963) (-603.420) [-600.729] (-600.452) * [-600.714] (-601.402) (-601.806) (-601.614) -- 0:01:10
      54000 -- (-601.921) [-604.513] (-601.530) (-600.152) * [-600.899] (-603.663) (-601.356) (-605.113) -- 0:01:10
      54500 -- (-603.709) (-606.452) (-605.785) [-601.624] * (-602.085) [-600.839] (-603.552) (-611.100) -- 0:01:09
      55000 -- [-603.357] (-602.183) (-603.341) (-600.728) * [-601.516] (-602.629) (-603.443) (-611.705) -- 0:01:08

      Average standard deviation of split frequencies: 0.039564

      55500 -- (-600.391) (-602.745) [-600.495] (-601.693) * (-601.540) (-601.177) (-606.736) [-602.557] -- 0:01:08
      56000 -- [-601.635] (-602.099) (-600.504) (-600.506) * [-600.881] (-602.688) (-604.435) (-604.651) -- 0:01:07
      56500 -- (-605.751) (-601.560) [-601.117] (-600.488) * (-601.829) (-605.407) [-602.282] (-601.101) -- 0:01:06
      57000 -- [-604.812] (-603.582) (-601.007) (-601.139) * (-603.724) (-605.241) (-601.628) [-601.938] -- 0:01:06
      57500 -- (-604.234) [-605.874] (-602.188) (-600.822) * (-605.133) [-603.432] (-600.552) (-602.796) -- 0:01:05
      58000 -- (-603.023) [-603.256] (-603.164) (-602.395) * [-601.551] (-602.948) (-602.705) (-604.396) -- 0:01:04
      58500 -- (-602.739) [-602.954] (-600.769) (-601.585) * (-601.986) (-600.301) (-600.157) [-600.132] -- 0:01:04
      59000 -- (-602.208) (-601.358) (-600.686) [-600.733] * (-601.496) (-603.106) (-600.876) [-603.129] -- 0:01:03
      59500 -- [-602.493] (-603.099) (-600.382) (-601.804) * (-601.983) [-605.173] (-603.813) (-604.552) -- 0:01:03
      60000 -- (-600.764) [-602.492] (-601.573) (-601.516) * (-602.740) (-600.628) [-600.374] (-604.723) -- 0:01:02

      Average standard deviation of split frequencies: 0.040018

      60500 -- [-600.551] (-606.162) (-605.797) (-601.476) * (-605.947) [-600.891] (-603.090) (-605.132) -- 0:01:02
      61000 -- (-603.131) (-601.682) [-601.899] (-602.404) * (-600.528) (-607.633) (-601.951) [-602.180] -- 0:01:01
      61500 -- [-602.243] (-603.799) (-600.185) (-605.206) * (-600.660) (-606.251) [-601.165] (-601.737) -- 0:01:01
      62000 -- (-602.592) (-602.279) (-600.700) [-606.424] * (-601.717) (-607.959) [-603.608] (-601.578) -- 0:01:00
      62500 -- (-601.505) [-601.376] (-601.966) (-609.139) * (-601.143) (-604.132) [-600.153] (-603.115) -- 0:01:00
      63000 -- (-602.208) (-603.280) (-601.428) [-603.998] * (-603.489) [-603.114] (-602.216) (-600.223) -- 0:00:59
      63500 -- (-601.278) (-603.510) [-602.308] (-603.628) * (-604.884) (-602.150) [-603.951] (-601.228) -- 0:00:58
      64000 -- (-601.269) [-603.979] (-603.431) (-600.974) * (-604.007) (-602.205) (-601.566) [-601.449] -- 0:00:58
      64500 -- [-603.533] (-608.868) (-601.178) (-602.090) * (-607.047) (-601.846) [-602.329] (-603.090) -- 0:00:58
      65000 -- (-602.234) (-600.841) (-600.718) [-604.668] * (-602.863) (-602.950) (-602.644) [-602.649] -- 0:00:57

      Average standard deviation of split frequencies: 0.033570

      65500 -- (-603.005) [-603.144] (-603.987) (-601.579) * (-603.563) (-604.036) (-601.962) [-600.864] -- 0:00:57
      66000 -- (-603.036) [-602.081] (-602.194) (-602.409) * [-602.309] (-601.564) (-603.873) (-600.995) -- 0:00:56
      66500 -- (-605.189) (-602.113) (-606.375) [-600.662] * (-602.832) (-602.173) (-603.292) [-601.645] -- 0:00:56
      67000 -- (-603.162) (-602.787) (-603.550) [-600.678] * (-602.636) (-602.477) [-603.369] (-603.671) -- 0:00:55
      67500 -- [-604.222] (-601.094) (-603.858) (-601.048) * (-600.509) (-602.571) [-606.440] (-601.177) -- 0:01:09
      68000 -- (-602.766) (-603.930) [-601.360] (-602.685) * (-601.194) [-603.712] (-603.680) (-605.387) -- 0:01:08
      68500 -- (-603.022) [-604.673] (-601.412) (-602.462) * [-602.183] (-600.560) (-604.486) (-605.261) -- 0:01:07
      69000 -- (-603.659) (-604.200) (-602.195) [-602.651] * (-601.780) [-601.045] (-601.646) (-602.140) -- 0:01:07
      69500 -- (-603.344) (-602.733) [-603.660] (-602.071) * (-603.040) (-603.409) (-602.465) [-601.539] -- 0:01:06
      70000 -- (-600.712) (-602.887) (-601.245) [-603.080] * (-602.991) [-602.706] (-603.920) (-600.471) -- 0:01:06

      Average standard deviation of split frequencies: 0.031019

      70500 -- (-601.561) (-601.142) (-600.503) [-601.703] * (-602.652) [-601.058] (-604.803) (-602.959) -- 0:01:05
      71000 -- (-602.486) (-602.247) (-601.469) [-600.733] * (-602.066) [-600.262] (-601.645) (-602.969) -- 0:01:05
      71500 -- [-600.490] (-605.036) (-601.798) (-601.926) * [-604.616] (-607.260) (-602.009) (-602.171) -- 0:01:04
      72000 -- (-601.529) (-601.278) [-602.270] (-603.214) * [-600.595] (-607.233) (-600.971) (-604.726) -- 0:01:04
      72500 -- [-601.369] (-602.744) (-604.477) (-602.374) * [-601.046] (-604.674) (-600.782) (-602.981) -- 0:01:03
      73000 -- (-600.906) (-603.659) (-601.688) [-605.952] * (-604.912) [-603.044] (-601.804) (-601.097) -- 0:01:03
      73500 -- [-600.321] (-605.507) (-603.016) (-603.886) * (-603.022) (-604.883) (-601.777) [-604.646] -- 0:01:03
      74000 -- (-602.499) (-603.070) [-601.566] (-604.200) * (-602.523) (-603.299) [-602.473] (-601.707) -- 0:01:02
      74500 -- (-602.472) (-603.569) (-603.288) [-607.536] * (-603.117) [-604.600] (-602.731) (-603.941) -- 0:01:02
      75000 -- (-601.145) [-602.766] (-603.097) (-607.297) * (-603.702) (-602.465) [-602.232] (-602.671) -- 0:01:01

      Average standard deviation of split frequencies: 0.031309

      75500 -- (-600.715) (-604.838) [-602.065] (-602.485) * (-603.583) (-603.545) [-600.435] (-605.518) -- 0:01:01
      76000 -- (-601.185) (-600.632) (-602.202) [-600.784] * [-602.524] (-601.216) (-602.391) (-601.593) -- 0:01:00
      76500 -- (-600.718) [-606.985] (-603.251) (-600.891) * (-601.496) (-601.446) [-602.788] (-600.641) -- 0:01:00
      77000 -- [-604.001] (-603.809) (-602.598) (-602.054) * (-602.136) [-602.225] (-602.269) (-603.017) -- 0:00:59
      77500 -- (-603.719) (-602.406) [-602.847] (-604.866) * (-602.628) (-603.146) [-603.725] (-607.320) -- 0:00:59
      78000 -- (-602.238) (-603.726) (-604.760) [-602.939] * (-601.239) (-606.482) [-600.961] (-603.397) -- 0:00:59
      78500 -- (-604.762) (-601.300) (-605.152) [-601.746] * (-605.861) (-605.238) (-601.797) [-601.214] -- 0:00:58
      79000 -- (-604.200) (-600.964) (-606.070) [-601.470] * (-604.210) (-608.410) [-601.909] (-600.876) -- 0:00:58
      79500 -- (-602.127) (-606.188) (-602.950) [-600.275] * (-602.644) [-600.901] (-602.821) (-601.671) -- 0:00:57
      80000 -- (-601.495) (-603.025) (-609.456) [-600.755] * [-600.757] (-601.559) (-603.658) (-601.789) -- 0:00:57

      Average standard deviation of split frequencies: 0.029751

      80500 -- (-604.268) (-602.800) (-603.864) [-602.189] * [-600.479] (-601.870) (-606.021) (-601.608) -- 0:00:57
      81000 -- [-602.814] (-606.307) (-604.835) (-605.670) * (-602.133) (-603.438) (-605.567) [-601.884] -- 0:00:56
      81500 -- (-602.817) [-601.358] (-604.528) (-600.574) * (-602.924) [-606.475] (-602.119) (-602.145) -- 0:00:56
      82000 -- (-602.377) [-604.569] (-602.910) (-601.527) * (-606.409) (-601.816) (-600.883) [-603.432] -- 0:00:55
      82500 -- [-610.767] (-605.595) (-600.799) (-601.546) * (-602.757) (-602.568) (-601.820) [-602.771] -- 0:00:55
      83000 -- (-600.309) (-605.408) (-601.723) [-601.800] * (-605.286) [-601.131] (-604.270) (-601.666) -- 0:00:55
      83500 -- [-603.851] (-604.427) (-602.638) (-601.410) * (-607.646) (-601.934) (-601.391) [-602.527] -- 0:00:54
      84000 -- (-605.091) (-601.877) [-602.374] (-602.041) * [-601.230] (-601.036) (-605.155) (-600.745) -- 0:00:54
      84500 -- (-601.917) (-602.089) [-600.299] (-604.101) * [-605.245] (-600.868) (-601.851) (-603.175) -- 0:01:05
      85000 -- (-600.552) (-600.481) (-602.108) [-603.904] * (-608.073) (-601.927) [-601.982] (-601.218) -- 0:01:04

      Average standard deviation of split frequencies: 0.028361

      85500 -- (-605.166) [-601.397] (-603.635) (-602.773) * [-603.281] (-601.650) (-603.318) (-603.024) -- 0:01:04
      86000 -- (-602.276) (-600.727) (-609.892) [-601.499] * (-602.165) (-602.420) [-601.539] (-603.729) -- 0:01:03
      86500 -- (-604.277) (-600.629) [-603.159] (-601.843) * [-603.672] (-602.528) (-602.727) (-601.537) -- 0:01:03
      87000 -- (-601.062) [-601.584] (-603.556) (-601.535) * (-602.360) [-602.806] (-602.713) (-601.450) -- 0:01:02
      87500 -- [-600.917] (-601.127) (-602.779) (-601.468) * (-600.932) (-603.338) (-602.657) [-601.332] -- 0:01:02
      88000 -- [-600.853] (-600.376) (-603.023) (-600.154) * [-602.451] (-606.367) (-602.512) (-600.722) -- 0:01:02
      88500 -- (-601.628) (-601.767) (-603.379) [-601.311] * (-603.255) (-603.984) (-601.019) [-603.455] -- 0:01:01
      89000 -- (-600.664) (-601.627) (-602.569) [-601.754] * [-602.129] (-600.172) (-602.743) (-602.135) -- 0:01:01
      89500 -- [-601.156] (-602.500) (-602.597) (-603.763) * [-601.443] (-602.030) (-603.035) (-605.266) -- 0:01:01
      90000 -- [-603.889] (-602.137) (-603.086) (-604.254) * (-601.644) (-602.245) (-604.605) [-606.205] -- 0:01:00

      Average standard deviation of split frequencies: 0.027178

      90500 -- (-603.964) (-603.515) [-601.889] (-605.405) * (-601.875) (-601.850) (-601.409) [-603.264] -- 0:01:00
      91000 -- [-604.002] (-602.157) (-601.307) (-604.473) * (-603.117) [-604.184] (-600.994) (-601.633) -- 0:00:59
      91500 -- (-600.345) (-601.041) [-601.704] (-601.847) * [-602.063] (-602.882) (-601.825) (-605.667) -- 0:00:59
      92000 -- [-601.524] (-601.093) (-605.946) (-604.212) * [-605.351] (-602.966) (-604.571) (-602.139) -- 0:00:59
      92500 -- (-602.457) (-601.323) [-600.932] (-604.040) * (-602.071) [-602.104] (-605.955) (-602.625) -- 0:00:58
      93000 -- [-602.529] (-601.647) (-601.552) (-601.080) * [-603.539] (-607.571) (-604.325) (-600.901) -- 0:00:58
      93500 -- [-602.557] (-600.935) (-603.303) (-602.427) * (-603.937) (-603.428) (-601.036) [-601.980] -- 0:00:58
      94000 -- (-600.648) (-600.384) [-603.589] (-601.659) * [-603.419] (-606.273) (-601.203) (-603.504) -- 0:00:57
      94500 -- (-602.167) [-606.408] (-601.665) (-600.464) * (-603.990) (-601.533) (-602.770) [-603.953] -- 0:00:57
      95000 -- (-602.726) [-601.189] (-603.984) (-603.428) * [-602.446] (-602.911) (-603.013) (-604.794) -- 0:00:57

      Average standard deviation of split frequencies: 0.028761

      95500 -- (-603.547) (-602.535) (-600.906) [-602.452] * (-600.321) (-600.740) [-602.488] (-602.580) -- 0:00:56
      96000 -- [-600.356] (-601.808) (-601.669) (-602.800) * (-604.169) (-603.427) (-604.106) [-604.340] -- 0:00:56
      96500 -- [-600.988] (-601.082) (-601.083) (-602.987) * (-603.072) (-601.540) (-601.245) [-603.613] -- 0:00:56
      97000 -- (-601.955) (-601.140) [-603.377] (-604.308) * (-606.293) (-601.616) (-605.698) [-604.133] -- 0:00:55
      97500 -- (-601.984) (-602.386) [-604.509] (-602.509) * (-605.530) (-604.674) (-602.534) [-601.839] -- 0:00:55
      98000 -- (-604.867) (-602.796) [-601.106] (-601.858) * (-607.005) (-603.616) [-602.301] (-604.498) -- 0:00:55
      98500 -- (-602.417) [-602.820] (-603.391) (-602.108) * [-601.280] (-600.544) (-605.112) (-600.814) -- 0:00:54
      99000 -- (-603.657) (-603.544) [-602.172] (-603.246) * (-605.918) [-602.928] (-601.101) (-606.656) -- 0:00:54
      99500 -- (-600.795) (-608.413) [-605.040] (-600.589) * (-601.499) (-600.538) [-601.899] (-604.754) -- 0:00:54
      100000 -- (-600.986) [-604.117] (-604.500) (-602.167) * (-601.728) [-602.038] (-602.088) (-603.751) -- 0:00:54

      Average standard deviation of split frequencies: 0.026224

      100500 -- (-600.260) [-601.665] (-607.001) (-601.591) * (-602.415) (-601.993) (-603.321) [-603.190] -- 0:00:53
      101000 -- [-602.922] (-602.676) (-602.148) (-602.532) * [-601.646] (-603.729) (-600.113) (-602.911) -- 0:00:53
      101500 -- (-606.143) [-601.730] (-602.164) (-601.100) * (-601.462) [-604.663] (-603.409) (-604.259) -- 0:01:01
      102000 -- (-608.408) [-603.595] (-602.557) (-606.269) * (-601.614) (-604.514) (-603.486) [-601.224] -- 0:01:01
      102500 -- (-607.440) (-604.250) [-601.269] (-606.679) * (-603.087) (-604.051) [-600.815] (-601.301) -- 0:01:01
      103000 -- (-605.804) (-603.905) [-604.093] (-604.758) * [-601.385] (-603.051) (-601.238) (-602.355) -- 0:01:00
      103500 -- (-607.987) [-601.410] (-606.740) (-605.184) * (-601.324) (-600.702) (-604.155) [-601.540] -- 0:01:00
      104000 -- (-605.485) [-601.428] (-601.472) (-602.979) * (-600.796) (-600.371) (-601.805) [-601.610] -- 0:01:00
      104500 -- (-604.871) (-600.556) [-601.997] (-603.207) * (-604.030) (-601.985) [-600.536] (-600.711) -- 0:00:59
      105000 -- (-604.572) [-602.349] (-603.308) (-601.791) * (-601.116) (-602.881) (-601.491) [-603.062] -- 0:00:59

      Average standard deviation of split frequencies: 0.025673

      105500 -- (-602.079) (-603.848) [-602.674] (-602.897) * (-601.030) (-601.677) (-604.054) [-603.480] -- 0:00:59
      106000 -- (-601.144) (-603.930) [-602.194] (-603.047) * (-601.157) (-602.368) (-602.894) [-602.876] -- 0:00:59
      106500 -- [-604.281] (-602.235) (-601.927) (-603.793) * [-606.081] (-601.525) (-602.987) (-604.815) -- 0:00:58
      107000 -- (-604.944) [-603.458] (-605.057) (-604.540) * (-600.669) [-600.982] (-602.402) (-604.743) -- 0:00:58
      107500 -- [-600.232] (-603.267) (-607.737) (-602.035) * (-603.737) [-600.869] (-602.055) (-600.421) -- 0:00:58
      108000 -- (-600.170) (-602.937) (-602.747) [-602.707] * (-603.732) [-601.139] (-602.233) (-602.489) -- 0:00:57
      108500 -- (-603.403) [-604.440] (-607.926) (-605.694) * (-603.174) [-601.022] (-601.595) (-599.904) -- 0:00:57
      109000 -- (-603.149) (-605.301) [-602.083] (-605.119) * [-602.466] (-601.229) (-605.182) (-601.509) -- 0:00:57
      109500 -- [-600.252] (-600.343) (-600.525) (-601.601) * (-601.045) [-602.444] (-606.114) (-600.526) -- 0:00:56
      110000 -- [-601.551] (-601.443) (-601.254) (-603.765) * (-601.422) (-600.710) [-602.712] (-600.960) -- 0:00:56

      Average standard deviation of split frequencies: 0.027688

      110500 -- (-603.252) (-603.020) [-601.177] (-607.434) * (-600.634) (-602.383) [-602.392] (-604.925) -- 0:00:56
      111000 -- (-604.256) [-604.865] (-602.301) (-604.464) * (-601.165) [-600.145] (-601.769) (-606.191) -- 0:00:56
      111500 -- (-604.490) [-601.751] (-602.953) (-602.957) * (-602.247) [-600.226] (-601.750) (-603.071) -- 0:00:55
      112000 -- [-601.161] (-601.483) (-601.927) (-602.398) * [-603.501] (-602.021) (-603.215) (-603.906) -- 0:00:55
      112500 -- [-603.277] (-604.380) (-602.428) (-603.198) * (-600.674) (-604.820) [-601.475] (-615.434) -- 0:00:55
      113000 -- (-603.537) (-606.581) (-602.539) [-602.323] * (-602.627) [-600.984] (-601.772) (-604.032) -- 0:00:54
      113500 -- (-601.910) (-602.846) [-600.677] (-600.789) * [-600.024] (-601.692) (-601.989) (-601.056) -- 0:00:54
      114000 -- (-601.820) (-601.865) [-601.556] (-605.491) * (-605.590) (-600.909) [-601.845] (-600.586) -- 0:00:54
      114500 -- [-600.885] (-600.842) (-601.761) (-603.109) * [-602.018] (-602.105) (-601.140) (-601.999) -- 0:00:54
      115000 -- [-602.366] (-602.305) (-603.512) (-605.819) * (-601.660) (-601.249) [-600.862] (-600.270) -- 0:00:53

      Average standard deviation of split frequencies: 0.021538

      115500 -- (-604.525) (-600.231) [-601.590] (-603.940) * (-602.913) (-602.062) [-603.005] (-600.922) -- 0:00:53
      116000 -- (-604.283) (-601.001) (-602.935) [-604.471] * (-603.289) (-603.707) [-601.437] (-601.576) -- 0:00:53
      116500 -- (-604.541) (-602.382) (-602.003) [-603.997] * (-601.323) (-602.318) [-602.152] (-608.205) -- 0:00:53
      117000 -- (-601.596) (-604.353) (-600.900) [-602.547] * (-602.024) [-600.421] (-604.376) (-602.428) -- 0:00:52
      117500 -- (-600.241) (-605.564) (-602.395) [-600.917] * (-601.484) (-602.117) [-600.370] (-601.322) -- 0:00:52
      118000 -- (-600.650) [-604.998] (-604.328) (-601.598) * (-602.483) (-601.319) [-601.167] (-602.795) -- 0:00:59
      118500 -- [-601.645] (-602.442) (-601.549) (-602.344) * (-602.370) (-602.309) [-601.806] (-601.050) -- 0:00:59
      119000 -- (-600.601) [-601.343] (-602.421) (-609.881) * (-603.932) [-604.671] (-601.161) (-601.098) -- 0:00:59
      119500 -- (-603.816) (-602.045) (-605.074) [-602.549] * (-607.487) [-600.994] (-603.109) (-604.474) -- 0:00:58
      120000 -- (-602.527) [-601.830] (-601.442) (-603.053) * (-600.948) (-602.949) (-601.767) [-602.074] -- 0:00:58

      Average standard deviation of split frequencies: 0.019328

      120500 -- (-603.023) (-602.279) (-606.174) [-604.441] * (-602.006) [-601.785] (-603.931) (-602.616) -- 0:00:58
      121000 -- (-603.773) (-602.051) [-602.187] (-603.801) * (-604.655) (-601.279) (-600.805) [-604.203] -- 0:00:58
      121500 -- (-602.975) [-602.513] (-602.854) (-603.401) * [-605.885] (-601.820) (-600.836) (-603.083) -- 0:00:57
      122000 -- (-601.185) [-601.699] (-604.522) (-603.989) * [-601.500] (-601.116) (-600.562) (-605.812) -- 0:00:57
      122500 -- (-602.185) [-602.690] (-603.702) (-603.383) * (-601.876) (-601.014) [-600.965] (-606.201) -- 0:00:57
      123000 -- (-600.574) (-602.768) [-602.037] (-605.543) * (-602.304) [-600.996] (-606.258) (-602.375) -- 0:00:57
      123500 -- (-604.191) (-603.663) (-603.720) [-601.370] * [-602.645] (-602.881) (-602.137) (-601.022) -- 0:00:56
      124000 -- (-605.349) (-601.547) [-602.214] (-602.167) * (-601.303) (-602.591) (-604.097) [-601.383] -- 0:00:56
      124500 -- (-604.724) [-601.897] (-600.905) (-605.694) * (-602.543) (-603.149) (-604.207) [-600.739] -- 0:00:56
      125000 -- (-600.919) (-605.506) (-602.910) [-603.439] * (-606.061) (-602.008) (-605.047) [-602.420] -- 0:00:56

      Average standard deviation of split frequencies: 0.016747

      125500 -- (-603.214) [-603.007] (-601.296) (-603.665) * (-604.496) (-602.092) [-601.836] (-602.044) -- 0:00:55
      126000 -- [-604.733] (-601.710) (-603.950) (-602.707) * (-601.113) (-603.866) [-602.136] (-601.029) -- 0:00:55
      126500 -- (-605.851) (-600.021) (-602.115) [-600.942] * (-601.646) [-605.255] (-604.499) (-601.114) -- 0:00:55
      127000 -- (-602.407) [-601.823] (-601.831) (-602.331) * (-600.790) (-610.138) [-602.578] (-601.501) -- 0:00:54
      127500 -- (-602.061) (-605.581) [-601.695] (-603.170) * [-602.893] (-603.274) (-600.979) (-603.913) -- 0:00:54
      128000 -- (-600.643) (-602.615) (-604.525) [-602.412] * (-602.023) (-605.192) (-605.524) [-602.988] -- 0:00:54
      128500 -- (-602.050) (-603.044) [-601.683] (-605.354) * (-601.251) (-604.355) [-601.616] (-605.110) -- 0:00:54
      129000 -- (-604.770) (-602.425) [-600.441] (-602.297) * (-601.048) (-600.823) [-603.827] (-602.282) -- 0:00:54
      129500 -- (-607.349) (-602.505) (-604.456) [-602.066] * (-602.142) (-600.748) [-601.135] (-604.104) -- 0:00:53
      130000 -- (-604.248) (-607.369) [-605.162] (-603.106) * (-602.545) (-600.426) [-603.925] (-602.554) -- 0:00:53

      Average standard deviation of split frequencies: 0.013709

      130500 -- (-603.615) (-605.746) (-601.143) [-603.354] * (-601.211) (-607.548) [-601.500] (-602.386) -- 0:00:53
      131000 -- (-602.311) (-600.808) (-600.357) [-605.389] * (-601.934) (-604.323) (-604.392) [-602.622] -- 0:00:53
      131500 -- [-601.713] (-600.722) (-602.279) (-601.971) * [-602.039] (-606.447) (-601.598) (-603.638) -- 0:00:52
      132000 -- (-603.509) (-601.831) [-600.464] (-601.215) * [-602.151] (-603.503) (-600.915) (-602.828) -- 0:00:52
      132500 -- (-604.165) (-605.557) (-605.366) [-601.513] * [-602.214] (-602.515) (-600.836) (-603.414) -- 0:00:52
      133000 -- [-601.984] (-604.486) (-601.557) (-601.201) * (-602.377) [-603.241] (-601.424) (-601.454) -- 0:00:52
      133500 -- (-602.560) [-601.490] (-602.324) (-600.635) * (-601.996) (-601.025) (-603.100) [-603.393] -- 0:00:51
      134000 -- (-610.508) (-600.504) (-606.268) [-600.345] * (-600.605) (-603.037) (-603.559) [-603.178] -- 0:00:51
      134500 -- [-604.163] (-601.018) (-604.209) (-600.219) * (-607.175) (-601.674) [-601.003] (-606.443) -- 0:00:51
      135000 -- (-603.920) (-604.176) [-600.878] (-600.602) * (-601.849) [-602.097] (-601.151) (-602.488) -- 0:00:57

      Average standard deviation of split frequencies: 0.014690

      135500 -- (-606.448) (-603.344) (-600.327) [-603.141] * (-602.716) [-600.974] (-600.100) (-601.201) -- 0:00:57
      136000 -- (-601.824) [-601.556] (-601.059) (-604.194) * [-604.954] (-601.598) (-600.427) (-600.002) -- 0:00:57
      136500 -- [-603.305] (-604.846) (-603.395) (-605.346) * (-604.548) (-600.262) (-601.247) [-602.912] -- 0:00:56
      137000 -- (-602.742) [-600.773] (-602.223) (-605.662) * [-600.715] (-601.213) (-603.730) (-603.016) -- 0:00:56
      137500 -- (-602.355) (-601.346) (-602.868) [-601.452] * (-600.815) [-600.385] (-605.104) (-604.074) -- 0:00:56
      138000 -- [-603.743] (-604.996) (-601.104) (-603.391) * (-601.099) (-602.260) [-602.320] (-606.966) -- 0:00:56
      138500 -- (-603.176) (-602.462) [-602.804] (-604.284) * (-601.153) (-601.925) (-601.960) [-603.523] -- 0:00:55
      139000 -- [-600.380] (-601.874) (-599.938) (-604.530) * (-601.190) (-601.013) [-601.300] (-601.636) -- 0:00:55
      139500 -- (-602.568) (-602.560) [-600.752] (-606.234) * [-602.119] (-601.704) (-600.607) (-601.308) -- 0:00:55
      140000 -- (-602.163) [-600.573] (-604.367) (-601.630) * (-600.971) [-603.996] (-601.187) (-607.804) -- 0:00:55

      Average standard deviation of split frequencies: 0.015267

      140500 -- (-602.693) [-601.259] (-602.065) (-602.373) * [-602.574] (-610.447) (-601.362) (-604.163) -- 0:00:55
      141000 -- (-602.181) [-600.893] (-602.896) (-602.414) * (-602.730) (-609.554) [-600.687] (-601.174) -- 0:00:54
      141500 -- (-601.638) [-602.092] (-600.384) (-602.815) * [-602.830] (-603.722) (-600.652) (-601.111) -- 0:00:54
      142000 -- (-602.381) (-601.541) (-602.817) [-600.726] * (-603.340) (-605.151) [-600.632] (-601.771) -- 0:00:54
      142500 -- (-601.316) (-601.099) (-603.991) [-601.540] * [-602.117] (-600.559) (-600.718) (-602.950) -- 0:00:54
      143000 -- (-601.418) (-602.134) [-604.346] (-603.855) * [-601.105] (-602.332) (-601.885) (-603.184) -- 0:00:53
      143500 -- (-601.184) [-600.194] (-603.147) (-602.852) * (-602.792) (-601.060) [-603.236] (-602.863) -- 0:00:53
      144000 -- (-601.709) (-604.621) [-603.297] (-600.807) * (-602.423) (-602.349) [-602.616] (-601.298) -- 0:00:53
      144500 -- (-602.687) [-601.879] (-602.833) (-600.853) * (-602.581) [-602.225] (-602.718) (-603.076) -- 0:00:53
      145000 -- (-602.281) (-604.566) [-600.227] (-600.138) * [-603.952] (-601.980) (-606.876) (-602.419) -- 0:00:53

      Average standard deviation of split frequencies: 0.013991

      145500 -- (-600.104) [-602.753] (-600.848) (-604.298) * (-603.448) (-603.254) [-600.440] (-600.290) -- 0:00:52
      146000 -- (-603.595) (-603.475) [-606.182] (-604.136) * [-603.274] (-608.801) (-603.415) (-602.721) -- 0:00:52
      146500 -- (-603.088) [-603.154] (-603.903) (-605.675) * [-601.132] (-602.411) (-601.517) (-600.866) -- 0:00:52
      147000 -- [-606.178] (-603.388) (-603.515) (-600.130) * (-600.337) (-606.030) (-601.238) [-601.754] -- 0:00:52
      147500 -- (-602.236) [-601.155] (-601.469) (-601.928) * [-603.136] (-601.169) (-600.950) (-602.311) -- 0:00:52
      148000 -- (-601.143) (-606.633) [-601.745] (-605.739) * [-602.956] (-605.669) (-602.809) (-606.609) -- 0:00:51
      148500 -- [-602.338] (-603.563) (-607.716) (-603.071) * (-601.359) (-602.423) (-602.149) [-601.506] -- 0:00:51
      149000 -- (-601.167) [-602.489] (-601.052) (-601.562) * (-602.572) [-600.915] (-601.528) (-603.808) -- 0:00:51
      149500 -- (-601.125) (-604.276) [-600.433] (-603.589) * (-602.612) [-600.851] (-602.109) (-603.823) -- 0:00:51
      150000 -- (-602.531) [-601.483] (-607.004) (-601.446) * (-602.341) (-606.305) [-601.248] (-601.984) -- 0:00:51

      Average standard deviation of split frequencies: 0.014656

      150500 -- (-604.181) [-602.495] (-604.386) (-603.381) * (-602.898) (-600.843) (-600.533) [-602.242] -- 0:00:50
      151000 -- [-604.941] (-601.033) (-603.510) (-603.270) * [-600.866] (-602.663) (-604.201) (-601.777) -- 0:00:50
      151500 -- (-603.012) [-605.689] (-601.598) (-603.089) * (-602.395) (-601.661) [-602.200] (-602.061) -- 0:00:56
      152000 -- (-602.169) (-609.542) (-602.591) [-600.825] * [-602.846] (-603.224) (-604.166) (-606.449) -- 0:00:55
      152500 -- (-601.836) [-602.313] (-602.809) (-602.442) * [-601.942] (-609.486) (-605.838) (-603.802) -- 0:00:55
      153000 -- (-600.690) [-601.688] (-604.792) (-600.718) * (-603.837) (-609.087) (-602.175) [-601.377] -- 0:00:55
      153500 -- (-600.899) [-601.297] (-603.950) (-603.278) * (-602.778) (-600.802) (-602.709) [-601.903] -- 0:00:55
      154000 -- (-602.669) (-603.026) [-602.050] (-605.640) * [-602.521] (-600.826) (-604.316) (-600.910) -- 0:00:54
      154500 -- (-603.392) (-603.395) (-605.978) [-609.136] * (-603.831) (-601.547) (-600.999) [-600.035] -- 0:00:54
      155000 -- (-606.133) [-604.359] (-600.761) (-603.276) * (-601.931) (-601.829) (-602.854) [-601.136] -- 0:00:54

      Average standard deviation of split frequencies: 0.013837

      155500 -- (-601.800) (-602.455) [-602.821] (-602.362) * (-603.117) (-601.350) (-600.224) [-602.436] -- 0:00:54
      156000 -- [-601.024] (-601.212) (-604.174) (-604.276) * (-603.288) [-600.727] (-603.416) (-600.255) -- 0:00:54
      156500 -- (-601.147) (-602.071) [-601.092] (-601.326) * (-604.622) (-604.314) (-600.855) [-601.710] -- 0:00:53
      157000 -- (-603.002) [-602.053] (-600.020) (-603.796) * [-603.431] (-605.422) (-600.714) (-602.760) -- 0:00:53
      157500 -- (-603.810) (-602.153) (-600.569) [-602.601] * [-602.850] (-600.494) (-602.497) (-605.545) -- 0:00:53
      158000 -- (-601.441) [-600.604] (-601.939) (-600.803) * [-601.062] (-603.514) (-600.385) (-607.627) -- 0:00:53
      158500 -- (-601.979) (-608.872) [-601.085] (-601.425) * [-601.122] (-602.676) (-605.663) (-608.509) -- 0:00:53
      159000 -- (-603.295) (-608.745) (-601.250) [-603.779] * (-600.841) (-603.378) (-603.819) [-604.740] -- 0:00:52
      159500 -- (-600.860) (-601.641) [-601.952] (-602.990) * (-600.338) [-605.288] (-603.344) (-603.186) -- 0:00:52
      160000 -- (-601.834) [-601.048] (-601.652) (-601.958) * (-600.932) (-601.625) (-602.116) [-600.471] -- 0:00:52

      Average standard deviation of split frequencies: 0.014018

      160500 -- [-601.490] (-601.920) (-603.856) (-601.723) * (-603.865) [-604.322] (-607.300) (-601.305) -- 0:00:52
      161000 -- (-601.496) (-602.105) (-602.054) [-607.594] * (-602.728) (-604.928) [-602.774] (-603.043) -- 0:00:52
      161500 -- (-601.431) (-603.578) [-602.530] (-601.985) * (-602.211) (-609.935) (-604.785) [-601.531] -- 0:00:51
      162000 -- (-601.431) (-602.983) [-600.362] (-601.546) * (-601.890) (-603.816) (-602.270) [-600.943] -- 0:00:51
      162500 -- (-601.695) [-600.897] (-600.738) (-602.048) * (-602.780) (-604.537) (-600.474) [-604.063] -- 0:00:51
      163000 -- (-601.728) (-602.216) (-601.904) [-600.864] * (-601.716) (-600.317) (-600.876) [-606.585] -- 0:00:51
      163500 -- (-610.511) [-601.165] (-601.590) (-600.807) * (-601.506) (-601.333) [-600.559] (-606.255) -- 0:00:51
      164000 -- (-602.913) [-601.171] (-601.273) (-602.285) * (-602.196) (-600.874) [-605.044] (-603.662) -- 0:00:50
      164500 -- [-603.708] (-602.427) (-603.877) (-603.234) * (-602.491) (-610.909) (-602.047) [-604.548] -- 0:00:50
      165000 -- (-603.594) [-603.061] (-601.103) (-606.340) * (-603.245) [-600.667] (-600.115) (-604.959) -- 0:00:50

      Average standard deviation of split frequencies: 0.013252

      165500 -- (-600.816) (-603.029) (-603.929) [-601.412] * (-604.157) (-600.682) [-600.627] (-606.066) -- 0:00:50
      166000 -- (-600.717) (-602.096) [-601.188] (-600.302) * (-603.479) (-604.587) [-605.593] (-605.029) -- 0:00:50
      166500 -- (-603.238) (-601.892) [-600.630] (-600.698) * (-602.481) (-601.992) [-605.390] (-600.238) -- 0:00:50
      167000 -- (-604.903) [-602.681] (-604.805) (-600.308) * (-601.454) (-603.039) (-601.422) [-600.276] -- 0:00:49
      167500 -- (-604.824) (-602.381) (-602.198) [-600.573] * (-600.943) [-601.377] (-602.299) (-600.330) -- 0:00:49
      168000 -- [-601.782] (-603.025) (-601.958) (-601.099) * (-602.645) (-601.860) (-602.118) [-600.001] -- 0:00:49
      168500 -- (-602.506) (-600.640) [-602.882] (-601.879) * (-606.555) [-602.813] (-604.226) (-600.482) -- 0:00:54
      169000 -- (-604.480) [-600.979] (-602.706) (-609.050) * (-603.335) (-602.235) [-602.294] (-602.121) -- 0:00:54
      169500 -- (-602.638) [-604.722] (-600.647) (-610.126) * (-600.144) [-601.317] (-602.799) (-606.912) -- 0:00:53
      170000 -- (-600.394) [-601.040] (-600.382) (-604.579) * (-600.559) [-601.615] (-603.673) (-603.430) -- 0:00:53

      Average standard deviation of split frequencies: 0.013942

      170500 -- (-600.663) [-600.818] (-602.391) (-605.346) * (-601.499) (-603.185) (-602.512) [-603.552] -- 0:00:53
      171000 -- (-602.623) (-600.753) [-601.177] (-603.482) * (-601.137) (-601.947) [-603.424] (-601.866) -- 0:00:53
      171500 -- (-602.623) [-603.714] (-600.376) (-604.421) * (-605.039) (-602.872) [-601.529] (-602.535) -- 0:00:53
      172000 -- (-606.845) (-603.328) [-601.023] (-601.420) * [-603.389] (-602.273) (-604.488) (-604.270) -- 0:00:52
      172500 -- (-601.766) (-600.802) (-605.387) [-601.019] * [-606.452] (-603.647) (-604.075) (-604.411) -- 0:00:52
      173000 -- [-601.885] (-600.023) (-600.443) (-600.980) * [-601.927] (-602.976) (-601.663) (-600.225) -- 0:00:52
      173500 -- (-604.732) [-601.828] (-601.161) (-604.635) * [-600.203] (-601.556) (-601.727) (-601.719) -- 0:00:52
      174000 -- [-603.002] (-603.546) (-603.958) (-603.614) * (-601.693) [-600.882] (-605.742) (-601.146) -- 0:00:52
      174500 -- (-601.273) [-603.359] (-600.640) (-604.124) * (-601.432) (-600.707) (-601.052) [-601.664] -- 0:00:52
      175000 -- (-603.005) (-601.651) (-606.669) [-604.911] * [-600.379] (-601.244) (-607.486) (-602.417) -- 0:00:51

      Average standard deviation of split frequencies: 0.012546

      175500 -- (-601.461) (-606.601) [-604.317] (-608.103) * [-600.893] (-606.690) (-603.275) (-602.277) -- 0:00:51
      176000 -- (-601.146) (-604.324) [-602.627] (-610.187) * [-600.300] (-603.533) (-603.247) (-601.813) -- 0:00:51
      176500 -- (-602.143) (-602.318) [-605.703] (-600.517) * (-600.728) (-602.853) [-601.834] (-600.972) -- 0:00:51
      177000 -- (-601.501) (-602.052) [-602.247] (-600.664) * (-602.584) (-603.559) [-601.539] (-604.282) -- 0:00:51
      177500 -- (-603.236) (-603.010) [-602.219] (-604.102) * (-603.255) [-604.584] (-601.065) (-602.845) -- 0:00:50
      178000 -- (-604.198) (-604.724) [-603.420] (-601.550) * (-602.147) (-601.759) [-600.608] (-604.401) -- 0:00:50
      178500 -- [-601.457] (-604.340) (-604.691) (-600.783) * (-604.342) [-600.715] (-601.821) (-601.732) -- 0:00:50
      179000 -- (-602.611) (-602.565) (-603.608) [-604.645] * (-604.017) [-604.331] (-604.410) (-603.895) -- 0:00:50
      179500 -- (-608.269) [-601.708] (-602.389) (-602.767) * (-601.977) (-603.229) (-602.303) [-602.369] -- 0:00:50
      180000 -- (-607.722) (-605.977) (-600.996) [-601.008] * (-600.553) (-601.721) (-601.666) [-601.187] -- 0:00:50

      Average standard deviation of split frequencies: 0.011742

      180500 -- (-606.343) (-604.246) (-602.323) [-601.608] * [-601.377] (-600.837) (-600.682) (-603.597) -- 0:00:49
      181000 -- (-606.185) (-607.396) (-608.718) [-601.002] * [-601.396] (-603.823) (-601.120) (-604.243) -- 0:00:49
      181500 -- (-605.489) (-604.419) [-603.414] (-600.894) * (-601.180) (-601.816) [-604.044] (-607.031) -- 0:00:49
      182000 -- [-603.082] (-606.419) (-603.213) (-602.804) * (-602.235) (-600.235) [-600.807] (-603.952) -- 0:00:49
      182500 -- (-600.732) (-607.287) (-605.076) [-605.208] * (-602.759) (-602.169) (-602.714) [-603.808] -- 0:00:49
      183000 -- (-602.425) [-609.841] (-604.460) (-603.430) * (-601.216) (-601.651) [-601.402] (-602.319) -- 0:00:49
      183500 -- (-602.016) [-601.149] (-602.920) (-605.530) * (-602.954) (-601.787) (-613.158) [-602.798] -- 0:00:48
      184000 -- (-601.188) (-601.891) (-603.010) [-607.162] * (-600.546) (-604.329) (-606.399) [-601.308] -- 0:00:48
      184500 -- [-601.697] (-605.618) (-603.663) (-609.607) * (-600.931) (-601.615) (-604.697) [-604.178] -- 0:00:48
      185000 -- (-602.369) (-604.494) [-605.500] (-601.858) * [-605.009] (-602.104) (-606.728) (-606.516) -- 0:00:48

      Average standard deviation of split frequencies: 0.011948

      185500 -- (-601.223) [-601.908] (-601.336) (-600.867) * (-602.858) (-601.026) (-601.218) [-603.426] -- 0:00:52
      186000 -- (-605.247) [-601.146] (-603.932) (-605.897) * (-601.044) [-602.912] (-603.026) (-601.296) -- 0:00:52
      186500 -- (-602.415) (-601.238) [-600.885] (-605.343) * (-600.014) (-602.958) [-601.732] (-601.795) -- 0:00:52
      187000 -- (-600.623) [-601.488] (-603.795) (-600.701) * [-604.229] (-601.117) (-600.760) (-601.732) -- 0:00:52
      187500 -- (-602.696) [-600.431] (-604.256) (-603.164) * (-606.221) (-600.504) [-601.136] (-608.200) -- 0:00:52
      188000 -- (-604.213) (-601.498) [-601.179] (-604.058) * (-602.247) [-602.336] (-602.058) (-602.473) -- 0:00:51
      188500 -- (-601.691) (-601.505) (-600.504) [-601.748] * (-603.303) (-602.184) (-603.088) [-603.333] -- 0:00:51
      189000 -- (-603.152) (-600.670) [-601.102] (-604.784) * [-601.342] (-602.470) (-602.654) (-603.144) -- 0:00:51
      189500 -- (-606.078) (-603.716) (-604.475) [-601.179] * (-602.182) (-602.390) [-600.814] (-601.373) -- 0:00:51
      190000 -- [-600.628] (-601.763) (-603.414) (-603.813) * (-600.434) (-602.078) [-601.803] (-605.535) -- 0:00:51

      Average standard deviation of split frequencies: 0.012009

      190500 -- (-600.994) (-603.234) (-606.033) [-604.541] * [-601.321] (-602.656) (-609.098) (-601.606) -- 0:00:50
      191000 -- (-602.918) (-606.783) (-604.632) [-604.845] * (-603.244) (-603.993) [-602.792] (-601.923) -- 0:00:50
      191500 -- (-604.892) (-602.907) [-602.207] (-602.554) * (-601.474) (-609.337) [-603.890] (-601.545) -- 0:00:50
      192000 -- (-601.571) [-602.002] (-602.633) (-600.432) * (-606.114) (-604.385) [-603.658] (-607.050) -- 0:00:50
      192500 -- (-605.405) (-602.280) (-601.505) [-601.398] * (-603.963) (-603.137) [-600.621] (-602.370) -- 0:00:50
      193000 -- (-607.062) (-601.270) [-602.268] (-603.598) * (-601.427) (-606.475) [-600.933] (-603.442) -- 0:00:50
      193500 -- (-601.087) [-604.411] (-603.387) (-604.410) * (-601.995) (-602.653) [-601.140] (-602.103) -- 0:00:50
      194000 -- (-603.344) (-603.821) [-603.054] (-601.725) * (-604.055) [-601.956] (-602.161) (-600.771) -- 0:00:49
      194500 -- (-603.030) (-608.690) [-602.050] (-601.548) * (-601.960) (-602.831) [-602.394] (-600.743) -- 0:00:49
      195000 -- (-602.340) (-605.571) (-601.793) [-600.967] * (-601.594) (-603.386) [-601.210] (-604.066) -- 0:00:49

      Average standard deviation of split frequencies: 0.013291

      195500 -- (-601.422) (-602.185) (-601.057) [-601.266] * (-601.103) (-601.551) [-602.430] (-602.977) -- 0:00:49
      196000 -- [-601.588] (-600.962) (-602.307) (-601.472) * (-600.780) (-601.777) [-602.648] (-605.082) -- 0:00:49
      196500 -- (-602.779) (-607.513) (-600.459) [-603.370] * (-601.389) (-601.543) [-604.047] (-600.455) -- 0:00:49
      197000 -- (-601.299) (-601.878) (-600.686) [-603.565] * (-600.781) (-601.731) (-603.923) [-600.734] -- 0:00:48
      197500 -- (-601.559) [-602.856] (-600.376) (-601.724) * (-606.923) (-602.378) [-601.578] (-601.763) -- 0:00:48
      198000 -- (-601.008) (-603.360) (-601.511) [-602.684] * [-602.700] (-605.724) (-600.536) (-603.043) -- 0:00:48
      198500 -- (-602.081) [-601.061] (-600.563) (-607.264) * (-604.857) (-602.100) (-605.141) [-603.347] -- 0:00:48
      199000 -- [-602.263] (-601.255) (-603.493) (-602.765) * [-601.937] (-602.931) (-603.159) (-600.221) -- 0:00:48
      199500 -- (-601.115) (-601.440) [-601.452] (-603.910) * (-602.680) (-602.039) [-605.759] (-603.461) -- 0:00:48
      200000 -- (-603.020) (-600.775) [-602.033] (-602.716) * (-600.137) [-601.085] (-606.673) (-603.410) -- 0:00:48

      Average standard deviation of split frequencies: 0.013978

      200500 -- [-601.460] (-600.412) (-601.271) (-600.990) * [-601.201] (-603.285) (-605.938) (-601.142) -- 0:00:47
      201000 -- (-599.985) (-601.643) [-601.533] (-607.950) * (-602.266) (-609.043) [-603.909] (-600.964) -- 0:00:47
      201500 -- (-601.928) [-602.533] (-600.587) (-606.896) * (-603.099) (-602.498) (-601.645) [-603.412] -- 0:00:47
      202000 -- [-602.188] (-603.211) (-603.077) (-601.170) * (-604.401) (-601.622) (-601.405) [-602.840] -- 0:00:51
      202500 -- [-602.002] (-600.509) (-602.460) (-602.352) * [-603.067] (-603.540) (-604.106) (-602.735) -- 0:00:51
      203000 -- (-604.811) (-601.310) (-604.102) [-601.957] * [-601.306] (-600.843) (-601.599) (-603.876) -- 0:00:51
      203500 -- (-601.119) [-603.502] (-604.765) (-601.656) * (-604.181) (-601.165) [-602.032] (-601.876) -- 0:00:50
      204000 -- [-601.637] (-601.689) (-604.776) (-605.202) * (-601.007) [-601.738] (-602.637) (-606.346) -- 0:00:50
      204500 -- (-603.118) [-604.330] (-601.923) (-601.256) * (-601.334) (-601.435) (-602.156) [-603.662] -- 0:00:50
      205000 -- [-604.515] (-602.565) (-606.304) (-601.876) * (-605.866) [-601.472] (-602.642) (-601.646) -- 0:00:50

      Average standard deviation of split frequencies: 0.014760

      205500 -- (-603.084) [-604.261] (-603.091) (-600.424) * (-604.528) (-601.384) (-604.471) [-603.409] -- 0:00:50
      206000 -- (-601.702) (-603.852) [-602.980] (-603.321) * (-608.872) [-600.042] (-604.866) (-602.483) -- 0:00:50
      206500 -- (-604.792) (-602.293) (-603.176) [-601.834] * (-608.623) [-601.806] (-602.083) (-605.515) -- 0:00:49
      207000 -- [-600.434] (-603.327) (-605.772) (-601.728) * (-603.527) (-603.417) [-600.320] (-603.029) -- 0:00:49
      207500 -- (-600.997) (-603.111) [-601.893] (-601.736) * [-601.482] (-601.945) (-604.223) (-600.735) -- 0:00:49
      208000 -- (-601.246) [-602.415] (-602.426) (-601.596) * [-608.767] (-600.452) (-605.923) (-603.069) -- 0:00:49
      208500 -- (-607.976) (-601.058) (-601.471) [-601.570] * (-600.818) (-601.203) (-603.966) [-602.643] -- 0:00:49
      209000 -- [-601.853] (-602.216) (-602.525) (-606.093) * (-604.794) [-601.792] (-604.590) (-603.053) -- 0:00:49
      209500 -- (-600.828) (-602.716) [-602.814] (-602.401) * [-605.371] (-603.728) (-600.519) (-603.741) -- 0:00:49
      210000 -- (-600.923) (-603.284) (-601.601) [-601.007] * [-601.954] (-601.974) (-600.375) (-606.520) -- 0:00:48

      Average standard deviation of split frequencies: 0.015075

      210500 -- (-600.901) [-600.483] (-602.170) (-602.206) * (-602.591) (-601.467) (-602.291) [-603.932] -- 0:00:48
      211000 -- (-602.499) (-600.794) [-602.857] (-605.642) * [-602.276] (-602.194) (-600.076) (-606.562) -- 0:00:48
      211500 -- (-602.869) [-600.812] (-602.409) (-602.651) * (-602.916) (-600.921) [-601.598] (-602.299) -- 0:00:48
      212000 -- (-602.296) [-603.232] (-602.664) (-602.331) * (-601.692) [-606.225] (-603.594) (-601.899) -- 0:00:48
      212500 -- (-600.992) (-601.579) [-603.857] (-604.429) * (-603.371) (-601.833) (-602.013) [-600.235] -- 0:00:48
      213000 -- (-604.791) [-601.915] (-602.358) (-602.183) * (-602.997) [-602.978] (-601.611) (-606.643) -- 0:00:48
      213500 -- [-601.202] (-603.464) (-601.804) (-603.445) * (-606.480) (-603.283) [-607.289] (-600.927) -- 0:00:47
      214000 -- (-601.694) (-606.461) [-604.826] (-606.976) * (-602.700) [-601.705] (-602.439) (-601.104) -- 0:00:47
      214500 -- (-606.829) (-601.512) [-600.994] (-604.976) * (-602.920) [-602.474] (-602.072) (-600.306) -- 0:00:47
      215000 -- [-602.611] (-600.262) (-601.586) (-603.414) * (-602.723) (-602.556) [-602.291] (-602.281) -- 0:00:47

      Average standard deviation of split frequencies: 0.014622

      215500 -- (-605.704) (-601.346) [-600.928] (-601.012) * (-601.081) [-606.612] (-604.662) (-601.792) -- 0:00:47
      216000 -- (-601.643) [-601.518] (-602.968) (-601.268) * (-602.788) [-601.311] (-607.869) (-603.261) -- 0:00:47
      216500 -- (-602.365) (-603.129) (-604.596) [-602.419] * (-601.812) (-603.991) [-601.605] (-603.947) -- 0:00:47
      217000 -- (-605.083) [-600.940] (-602.916) (-601.386) * (-601.069) [-604.691] (-602.400) (-609.301) -- 0:00:46
      217500 -- (-605.248) [-600.614] (-602.715) (-600.994) * (-601.306) (-601.206) [-601.851] (-602.603) -- 0:00:46
      218000 -- (-604.018) (-600.560) (-601.130) [-601.434] * (-602.535) (-603.817) [-602.644] (-602.423) -- 0:00:50
      218500 -- (-601.944) (-602.925) [-602.811] (-602.013) * (-602.862) [-601.831] (-603.431) (-603.329) -- 0:00:50
      219000 -- (-602.209) [-603.029] (-602.714) (-601.931) * (-605.330) (-601.070) [-602.091] (-600.449) -- 0:00:49
      219500 -- (-602.413) [-601.158] (-601.992) (-601.580) * (-602.557) (-602.300) [-600.652] (-600.897) -- 0:00:49
      220000 -- (-602.026) [-603.435] (-602.249) (-601.433) * (-602.451) (-603.019) [-601.799] (-601.875) -- 0:00:49

      Average standard deviation of split frequencies: 0.014633

      220500 -- [-601.317] (-602.225) (-601.289) (-602.611) * (-600.290) (-602.737) (-605.413) [-600.488] -- 0:00:49
      221000 -- (-601.406) (-609.748) (-600.728) [-600.435] * [-602.581] (-603.487) (-605.906) (-600.793) -- 0:00:49
      221500 -- (-601.410) (-603.794) [-605.410] (-601.037) * (-602.428) (-605.022) [-603.000] (-601.060) -- 0:00:49
      222000 -- (-601.039) (-602.223) (-601.962) [-600.874] * (-605.546) (-610.310) [-602.598] (-605.749) -- 0:00:49
      222500 -- [-601.215] (-601.497) (-602.873) (-601.341) * (-603.739) (-603.664) [-603.692] (-601.335) -- 0:00:48
      223000 -- [-600.573] (-604.082) (-603.769) (-605.065) * (-601.151) (-602.731) (-600.960) [-602.168] -- 0:00:48
      223500 -- (-604.732) (-601.786) [-601.720] (-608.444) * (-604.626) [-600.984] (-600.946) (-602.526) -- 0:00:48
      224000 -- [-604.578] (-600.499) (-602.839) (-607.169) * [-601.369] (-600.786) (-600.028) (-600.383) -- 0:00:48
      224500 -- (-603.231) (-603.695) [-602.484] (-602.771) * (-600.890) [-601.923] (-600.506) (-601.234) -- 0:00:48
      225000 -- (-600.286) [-605.026] (-600.356) (-602.261) * (-603.470) (-601.677) (-600.274) [-604.210] -- 0:00:48

      Average standard deviation of split frequencies: 0.013975

      225500 -- (-601.387) (-611.029) (-602.076) [-604.064] * (-601.855) (-604.185) (-605.277) [-601.586] -- 0:00:48
      226000 -- (-602.526) (-601.684) (-602.024) [-601.729] * (-602.347) (-602.635) [-607.415] (-601.470) -- 0:00:47
      226500 -- [-601.086] (-602.687) (-603.361) (-600.603) * (-607.444) [-605.384] (-603.103) (-602.193) -- 0:00:47
      227000 -- [-603.363] (-601.621) (-601.173) (-601.612) * (-603.023) [-601.755] (-607.773) (-600.586) -- 0:00:47
      227500 -- [-602.398] (-600.713) (-607.019) (-604.640) * [-601.348] (-604.621) (-604.620) (-600.452) -- 0:00:47
      228000 -- (-603.528) [-601.157] (-600.990) (-601.135) * [-600.372] (-603.157) (-601.930) (-600.628) -- 0:00:47
      228500 -- (-601.269) (-601.331) (-606.526) [-602.333] * (-602.293) [-603.139] (-602.870) (-600.013) -- 0:00:47
      229000 -- [-601.362] (-603.535) (-601.681) (-607.134) * (-602.443) (-604.741) [-604.652] (-600.294) -- 0:00:47
      229500 -- [-600.655] (-602.343) (-602.050) (-602.903) * (-603.635) (-601.410) (-601.818) [-603.346] -- 0:00:47
      230000 -- [-600.071] (-601.585) (-604.724) (-604.164) * (-604.799) (-604.197) [-601.719] (-605.085) -- 0:00:46

      Average standard deviation of split frequencies: 0.013079

      230500 -- (-601.992) (-600.699) [-601.553] (-601.406) * (-602.569) (-603.145) [-600.420] (-608.753) -- 0:00:46
      231000 -- (-600.268) [-601.220] (-603.620) (-602.848) * [-601.585] (-600.482) (-601.500) (-603.201) -- 0:00:46
      231500 -- [-600.518] (-608.157) (-602.246) (-601.229) * [-600.672] (-601.784) (-601.962) (-602.175) -- 0:00:46
      232000 -- [-602.043] (-606.841) (-600.867) (-601.997) * (-602.523) [-601.829] (-600.371) (-611.092) -- 0:00:46
      232500 -- (-601.308) [-607.009] (-600.051) (-603.095) * [-601.578] (-602.942) (-604.787) (-607.289) -- 0:00:46
      233000 -- (-601.398) (-605.721) (-601.982) [-600.779] * (-602.097) [-600.981] (-602.542) (-604.383) -- 0:00:46
      233500 -- (-601.140) (-605.156) [-601.204] (-603.136) * (-602.072) (-605.992) (-605.252) [-601.202] -- 0:00:45
      234000 -- (-600.505) (-601.831) [-602.377] (-600.861) * (-602.192) (-600.142) (-601.969) [-602.295] -- 0:00:45
      234500 -- (-605.438) (-602.497) (-604.263) [-600.327] * (-605.240) (-601.160) (-603.178) [-605.752] -- 0:00:45
      235000 -- (-605.156) (-602.043) [-601.892] (-600.457) * (-600.620) (-602.451) [-601.736] (-605.766) -- 0:00:48

      Average standard deviation of split frequencies: 0.015139

      235500 -- (-604.085) (-601.189) [-600.649] (-601.394) * (-605.630) [-602.115] (-604.075) (-604.102) -- 0:00:48
      236000 -- (-606.603) (-602.575) (-602.005) [-603.262] * (-601.930) (-602.979) (-605.004) [-601.310] -- 0:00:48
      236500 -- (-601.356) [-602.188] (-602.841) (-602.468) * (-600.037) (-600.690) [-603.800] (-602.157) -- 0:00:48
      237000 -- (-601.026) (-602.524) (-601.133) [-601.979] * (-602.247) [-600.464] (-603.272) (-601.269) -- 0:00:48
      237500 -- (-601.666) (-601.653) [-600.759] (-607.992) * (-602.803) (-600.806) [-601.970] (-601.310) -- 0:00:48
      238000 -- (-600.840) (-601.392) [-600.911] (-603.226) * (-601.807) (-602.082) (-602.219) [-601.237] -- 0:00:48
      238500 -- (-601.916) (-601.493) [-601.346] (-602.983) * (-604.473) (-602.891) (-602.698) [-601.708] -- 0:00:47
      239000 -- [-601.256] (-604.494) (-602.255) (-602.026) * (-604.122) (-602.947) [-607.609] (-605.751) -- 0:00:47
      239500 -- (-600.949) [-600.933] (-603.104) (-601.165) * (-604.011) [-602.243] (-602.558) (-603.285) -- 0:00:47
      240000 -- (-602.953) (-602.076) (-602.017) [-600.866] * (-609.645) (-600.797) (-602.765) [-600.572] -- 0:00:47

      Average standard deviation of split frequencies: 0.013417

      240500 -- [-601.568] (-603.115) (-602.665) (-601.581) * (-605.184) (-600.905) (-603.048) [-604.034] -- 0:00:47
      241000 -- [-600.735] (-600.978) (-609.919) (-600.465) * (-601.859) (-601.859) [-603.921] (-601.907) -- 0:00:47
      241500 -- [-606.197] (-603.288) (-601.377) (-603.315) * (-602.237) (-602.378) [-605.922] (-608.290) -- 0:00:47
      242000 -- (-603.505) (-604.989) [-600.992] (-601.545) * [-604.064] (-603.175) (-604.322) (-605.479) -- 0:00:46
      242500 -- [-600.387] (-601.898) (-600.788) (-602.303) * [-602.755] (-602.853) (-602.089) (-600.733) -- 0:00:46
      243000 -- [-600.895] (-601.621) (-602.478) (-603.644) * (-602.337) (-600.472) [-601.110] (-601.258) -- 0:00:46
      243500 -- (-602.738) (-600.116) [-605.959] (-602.254) * (-602.221) (-602.401) (-601.728) [-601.011] -- 0:00:46
      244000 -- (-604.825) [-600.413] (-600.639) (-604.534) * (-601.415) (-601.436) (-602.301) [-604.987] -- 0:00:46
      244500 -- (-603.248) (-601.208) [-603.247] (-601.362) * [-601.503] (-605.412) (-602.005) (-602.428) -- 0:00:46
      245000 -- (-607.708) (-602.770) [-600.627] (-602.235) * (-602.149) (-606.449) [-601.452] (-605.310) -- 0:00:46

      Average standard deviation of split frequencies: 0.012935

      245500 -- (-604.595) [-601.649] (-604.430) (-603.220) * (-603.185) [-600.610] (-604.471) (-606.338) -- 0:00:46
      246000 -- (-603.952) (-602.082) [-601.788] (-602.230) * (-602.756) (-601.195) [-601.161] (-603.217) -- 0:00:45
      246500 -- [-601.021] (-603.161) (-600.544) (-601.549) * (-604.227) (-602.572) (-601.616) [-603.528] -- 0:00:45
      247000 -- [-602.464] (-601.052) (-601.331) (-603.492) * [-600.944] (-601.943) (-601.018) (-601.101) -- 0:00:45
      247500 -- (-603.534) [-601.970] (-600.518) (-600.244) * [-600.653] (-603.577) (-601.221) (-602.548) -- 0:00:45
      248000 -- [-601.314] (-602.249) (-600.590) (-601.896) * [-600.752] (-601.535) (-603.387) (-600.933) -- 0:00:45
      248500 -- [-602.141] (-601.022) (-603.224) (-602.771) * (-600.959) [-600.057] (-602.819) (-601.466) -- 0:00:45
      249000 -- [-601.665] (-602.263) (-606.781) (-601.281) * (-602.971) (-601.491) (-602.839) [-604.193] -- 0:00:45
      249500 -- (-604.007) [-603.449] (-604.817) (-602.710) * (-602.179) (-600.741) [-601.936] (-605.440) -- 0:00:45
      250000 -- (-604.241) [-600.723] (-605.736) (-603.207) * [-601.392] (-600.653) (-602.643) (-604.038) -- 0:00:45

      Average standard deviation of split frequencies: 0.012224

      250500 -- (-601.328) (-605.275) [-601.681] (-601.721) * [-605.775] (-601.717) (-603.920) (-603.534) -- 0:00:44
      251000 -- [-601.781] (-602.252) (-604.073) (-602.368) * (-600.066) [-603.430] (-600.065) (-603.696) -- 0:00:44
      251500 -- (-600.525) [-600.511] (-600.487) (-603.540) * (-600.957) [-607.651] (-602.373) (-600.602) -- 0:00:47
      252000 -- (-604.119) (-602.320) (-602.105) [-603.376] * (-601.027) (-605.278) (-604.924) [-603.718] -- 0:00:47
      252500 -- (-601.440) [-600.973] (-603.465) (-603.219) * (-602.983) (-601.823) [-601.673] (-602.949) -- 0:00:47
      253000 -- [-601.834] (-600.408) (-600.892) (-601.098) * (-604.561) (-601.288) (-601.446) [-600.803] -- 0:00:47
      253500 -- [-600.983] (-603.217) (-600.567) (-602.383) * (-602.128) (-605.285) (-601.471) [-600.512] -- 0:00:47
      254000 -- (-602.668) (-603.514) (-602.455) [-606.433] * (-600.538) [-601.889] (-603.469) (-601.325) -- 0:00:46
      254500 -- [-603.341] (-605.233) (-602.454) (-604.324) * [-602.835] (-601.989) (-601.522) (-603.148) -- 0:00:46
      255000 -- [-601.097] (-601.225) (-604.767) (-602.380) * [-602.466] (-603.217) (-600.776) (-603.446) -- 0:00:46

      Average standard deviation of split frequencies: 0.013197

      255500 -- (-604.869) (-603.944) (-605.903) [-602.015] * [-603.311] (-601.492) (-601.984) (-601.822) -- 0:00:46
      256000 -- [-600.677] (-601.928) (-601.587) (-602.811) * (-603.117) [-601.412] (-606.865) (-603.325) -- 0:00:46
      256500 -- (-600.270) (-602.744) [-603.189] (-602.835) * (-603.766) (-602.033) (-602.488) [-601.978] -- 0:00:46
      257000 -- (-604.195) [-602.227] (-602.403) (-605.165) * (-602.557) [-602.106] (-601.340) (-600.870) -- 0:00:46
      257500 -- (-603.220) (-601.873) (-602.598) [-604.434] * (-607.271) [-602.174] (-600.540) (-602.080) -- 0:00:46
      258000 -- [-605.161] (-603.979) (-602.576) (-605.608) * [-601.277] (-603.345) (-601.201) (-602.004) -- 0:00:46
      258500 -- (-602.524) [-601.587] (-603.489) (-601.406) * (-602.727) (-600.913) [-601.999] (-601.682) -- 0:00:45
      259000 -- (-600.600) (-602.225) [-604.110] (-601.877) * (-603.897) (-603.092) (-600.849) [-600.752] -- 0:00:45
      259500 -- (-608.131) [-602.212] (-600.580) (-603.769) * [-602.704] (-601.885) (-603.311) (-601.692) -- 0:00:45
      260000 -- (-600.672) (-601.754) (-601.913) [-601.205] * (-602.553) (-603.019) [-603.096] (-602.503) -- 0:00:45

      Average standard deviation of split frequencies: 0.013463

      260500 -- (-602.272) (-602.379) (-603.234) [-605.151] * (-605.731) (-605.858) (-600.184) [-604.157] -- 0:00:45
      261000 -- (-603.541) [-602.138] (-602.813) (-601.985) * (-601.957) (-604.151) [-600.421] (-602.840) -- 0:00:45
      261500 -- [-604.593] (-604.142) (-600.889) (-604.052) * (-601.243) [-600.659] (-600.095) (-602.711) -- 0:00:45
      262000 -- (-609.912) (-602.739) (-603.827) [-603.435] * [-604.063] (-602.215) (-602.543) (-601.979) -- 0:00:45
      262500 -- [-606.335] (-602.560) (-608.438) (-603.586) * (-602.616) (-608.165) (-602.175) [-601.199] -- 0:00:44
      263000 -- (-603.022) [-602.890] (-603.403) (-603.322) * (-605.098) (-606.309) [-603.966] (-606.575) -- 0:00:44
      263500 -- [-602.456] (-603.868) (-604.850) (-602.011) * (-604.751) [-601.515] (-602.903) (-602.080) -- 0:00:44
      264000 -- (-605.009) (-605.619) (-602.843) [-603.661] * (-603.117) [-602.162] (-602.393) (-602.877) -- 0:00:44
      264500 -- (-602.293) [-606.007] (-602.391) (-605.531) * [-603.142] (-602.831) (-601.983) (-602.461) -- 0:00:44
      265000 -- [-602.109] (-604.226) (-603.534) (-603.892) * (-604.255) (-604.704) [-601.074] (-601.252) -- 0:00:44

      Average standard deviation of split frequencies: 0.013095

      265500 -- [-601.482] (-601.349) (-603.693) (-602.130) * (-605.897) (-600.999) (-608.148) [-602.534] -- 0:00:44
      266000 -- (-601.090) [-602.636] (-607.104) (-608.568) * (-602.996) [-600.057] (-602.467) (-601.350) -- 0:00:44
      266500 -- (-603.464) (-604.050) (-602.970) [-602.499] * (-602.269) (-603.508) [-601.122] (-604.356) -- 0:00:44
      267000 -- (-603.449) (-601.749) (-604.656) [-601.796] * (-602.768) (-601.419) (-603.967) [-604.390] -- 0:00:43
      267500 -- (-601.126) (-600.638) (-602.341) [-601.603] * [-601.395] (-600.905) (-601.230) (-600.997) -- 0:00:43
      268000 -- (-603.787) [-600.343] (-603.039) (-603.891) * (-605.260) (-602.537) (-604.564) [-601.091] -- 0:00:43
      268500 -- [-602.081] (-600.847) (-600.541) (-602.298) * (-600.586) (-602.120) (-602.776) [-601.265] -- 0:00:46
      269000 -- (-601.232) (-602.848) [-602.310] (-602.697) * (-607.715) (-604.326) (-600.437) [-601.103] -- 0:00:46
      269500 -- (-603.649) (-603.849) [-600.900] (-602.270) * (-603.809) (-602.395) [-600.485] (-602.311) -- 0:00:46
      270000 -- (-602.643) (-602.182) [-601.953] (-601.457) * [-600.993] (-601.861) (-600.251) (-603.815) -- 0:00:45

      Average standard deviation of split frequencies: 0.012375

      270500 -- [-601.857] (-601.008) (-602.622) (-602.603) * (-602.063) (-602.322) [-601.042] (-605.211) -- 0:00:45
      271000 -- (-601.597) [-600.960] (-600.522) (-602.677) * (-601.134) (-601.371) (-603.071) [-603.316] -- 0:00:45
      271500 -- (-602.541) (-601.567) [-601.454] (-602.487) * (-608.728) [-604.721] (-601.489) (-606.700) -- 0:00:45
      272000 -- (-607.827) (-604.639) [-601.418] (-601.436) * [-602.597] (-600.567) (-600.247) (-606.128) -- 0:00:45
      272500 -- (-604.217) (-608.762) (-605.114) [-601.169] * (-603.249) (-601.647) (-599.950) [-602.743] -- 0:00:45
      273000 -- (-601.765) [-601.512] (-600.597) (-602.049) * (-601.754) (-601.657) (-600.943) [-600.945] -- 0:00:45
      273500 -- (-601.914) [-601.724] (-601.004) (-600.796) * (-603.472) (-604.245) (-601.374) [-601.363] -- 0:00:45
      274000 -- (-602.071) (-603.227) [-601.199] (-602.035) * [-606.822] (-603.738) (-600.440) (-605.364) -- 0:00:45
      274500 -- (-600.547) [-605.681] (-605.287) (-603.997) * (-607.424) (-602.030) (-602.939) [-600.842] -- 0:00:44
      275000 -- (-600.265) (-607.676) (-603.608) [-602.155] * (-606.219) (-600.404) (-606.330) [-602.569] -- 0:00:44

      Average standard deviation of split frequencies: 0.014411

      275500 -- (-601.867) (-601.411) [-601.830] (-602.182) * (-600.733) (-600.884) [-602.569] (-601.434) -- 0:00:44
      276000 -- [-602.876] (-602.218) (-602.152) (-602.921) * (-602.343) (-600.720) (-603.899) [-602.693] -- 0:00:44
      276500 -- (-604.465) [-605.326] (-604.044) (-600.790) * (-603.621) [-601.308] (-604.920) (-602.201) -- 0:00:44
      277000 -- [-602.535] (-601.859) (-602.603) (-601.594) * [-604.218] (-606.694) (-604.782) (-602.021) -- 0:00:44
      277500 -- (-600.675) [-600.797] (-601.792) (-603.732) * (-603.012) (-602.752) [-602.584] (-603.184) -- 0:00:44
      278000 -- (-604.439) [-603.048] (-602.868) (-603.119) * (-602.213) (-602.107) [-606.353] (-602.057) -- 0:00:44
      278500 -- [-602.842] (-604.738) (-603.371) (-603.729) * (-603.598) (-602.093) [-604.096] (-605.239) -- 0:00:44
      279000 -- [-603.491] (-602.806) (-601.447) (-601.264) * [-602.635] (-603.817) (-603.479) (-603.200) -- 0:00:43
      279500 -- (-601.435) (-602.040) [-603.929] (-605.379) * (-605.155) (-600.909) (-603.065) [-602.723] -- 0:00:43
      280000 -- (-603.566) (-601.507) (-602.488) [-603.723] * (-606.522) (-603.742) [-602.531] (-600.674) -- 0:00:43

      Average standard deviation of split frequencies: 0.014591

      280500 -- (-604.830) (-601.688) [-600.458] (-601.423) * (-607.618) [-605.670] (-602.884) (-601.682) -- 0:00:43
      281000 -- (-602.021) [-603.113] (-602.388) (-603.171) * (-600.483) [-602.275] (-601.844) (-608.186) -- 0:00:43
      281500 -- [-604.804] (-601.484) (-600.874) (-602.823) * (-603.550) (-601.773) [-601.242] (-606.122) -- 0:00:43
      282000 -- (-605.404) (-601.157) [-603.330] (-600.291) * (-602.264) (-603.941) [-602.021] (-606.683) -- 0:00:43
      282500 -- (-602.437) (-601.921) [-601.664] (-602.380) * (-606.731) [-602.774] (-602.167) (-606.917) -- 0:00:43
      283000 -- (-606.424) [-602.087] (-602.340) (-604.565) * (-601.762) (-603.312) [-602.663] (-601.898) -- 0:00:43
      283500 -- (-609.000) (-602.779) [-606.220] (-601.474) * (-605.501) [-603.412] (-607.595) (-603.280) -- 0:00:42
      284000 -- (-603.108) (-601.586) (-605.025) [-603.062] * (-604.330) [-600.983] (-601.838) (-600.087) -- 0:00:42
      284500 -- (-601.559) (-601.970) (-604.152) [-600.736] * (-601.698) (-602.490) (-601.774) [-602.174] -- 0:00:42
      285000 -- [-600.302] (-601.281) (-604.989) (-601.734) * [-601.311] (-602.774) (-602.118) (-604.353) -- 0:00:45

      Average standard deviation of split frequencies: 0.014350

      285500 -- [-602.776] (-600.936) (-602.004) (-602.809) * [-600.277] (-601.692) (-602.729) (-602.182) -- 0:00:45
      286000 -- (-601.323) (-600.960) (-600.873) [-605.873] * (-601.356) [-604.659] (-601.220) (-601.553) -- 0:00:44
      286500 -- [-604.574] (-602.443) (-603.344) (-606.849) * [-601.524] (-604.733) (-602.033) (-602.410) -- 0:00:44
      287000 -- (-601.801) [-600.537] (-603.006) (-603.458) * (-601.477) (-602.112) (-602.845) [-600.782] -- 0:00:44
      287500 -- (-602.007) (-603.585) (-601.180) [-602.880] * (-600.387) (-603.212) (-601.722) [-600.071] -- 0:00:44
      288000 -- [-602.700] (-599.982) (-602.033) (-611.907) * (-601.192) (-603.994) [-600.699] (-600.247) -- 0:00:44
      288500 -- (-601.004) (-601.535) (-603.802) [-611.136] * (-602.172) (-600.903) (-601.388) [-601.984] -- 0:00:44
      289000 -- (-601.394) (-601.773) [-600.652] (-606.379) * (-602.704) (-604.723) (-601.696) [-603.528] -- 0:00:44
      289500 -- (-600.818) (-603.812) [-602.834] (-604.508) * (-602.629) (-601.029) [-601.963] (-601.689) -- 0:00:44
      290000 -- (-602.413) (-601.223) [-600.241] (-604.458) * (-603.033) (-601.071) (-601.692) [-601.327] -- 0:00:44

      Average standard deviation of split frequencies: 0.014495

      290500 -- (-600.953) (-603.369) [-601.728] (-602.226) * (-601.647) (-606.087) (-601.122) [-604.364] -- 0:00:43
      291000 -- (-600.852) (-608.945) [-606.311] (-600.361) * (-602.286) (-602.615) (-601.920) [-603.899] -- 0:00:43
      291500 -- [-600.678] (-608.847) (-602.942) (-601.280) * (-603.211) (-605.279) (-601.220) [-601.043] -- 0:00:43
      292000 -- (-601.481) [-602.439] (-600.963) (-601.105) * (-606.533) (-601.130) [-604.272] (-601.257) -- 0:00:43
      292500 -- (-601.722) [-603.167] (-604.122) (-603.928) * (-604.019) [-601.083] (-603.405) (-600.747) -- 0:00:43
      293000 -- [-601.421] (-600.906) (-605.881) (-607.010) * (-604.194) (-601.369) (-603.495) [-603.865] -- 0:00:43
      293500 -- (-600.194) (-603.578) (-604.732) [-601.631] * (-600.976) [-600.562] (-601.149) (-601.799) -- 0:00:43
      294000 -- (-602.241) (-603.618) (-600.656) [-600.948] * [-602.180] (-600.881) (-602.601) (-602.446) -- 0:00:43
      294500 -- (-603.974) (-602.046) (-600.803) [-601.105] * [-604.956] (-600.245) (-600.599) (-603.196) -- 0:00:43
      295000 -- (-602.451) (-601.142) [-600.803] (-603.286) * (-601.037) [-601.681] (-605.290) (-602.254) -- 0:00:43

      Average standard deviation of split frequencies: 0.013736

      295500 -- (-600.744) (-602.177) (-601.103) [-603.020] * [-600.487] (-602.011) (-601.942) (-602.744) -- 0:00:42
      296000 -- (-600.181) (-601.789) (-602.285) [-599.987] * (-603.768) (-601.634) [-601.727] (-604.440) -- 0:00:42
      296500 -- (-606.941) [-602.035] (-601.609) (-605.536) * (-601.036) (-601.292) [-604.864] (-601.958) -- 0:00:42
      297000 -- [-601.656] (-600.398) (-602.036) (-601.124) * (-600.514) (-600.834) [-604.113] (-600.934) -- 0:00:42
      297500 -- [-602.836] (-600.436) (-602.317) (-601.344) * (-601.612) (-601.032) (-605.772) [-602.184] -- 0:00:42
      298000 -- [-602.805] (-602.257) (-601.358) (-600.506) * [-600.829] (-601.435) (-603.379) (-601.702) -- 0:00:42
      298500 -- (-601.510) (-600.677) (-602.039) [-600.859] * (-603.152) (-604.177) (-601.915) [-602.739] -- 0:00:42
      299000 -- (-604.207) (-601.643) (-602.017) [-600.932] * (-600.900) (-601.317) [-603.455] (-602.229) -- 0:00:42
      299500 -- [-601.016] (-608.417) (-600.898) (-602.806) * [-601.096] (-600.905) (-600.161) (-604.280) -- 0:00:42
      300000 -- (-603.902) (-609.173) (-601.847) [-602.399] * (-601.549) (-601.020) (-603.470) [-600.863] -- 0:00:42

      Average standard deviation of split frequencies: 0.014756

      300500 -- [-601.734] (-603.373) (-601.321) (-601.765) * [-603.055] (-601.187) (-602.920) (-603.629) -- 0:00:41
      301000 -- [-601.280] (-603.852) (-600.584) (-602.663) * (-603.510) [-600.366] (-604.511) (-604.270) -- 0:00:41
      301500 -- (-600.972) (-602.346) [-603.246] (-601.324) * (-605.190) (-602.587) [-600.983] (-601.016) -- 0:00:41
      302000 -- (-601.548) (-600.244) [-603.164] (-600.917) * (-605.912) (-608.110) (-602.815) [-603.176] -- 0:00:43
      302500 -- (-602.028) (-603.215) [-607.630] (-600.563) * (-605.959) [-601.712] (-603.698) (-605.708) -- 0:00:43
      303000 -- (-600.568) (-600.441) [-605.013] (-601.914) * (-603.094) (-602.461) [-600.682] (-600.673) -- 0:00:43
      303500 -- [-600.937] (-603.809) (-603.150) (-600.758) * [-603.785] (-602.192) (-603.296) (-605.207) -- 0:00:43
      304000 -- (-603.916) (-608.498) [-604.858] (-602.534) * (-600.835) (-603.909) [-602.979] (-602.942) -- 0:00:43
      304500 -- (-601.429) (-605.026) (-601.724) [-603.158] * (-601.440) [-601.236] (-608.018) (-602.471) -- 0:00:43
      305000 -- (-601.462) [-606.451] (-600.829) (-604.478) * (-602.697) [-601.194] (-604.631) (-603.044) -- 0:00:43

      Average standard deviation of split frequencies: 0.015043

      305500 -- (-600.919) (-601.883) (-600.650) [-603.140] * (-602.334) (-600.552) [-603.609] (-600.717) -- 0:00:43
      306000 -- (-601.343) [-607.219] (-601.796) (-609.256) * (-601.882) (-600.722) (-602.438) [-599.945] -- 0:00:43
      306500 -- (-600.294) (-609.751) (-601.621) [-606.347] * (-602.262) [-601.962] (-605.623) (-601.515) -- 0:00:42
      307000 -- [-600.479] (-602.134) (-602.499) (-601.557) * (-600.415) [-605.170] (-604.379) (-602.995) -- 0:00:42
      307500 -- (-601.984) (-605.209) [-601.254] (-601.529) * (-602.161) [-603.230] (-603.529) (-600.598) -- 0:00:42
      308000 -- (-600.382) (-603.804) (-602.584) [-603.035] * (-601.155) (-601.090) (-601.089) [-602.160] -- 0:00:42
      308500 -- [-603.605] (-603.041) (-600.986) (-600.430) * (-601.254) (-603.471) (-601.707) [-602.919] -- 0:00:42
      309000 -- (-602.828) (-604.642) [-601.229] (-604.170) * (-601.655) (-604.157) (-606.167) [-600.704] -- 0:00:42
      309500 -- [-600.877] (-603.956) (-601.225) (-602.651) * [-601.429] (-606.225) (-603.921) (-602.483) -- 0:00:42
      310000 -- (-601.937) (-600.985) (-600.709) [-606.132] * (-602.786) [-605.722] (-603.283) (-601.196) -- 0:00:42

      Average standard deviation of split frequencies: 0.015531

      310500 -- (-601.020) [-600.618] (-602.866) (-605.737) * (-601.328) (-603.546) [-602.073] (-604.733) -- 0:00:42
      311000 -- [-602.854] (-602.526) (-600.900) (-601.952) * (-601.440) (-603.284) [-601.609] (-600.738) -- 0:00:42
      311500 -- (-601.465) [-602.215] (-601.341) (-603.797) * (-600.969) (-602.738) [-601.935] (-600.698) -- 0:00:41
      312000 -- (-601.143) (-603.481) [-601.620] (-604.503) * (-600.765) (-605.597) [-601.036] (-600.874) -- 0:00:41
      312500 -- (-600.309) (-602.963) [-605.114] (-605.029) * [-599.980] (-604.488) (-601.098) (-604.280) -- 0:00:41
      313000 -- (-602.456) (-601.125) (-601.839) [-606.376] * (-606.736) [-600.670] (-601.030) (-602.490) -- 0:00:41
      313500 -- (-603.448) (-600.719) [-603.034] (-612.698) * (-603.634) (-602.139) [-604.830] (-600.605) -- 0:00:41
      314000 -- (-603.147) [-601.725] (-601.315) (-609.971) * [-603.633] (-601.856) (-601.936) (-600.366) -- 0:00:41
      314500 -- [-603.582] (-603.910) (-600.429) (-604.978) * (-604.383) (-601.646) [-601.165] (-603.398) -- 0:00:41
      315000 -- (-600.009) [-601.181] (-605.849) (-606.356) * (-602.933) (-600.481) [-602.150] (-603.657) -- 0:00:41

      Average standard deviation of split frequencies: 0.015664

      315500 -- (-600.964) (-600.438) (-605.593) [-600.288] * [-601.688] (-606.772) (-606.473) (-601.339) -- 0:00:41
      316000 -- (-602.779) (-604.556) [-602.411] (-601.731) * (-603.449) [-602.044] (-604.606) (-602.159) -- 0:00:41
      316500 -- (-601.954) (-603.861) [-604.701] (-602.374) * (-601.316) (-604.926) (-602.971) [-600.750] -- 0:00:41
      317000 -- (-603.839) (-606.039) (-601.783) [-602.608] * [-601.112] (-603.365) (-603.002) (-602.686) -- 0:00:40
      317500 -- (-600.331) (-601.670) [-604.252] (-601.607) * (-604.542) [-605.003] (-604.116) (-604.203) -- 0:00:40
      318000 -- (-601.862) (-602.615) [-603.665] (-601.908) * [-600.772] (-605.592) (-605.182) (-602.616) -- 0:00:40
      318500 -- (-601.750) (-601.192) (-607.478) [-602.157] * (-601.300) [-600.570] (-603.354) (-603.899) -- 0:00:42
      319000 -- [-600.123] (-601.414) (-604.225) (-602.275) * (-601.087) (-601.292) [-602.364] (-602.794) -- 0:00:42
      319500 -- (-601.984) (-600.021) [-602.815] (-601.411) * (-601.222) (-603.102) [-604.243] (-604.783) -- 0:00:42
      320000 -- (-602.099) (-600.319) [-603.029] (-602.353) * (-602.746) (-606.865) (-602.276) [-601.206] -- 0:00:42

      Average standard deviation of split frequencies: 0.015711

      320500 -- [-601.876] (-601.981) (-602.124) (-604.466) * (-600.604) (-605.608) [-603.426] (-602.092) -- 0:00:42
      321000 -- (-603.792) (-604.702) [-602.448] (-602.972) * (-603.184) [-602.834] (-603.895) (-603.185) -- 0:00:42
      321500 -- (-602.664) (-602.176) (-603.801) [-603.355] * [-601.566] (-603.884) (-601.303) (-602.008) -- 0:00:42
      322000 -- (-600.823) (-601.984) [-605.214] (-602.415) * [-604.006] (-600.118) (-601.425) (-601.405) -- 0:00:42
      322500 -- (-600.224) (-601.278) (-605.107) [-602.698] * (-600.688) (-600.681) [-601.161] (-601.886) -- 0:00:42
      323000 -- [-600.695] (-606.928) (-603.078) (-605.625) * [-600.626] (-602.623) (-601.613) (-603.572) -- 0:00:41
      323500 -- (-602.787) [-602.785] (-602.177) (-604.250) * [-600.482] (-603.065) (-602.444) (-603.142) -- 0:00:41
      324000 -- (-603.191) (-601.031) (-603.321) [-601.808] * (-601.814) (-602.569) (-602.888) [-609.491] -- 0:00:41
      324500 -- (-604.446) (-601.738) [-604.152] (-608.013) * (-601.741) (-609.928) [-600.870] (-603.498) -- 0:00:41
      325000 -- (-606.067) [-600.536] (-605.830) (-608.324) * (-605.329) [-608.317] (-604.182) (-604.596) -- 0:00:41

      Average standard deviation of split frequencies: 0.015274

      325500 -- (-604.371) (-600.998) [-602.573] (-604.451) * [-605.087] (-605.450) (-601.606) (-602.456) -- 0:00:41
      326000 -- (-603.314) (-600.585) [-602.220] (-602.757) * [-605.459] (-603.131) (-603.983) (-601.716) -- 0:00:41
      326500 -- (-607.544) (-602.434) (-600.557) [-601.267] * [-602.003] (-601.308) (-605.950) (-601.985) -- 0:00:41
      327000 -- (-601.648) (-601.804) [-602.428] (-605.856) * (-604.310) (-601.807) [-600.986] (-604.365) -- 0:00:41
      327500 -- (-601.235) (-601.857) (-601.755) [-601.487] * (-602.859) (-602.908) (-602.928) [-600.885] -- 0:00:41
      328000 -- (-601.019) (-600.896) [-605.606] (-602.024) * (-601.906) [-600.784] (-600.717) (-602.054) -- 0:00:40
      328500 -- (-602.594) [-601.067] (-602.022) (-601.567) * (-605.459) (-604.055) [-601.427] (-601.296) -- 0:00:40
      329000 -- (-602.395) (-601.145) (-604.432) [-602.992] * (-603.567) (-601.092) (-601.145) [-600.926] -- 0:00:40
      329500 -- (-603.167) (-600.283) [-603.021] (-603.763) * (-601.071) (-602.402) (-601.491) [-600.793] -- 0:00:40
      330000 -- [-602.614] (-600.699) (-603.396) (-609.377) * (-604.449) [-602.423] (-605.996) (-602.494) -- 0:00:40

      Average standard deviation of split frequencies: 0.015504

      330500 -- (-601.942) [-602.509] (-604.111) (-604.958) * [-603.098] (-602.764) (-601.227) (-604.207) -- 0:00:40
      331000 -- (-604.800) [-601.756] (-602.712) (-601.596) * (-602.186) [-602.239] (-602.845) (-607.527) -- 0:00:40
      331500 -- [-602.725] (-602.607) (-608.355) (-600.234) * (-605.630) (-601.148) [-600.725] (-604.768) -- 0:00:40
      332000 -- (-601.780) [-601.479] (-606.532) (-602.156) * [-601.496] (-604.578) (-600.119) (-607.834) -- 0:00:40
      332500 -- [-602.125] (-601.809) (-603.735) (-600.171) * (-601.455) (-601.554) [-601.795] (-602.269) -- 0:00:40
      333000 -- (-604.389) (-607.359) (-602.481) [-602.049] * (-601.680) (-601.554) [-600.929] (-600.984) -- 0:00:40
      333500 -- (-601.674) [-602.286] (-601.849) (-601.485) * (-603.545) [-602.046] (-601.181) (-600.774) -- 0:00:39
      334000 -- (-601.128) (-600.726) [-601.299] (-600.618) * [-603.583] (-603.740) (-600.489) (-601.742) -- 0:00:39
      334500 -- (-604.320) (-603.091) (-600.251) [-600.847] * (-605.048) (-603.144) (-605.856) [-601.144] -- 0:00:39
      335000 -- (-601.413) (-605.636) (-601.761) [-601.663] * (-603.373) [-602.300] (-603.209) (-600.641) -- 0:00:39

      Average standard deviation of split frequencies: 0.015696

      335500 -- (-604.997) [-602.557] (-600.941) (-600.932) * (-601.834) (-603.464) (-602.126) [-602.485] -- 0:00:41
      336000 -- (-605.068) (-601.036) [-602.137] (-603.181) * (-600.480) [-600.865] (-599.989) (-600.187) -- 0:00:41
      336500 -- (-605.581) (-602.284) [-601.873] (-601.337) * [-600.270] (-600.638) (-609.152) (-600.850) -- 0:00:41
      337000 -- (-602.024) (-602.584) (-601.818) [-604.901] * (-601.527) (-600.331) (-600.730) [-601.147] -- 0:00:41
      337500 -- (-601.216) (-600.646) [-601.130] (-605.306) * (-601.283) (-601.960) [-602.040] (-602.786) -- 0:00:41
      338000 -- (-600.698) (-603.497) (-605.389) [-602.686] * (-601.371) (-600.865) [-603.208] (-603.201) -- 0:00:41
      338500 -- [-602.607] (-602.297) (-605.593) (-601.235) * [-600.535] (-600.659) (-600.899) (-602.796) -- 0:00:41
      339000 -- [-604.608] (-604.918) (-604.018) (-603.355) * [-600.633] (-602.938) (-600.116) (-603.741) -- 0:00:40
      339500 -- (-604.830) [-601.588] (-604.065) (-602.399) * (-602.777) (-606.327) [-600.644] (-603.072) -- 0:00:40
      340000 -- (-602.619) (-603.193) (-602.360) [-601.736] * (-601.227) [-602.109] (-602.401) (-602.679) -- 0:00:40

      Average standard deviation of split frequencies: 0.013924

      340500 -- (-606.363) (-601.256) [-600.826] (-604.238) * (-600.946) (-605.328) (-601.565) [-600.956] -- 0:00:40
      341000 -- [-603.531] (-603.903) (-600.940) (-607.525) * [-600.831] (-603.132) (-601.144) (-601.729) -- 0:00:40
      341500 -- (-601.491) (-603.854) [-603.467] (-605.614) * (-602.878) (-601.698) (-600.316) [-604.011] -- 0:00:40
      342000 -- [-602.991] (-602.699) (-602.084) (-603.741) * (-604.874) [-601.184] (-606.008) (-601.693) -- 0:00:40
      342500 -- (-604.649) [-602.770] (-603.405) (-602.845) * (-600.083) (-601.159) [-602.837] (-602.034) -- 0:00:40
      343000 -- [-602.480] (-603.629) (-600.388) (-607.309) * [-602.705] (-601.751) (-602.535) (-600.595) -- 0:00:40
      343500 -- [-601.126] (-602.363) (-604.783) (-602.572) * (-606.690) (-600.132) [-602.086] (-602.013) -- 0:00:40
      344000 -- (-601.110) (-604.106) (-609.769) [-600.669] * (-606.212) (-600.663) [-602.404] (-602.985) -- 0:00:40
      344500 -- (-601.045) [-606.802] (-600.708) (-603.416) * (-604.700) (-602.132) [-600.002] (-603.265) -- 0:00:39
      345000 -- [-602.992] (-602.557) (-602.020) (-600.397) * (-602.111) [-601.329] (-601.778) (-601.388) -- 0:00:39

      Average standard deviation of split frequencies: 0.014306

      345500 -- (-602.588) [-603.698] (-602.792) (-601.155) * (-602.355) (-601.691) [-602.584] (-602.381) -- 0:00:39
      346000 -- [-602.704] (-602.429) (-601.846) (-603.256) * [-602.112] (-604.179) (-601.055) (-600.858) -- 0:00:39
      346500 -- (-603.383) (-605.150) [-601.704] (-610.312) * [-602.179] (-603.143) (-601.155) (-602.792) -- 0:00:39
      347000 -- (-603.019) (-601.867) (-603.762) [-603.187] * (-602.061) [-602.788] (-602.740) (-603.911) -- 0:00:39
      347500 -- (-603.155) (-601.789) [-600.463] (-600.732) * (-602.535) [-601.821] (-610.751) (-603.615) -- 0:00:39
      348000 -- (-601.514) (-601.546) [-600.763] (-602.083) * (-603.627) [-600.875] (-603.705) (-603.233) -- 0:00:39
      348500 -- [-600.494] (-600.435) (-601.703) (-601.213) * (-603.808) [-602.895] (-600.930) (-603.847) -- 0:00:39
      349000 -- [-602.171] (-606.091) (-604.622) (-604.226) * (-613.701) [-603.214] (-601.671) (-603.494) -- 0:00:39
      349500 -- (-603.264) (-602.476) (-603.241) [-603.660] * (-606.191) [-601.602] (-601.427) (-603.774) -- 0:00:39
      350000 -- [-604.072] (-604.282) (-603.767) (-607.031) * (-602.894) (-602.750) [-602.071] (-604.089) -- 0:00:39

      Average standard deviation of split frequencies: 0.015123

      350500 -- [-603.399] (-601.387) (-601.280) (-603.393) * (-600.816) [-601.278] (-602.448) (-601.697) -- 0:00:38
      351000 -- (-602.483) [-600.708] (-602.784) (-602.053) * (-601.574) (-605.027) (-603.198) [-601.743] -- 0:00:38
      351500 -- (-604.252) (-605.208) [-601.948] (-603.676) * (-605.791) (-604.725) [-601.028] (-602.068) -- 0:00:38
      352000 -- [-604.919] (-606.212) (-601.153) (-604.573) * (-602.715) (-604.268) [-604.073] (-600.558) -- 0:00:40
      352500 -- (-603.150) (-601.128) [-601.164] (-603.672) * (-603.747) (-602.941) [-604.708] (-600.557) -- 0:00:40
      353000 -- (-605.299) [-601.356] (-602.577) (-606.245) * (-605.505) (-600.569) (-601.516) [-603.719] -- 0:00:40
      353500 -- (-600.078) (-601.026) [-602.873] (-601.604) * [-601.058] (-600.669) (-606.899) (-605.296) -- 0:00:40
      354000 -- (-600.783) (-600.819) (-603.597) [-601.280] * (-600.651) (-601.602) [-604.780] (-602.468) -- 0:00:40
      354500 -- (-601.758) [-602.512] (-601.018) (-604.412) * (-600.698) (-604.624) (-603.053) [-602.438] -- 0:00:40
      355000 -- (-600.684) (-602.282) [-600.124] (-601.115) * (-601.511) (-605.809) [-601.149] (-603.402) -- 0:00:39

      Average standard deviation of split frequencies: 0.015642

      355500 -- (-604.198) [-603.238] (-603.979) (-603.412) * (-604.519) (-600.767) (-600.923) [-603.029] -- 0:00:39
      356000 -- [-604.903] (-606.001) (-603.734) (-603.471) * (-605.626) (-601.217) (-601.074) [-601.940] -- 0:00:39
      356500 -- [-600.598] (-602.883) (-600.838) (-604.282) * [-603.028] (-601.139) (-601.487) (-603.959) -- 0:00:39
      357000 -- (-600.580) [-602.819] (-607.696) (-603.352) * (-602.400) (-600.634) (-605.958) [-601.176] -- 0:00:39
      357500 -- (-600.568) (-603.235) (-601.803) [-601.792] * (-600.770) [-606.471] (-601.557) (-603.120) -- 0:00:39
      358000 -- (-601.833) (-601.060) (-601.908) [-599.912] * (-601.287) (-601.126) [-604.319] (-600.975) -- 0:00:39
      358500 -- (-603.986) (-601.625) [-602.946] (-601.071) * (-601.007) [-603.145] (-602.193) (-603.789) -- 0:00:39
      359000 -- (-601.571) (-601.839) [-604.555] (-602.572) * (-602.834) (-604.884) [-602.267] (-603.838) -- 0:00:39
      359500 -- (-601.091) [-601.748] (-602.153) (-602.082) * (-607.994) (-603.611) [-604.079] (-600.814) -- 0:00:39
      360000 -- (-605.470) (-601.169) [-601.800] (-604.341) * (-601.534) [-605.303] (-601.730) (-604.142) -- 0:00:39

      Average standard deviation of split frequencies: 0.015358

      360500 -- (-602.786) (-600.399) (-600.222) [-603.291] * [-600.609] (-604.683) (-602.380) (-608.068) -- 0:00:39
      361000 -- (-600.102) (-603.558) [-601.228] (-603.375) * [-600.351] (-607.014) (-600.931) (-604.399) -- 0:00:38
      361500 -- (-603.870) [-601.855] (-602.224) (-602.176) * (-601.521) [-602.562] (-600.666) (-600.993) -- 0:00:38
      362000 -- (-603.456) (-601.826) [-603.160] (-602.657) * (-601.781) (-603.711) (-600.625) [-604.292] -- 0:00:38
      362500 -- (-602.122) [-601.869] (-601.228) (-601.258) * [-603.032] (-604.170) (-601.750) (-601.190) -- 0:00:38
      363000 -- (-602.637) (-602.126) (-600.712) [-602.892] * (-601.279) (-600.414) (-602.838) [-600.954] -- 0:00:38
      363500 -- [-602.491] (-607.671) (-601.253) (-602.193) * (-601.556) [-603.438] (-601.033) (-605.953) -- 0:00:38
      364000 -- (-603.586) [-601.193] (-601.635) (-601.546) * (-603.470) (-608.178) [-601.725] (-601.873) -- 0:00:38
      364500 -- [-605.938] (-601.939) (-601.880) (-604.427) * (-603.273) (-600.550) (-603.293) [-601.157] -- 0:00:38
      365000 -- [-603.060] (-602.832) (-600.933) (-603.743) * (-605.080) (-600.547) (-602.839) [-605.053] -- 0:00:38

      Average standard deviation of split frequencies: 0.016261

      365500 -- [-601.462] (-601.171) (-605.118) (-605.049) * (-602.485) (-600.978) [-601.300] (-606.235) -- 0:00:38
      366000 -- [-601.796] (-602.630) (-602.043) (-605.760) * [-602.560] (-605.902) (-601.424) (-602.179) -- 0:00:38
      366500 -- (-601.188) [-600.309] (-602.361) (-601.785) * [-601.903] (-600.394) (-602.900) (-606.197) -- 0:00:38
      367000 -- [-603.081] (-601.491) (-604.877) (-600.471) * [-603.153] (-601.185) (-603.135) (-603.295) -- 0:00:37
      367500 -- [-600.603] (-605.470) (-602.351) (-600.606) * [-602.102] (-600.533) (-602.802) (-600.909) -- 0:00:37
      368000 -- (-600.114) (-602.735) [-601.892] (-601.477) * (-604.587) (-601.900) [-601.142] (-603.120) -- 0:00:37
      368500 -- [-600.482] (-599.890) (-603.171) (-602.573) * (-606.798) (-604.272) [-600.325] (-601.610) -- 0:00:37
      369000 -- (-601.960) (-601.985) [-601.646] (-601.576) * [-601.464] (-602.217) (-600.985) (-603.990) -- 0:00:39
      369500 -- (-601.492) (-605.431) (-603.091) [-600.973] * (-604.226) (-602.430) [-603.466] (-602.445) -- 0:00:39
      370000 -- (-606.339) [-601.801] (-604.187) (-601.996) * (-602.197) [-602.151] (-601.937) (-602.255) -- 0:00:39

      Average standard deviation of split frequencies: 0.016454

      370500 -- [-605.457] (-600.498) (-601.589) (-601.477) * [-601.256] (-600.983) (-602.266) (-601.960) -- 0:00:39
      371000 -- (-605.754) (-605.892) [-603.397] (-601.584) * (-602.050) (-601.553) (-600.740) [-600.888] -- 0:00:38
      371500 -- [-603.245] (-601.472) (-603.922) (-602.631) * [-604.704] (-607.941) (-602.487) (-603.091) -- 0:00:38
      372000 -- [-600.675] (-601.145) (-606.659) (-601.934) * (-601.324) [-601.899] (-600.232) (-601.813) -- 0:00:38
      372500 -- (-603.723) (-601.216) [-602.092] (-602.591) * (-600.511) (-602.172) (-601.006) [-599.887] -- 0:00:38
      373000 -- [-606.945] (-602.239) (-602.720) (-602.263) * (-603.750) [-602.089] (-600.738) (-600.265) -- 0:00:38
      373500 -- [-604.292] (-603.138) (-603.792) (-600.465) * (-601.233) [-601.251] (-602.722) (-602.215) -- 0:00:38
      374000 -- [-604.749] (-603.951) (-600.460) (-601.832) * (-602.226) (-600.521) [-600.496] (-602.495) -- 0:00:38
      374500 -- [-601.965] (-600.478) (-605.493) (-600.944) * (-601.345) (-605.781) [-602.761] (-602.073) -- 0:00:38
      375000 -- (-602.064) [-600.720] (-602.398) (-600.748) * (-601.829) (-606.087) [-604.220] (-600.428) -- 0:00:38

      Average standard deviation of split frequencies: 0.015907

      375500 -- [-602.062] (-602.356) (-601.650) (-605.008) * [-601.530] (-602.561) (-600.971) (-603.389) -- 0:00:38
      376000 -- (-603.456) (-601.106) [-601.716] (-604.086) * (-600.163) (-604.042) (-604.436) [-600.849] -- 0:00:38
      376500 -- (-605.859) (-603.451) [-600.689] (-603.139) * (-602.752) (-600.971) [-601.575] (-603.130) -- 0:00:38
      377000 -- (-601.691) (-600.719) [-602.566] (-601.454) * [-601.417] (-600.830) (-600.018) (-605.774) -- 0:00:38
      377500 -- [-602.469] (-601.196) (-602.769) (-599.959) * (-603.299) (-602.702) (-601.486) [-602.363] -- 0:00:37
      378000 -- (-606.083) (-601.307) (-601.512) [-601.586] * (-601.909) [-604.200] (-601.696) (-600.692) -- 0:00:37
      378500 -- (-602.713) [-600.922] (-603.320) (-605.703) * [-601.190] (-604.269) (-601.080) (-600.400) -- 0:00:37
      379000 -- (-602.179) [-600.255] (-602.070) (-605.368) * (-603.082) [-601.913] (-600.776) (-602.492) -- 0:00:37
      379500 -- (-604.936) (-606.993) [-601.391] (-602.903) * [-602.417] (-601.146) (-600.888) (-601.264) -- 0:00:37
      380000 -- (-603.751) (-605.438) [-602.268] (-602.752) * (-601.751) (-603.958) [-601.780] (-602.298) -- 0:00:37

      Average standard deviation of split frequencies: 0.016486

      380500 -- [-599.924] (-604.770) (-600.565) (-603.427) * [-600.157] (-607.991) (-602.861) (-601.471) -- 0:00:37
      381000 -- [-602.341] (-602.040) (-603.304) (-600.328) * [-604.280] (-600.570) (-601.687) (-601.433) -- 0:00:37
      381500 -- (-602.393) [-601.445] (-600.407) (-600.736) * (-603.270) (-600.476) [-602.708] (-602.417) -- 0:00:37
      382000 -- [-600.545] (-604.943) (-603.360) (-600.679) * (-602.500) (-601.110) (-600.985) [-601.862] -- 0:00:37
      382500 -- (-602.391) (-602.503) (-607.239) [-602.146] * (-600.965) (-600.932) (-601.517) [-600.588] -- 0:00:37
      383000 -- (-602.467) (-601.214) (-614.460) [-600.996] * (-603.186) (-600.392) [-604.131] (-602.402) -- 0:00:37
      383500 -- (-603.739) (-601.785) [-605.961] (-608.767) * [-603.655] (-600.661) (-602.806) (-600.639) -- 0:00:36
      384000 -- (-602.857) (-606.163) [-601.480] (-606.237) * [-603.392] (-600.462) (-602.065) (-602.886) -- 0:00:36
      384500 -- (-600.629) (-604.197) [-601.445] (-602.185) * (-601.553) [-600.885] (-600.627) (-601.557) -- 0:00:36
      385000 -- (-601.116) (-601.142) (-602.021) [-600.705] * [-605.151] (-603.803) (-603.444) (-603.488) -- 0:00:36

      Average standard deviation of split frequencies: 0.015495

      385500 -- (-605.213) [-601.166] (-603.386) (-604.577) * (-601.164) [-604.119] (-604.450) (-603.377) -- 0:00:36
      386000 -- [-603.989] (-601.900) (-602.251) (-601.196) * (-603.401) [-602.847] (-602.351) (-603.340) -- 0:00:38
      386500 -- (-602.411) [-602.652] (-601.919) (-602.298) * (-604.911) (-601.841) (-602.952) [-601.534] -- 0:00:38
      387000 -- (-602.948) [-600.539] (-600.582) (-604.435) * (-602.198) (-601.400) [-604.855] (-606.457) -- 0:00:38
      387500 -- (-607.129) (-600.199) [-602.684] (-602.967) * (-603.752) (-601.894) (-603.518) [-600.536] -- 0:00:37
      388000 -- (-607.152) (-606.755) [-602.429] (-602.553) * (-602.332) (-602.993) (-601.491) [-604.531] -- 0:00:37
      388500 -- (-603.046) (-600.553) (-603.716) [-602.455] * (-600.942) (-600.553) (-601.407) [-605.015] -- 0:00:37
      389000 -- [-601.660] (-601.341) (-604.154) (-604.509) * [-603.715] (-600.141) (-602.673) (-606.334) -- 0:00:37
      389500 -- [-600.562] (-601.363) (-604.520) (-606.183) * (-602.006) (-601.895) [-601.311] (-606.173) -- 0:00:37
      390000 -- [-600.424] (-603.356) (-604.757) (-604.967) * (-602.699) (-602.199) [-602.005] (-610.817) -- 0:00:37

      Average standard deviation of split frequencies: 0.016064

      390500 -- [-600.628] (-601.022) (-609.357) (-602.609) * (-604.688) (-601.456) [-602.469] (-600.524) -- 0:00:37
      391000 -- [-600.628] (-601.321) (-604.866) (-601.852) * (-601.489) (-601.525) [-600.156] (-600.420) -- 0:00:37
      391500 -- (-602.387) (-601.775) (-604.252) [-602.173] * (-604.605) (-603.423) (-600.294) [-600.787] -- 0:00:37
      392000 -- (-605.327) [-603.072] (-601.614) (-602.616) * (-605.884) (-601.400) [-601.396] (-601.463) -- 0:00:37
      392500 -- [-603.493] (-603.039) (-601.558) (-600.641) * (-605.371) (-601.855) [-600.392] (-602.819) -- 0:00:37
      393000 -- (-601.057) (-601.540) [-602.882] (-605.572) * (-607.796) (-605.643) (-602.629) [-606.547] -- 0:00:37
      393500 -- [-601.375] (-602.468) (-602.755) (-602.344) * [-600.962] (-601.589) (-608.484) (-611.964) -- 0:00:36
      394000 -- (-603.092) [-600.075] (-600.807) (-602.448) * [-600.397] (-600.840) (-604.312) (-608.307) -- 0:00:36
      394500 -- (-602.561) (-604.617) (-600.954) [-602.126] * [-602.929] (-605.004) (-602.431) (-602.235) -- 0:00:36
      395000 -- (-601.690) (-612.496) (-601.680) [-604.779] * (-601.639) (-602.406) [-602.055] (-606.868) -- 0:00:36

      Average standard deviation of split frequencies: 0.015996

      395500 -- (-601.421) (-606.322) (-603.770) [-601.702] * (-601.000) [-602.902] (-604.596) (-600.809) -- 0:00:36
      396000 -- (-600.344) (-601.545) [-601.677] (-605.481) * (-606.409) [-601.897] (-608.034) (-604.103) -- 0:00:36
      396500 -- [-601.767] (-602.884) (-602.609) (-606.001) * (-608.028) (-612.623) [-602.091] (-607.691) -- 0:00:36
      397000 -- [-604.235] (-602.778) (-600.513) (-608.145) * (-603.607) (-601.819) [-600.756] (-602.621) -- 0:00:36
      397500 -- (-604.395) (-604.336) [-603.744] (-601.611) * (-603.862) (-602.851) (-602.684) [-602.161] -- 0:00:36
      398000 -- [-600.582] (-604.047) (-603.359) (-603.616) * (-603.110) (-601.363) [-601.481] (-601.764) -- 0:00:36
      398500 -- (-601.045) [-602.054] (-603.615) (-600.897) * (-601.864) (-599.953) (-600.876) [-602.226] -- 0:00:36
      399000 -- (-604.853) (-603.254) (-609.068) [-601.866] * (-603.245) [-600.192] (-603.912) (-602.259) -- 0:00:36
      399500 -- [-600.734] (-606.159) (-602.950) (-603.271) * (-602.312) (-602.709) (-603.267) [-604.668] -- 0:00:36
      400000 -- (-604.140) (-601.896) [-605.522] (-603.630) * (-601.878) [-602.664] (-602.881) (-602.797) -- 0:00:36

      Average standard deviation of split frequencies: 0.014780

      400500 -- (-602.992) [-602.237] (-603.700) (-600.684) * (-600.203) (-601.092) [-602.255] (-600.828) -- 0:00:35
      401000 -- (-602.081) (-600.468) [-602.307] (-601.425) * (-600.447) (-601.730) (-601.994) [-601.180] -- 0:00:35
      401500 -- (-602.821) (-606.169) (-600.772) [-603.054] * (-602.197) (-602.495) (-602.971) [-601.971] -- 0:00:35
      402000 -- [-602.771] (-604.679) (-601.959) (-603.777) * (-602.586) (-603.074) (-603.115) [-605.049] -- 0:00:35
      402500 -- (-602.716) (-601.343) [-601.356] (-601.166) * [-602.017] (-604.630) (-602.381) (-602.867) -- 0:00:37
      403000 -- (-602.812) (-600.259) [-601.680] (-601.896) * (-600.672) (-600.574) [-600.882] (-605.039) -- 0:00:37
      403500 -- [-601.214] (-600.385) (-603.580) (-605.506) * [-600.051] (-603.204) (-602.595) (-604.444) -- 0:00:36
      404000 -- (-601.204) [-600.364] (-601.851) (-606.089) * (-600.305) [-601.422] (-603.510) (-605.149) -- 0:00:36
      404500 -- [-600.721] (-601.768) (-606.893) (-602.274) * (-601.445) (-602.647) (-603.166) [-601.891] -- 0:00:36
      405000 -- (-603.616) [-602.259] (-602.248) (-601.635) * (-601.516) [-600.641] (-600.448) (-605.104) -- 0:00:36

      Average standard deviation of split frequencies: 0.013933

      405500 -- (-602.676) (-601.931) (-602.478) [-608.577] * [-603.090] (-602.224) (-600.427) (-601.873) -- 0:00:36
      406000 -- (-604.425) (-600.712) [-601.665] (-601.559) * (-605.875) [-603.144] (-604.991) (-604.139) -- 0:00:36
      406500 -- (-600.933) [-600.540] (-603.342) (-601.732) * (-603.853) [-599.973] (-603.969) (-601.032) -- 0:00:36
      407000 -- [-602.586] (-601.737) (-604.449) (-599.978) * (-604.011) (-601.577) [-603.978] (-603.490) -- 0:00:36
      407500 -- [-601.186] (-602.014) (-602.456) (-601.382) * [-602.168] (-606.494) (-607.764) (-602.017) -- 0:00:36
      408000 -- (-601.249) (-604.146) (-602.698) [-600.299] * (-604.280) (-603.734) [-605.050] (-601.404) -- 0:00:36
      408500 -- (-602.760) (-603.131) [-601.585] (-600.183) * (-602.078) (-609.196) [-602.276] (-605.077) -- 0:00:36
      409000 -- [-600.322] (-604.133) (-605.832) (-602.617) * (-607.989) (-601.737) [-603.031] (-602.488) -- 0:00:36
      409500 -- (-601.597) (-601.422) (-602.448) [-603.138] * (-600.419) (-606.186) [-601.986] (-605.880) -- 0:00:36
      410000 -- [-601.189] (-603.246) (-601.296) (-603.831) * (-600.500) (-600.718) (-603.888) [-601.786] -- 0:00:35

      Average standard deviation of split frequencies: 0.014277

      410500 -- (-601.012) (-602.660) (-600.582) [-601.926] * (-605.306) [-601.894] (-602.269) (-603.315) -- 0:00:35
      411000 -- (-603.699) (-607.205) (-602.984) [-602.204] * (-605.676) [-603.200] (-601.249) (-602.148) -- 0:00:35
      411500 -- [-604.564] (-602.023) (-601.807) (-602.776) * (-602.562) (-603.161) (-602.538) [-602.359] -- 0:00:35
      412000 -- [-602.039] (-603.646) (-603.990) (-604.812) * (-604.816) [-602.428] (-606.493) (-603.770) -- 0:00:35
      412500 -- (-601.747) [-603.075] (-611.504) (-601.875) * [-602.324] (-602.223) (-604.470) (-603.263) -- 0:00:35
      413000 -- (-605.326) (-605.150) (-605.658) [-604.724] * (-602.697) (-603.344) (-601.353) [-602.071] -- 0:00:35
      413500 -- (-604.227) [-602.267] (-605.686) (-601.535) * [-603.912] (-602.007) (-602.183) (-601.437) -- 0:00:35
      414000 -- (-603.566) (-601.691) [-600.316] (-603.645) * [-603.695] (-601.612) (-603.849) (-600.685) -- 0:00:35
      414500 -- (-603.274) [-600.620] (-601.008) (-606.359) * (-602.591) (-601.400) (-603.456) [-602.527] -- 0:00:35
      415000 -- (-603.267) (-600.152) (-605.026) [-604.263] * [-604.124] (-603.490) (-603.320) (-603.758) -- 0:00:35

      Average standard deviation of split frequencies: 0.013882

      415500 -- (-602.986) (-600.682) [-600.866] (-605.836) * [-602.271] (-603.833) (-600.676) (-604.856) -- 0:00:35
      416000 -- (-603.406) (-600.853) [-601.447] (-604.638) * (-602.104) (-600.126) [-603.257] (-606.457) -- 0:00:35
      416500 -- (-601.460) [-607.341] (-604.961) (-604.529) * (-605.740) (-600.984) (-601.894) [-602.060] -- 0:00:35
      417000 -- (-601.792) [-601.339] (-602.026) (-604.309) * [-606.260] (-602.596) (-601.964) (-603.013) -- 0:00:34
      417500 -- (-603.361) [-601.102] (-601.072) (-601.552) * (-600.558) [-604.054] (-602.312) (-609.168) -- 0:00:34
      418000 -- (-603.568) (-603.655) [-600.568] (-600.040) * (-601.014) (-600.719) (-608.920) [-603.058] -- 0:00:34
      418500 -- (-602.174) (-604.042) (-600.889) [-599.992] * (-609.956) (-601.709) (-601.406) [-601.376] -- 0:00:34
      419000 -- [-603.628] (-602.929) (-604.283) (-602.790) * (-601.075) (-608.024) (-602.926) [-602.452] -- 0:00:34
      419500 -- (-602.985) [-602.246] (-600.702) (-603.242) * (-601.587) (-605.671) (-603.374) [-601.032] -- 0:00:35
      420000 -- [-601.604] (-600.969) (-601.288) (-601.968) * (-605.178) (-602.369) (-603.592) [-601.389] -- 0:00:35

      Average standard deviation of split frequencies: 0.013167

      420500 -- [-601.161] (-601.238) (-601.666) (-603.913) * (-600.426) (-610.026) [-604.396] (-602.648) -- 0:00:35
      421000 -- [-600.667] (-603.361) (-604.901) (-603.081) * [-601.981] (-603.297) (-606.752) (-602.335) -- 0:00:35
      421500 -- [-600.795] (-601.214) (-603.873) (-602.824) * (-603.527) (-604.649) [-605.058] (-601.221) -- 0:00:35
      422000 -- [-600.688] (-600.629) (-605.176) (-602.005) * (-604.020) [-603.900] (-600.589) (-603.054) -- 0:00:35
      422500 -- (-601.382) [-600.606] (-605.612) (-602.435) * (-601.837) (-603.210) [-600.871] (-603.222) -- 0:00:35
      423000 -- [-600.616] (-602.628) (-606.555) (-601.889) * (-601.132) (-607.290) (-602.210) [-600.754] -- 0:00:35
      423500 -- (-601.413) [-602.425] (-602.183) (-601.078) * (-604.299) (-605.830) (-607.609) [-602.790] -- 0:00:35
      424000 -- (-602.813) [-600.791] (-600.097) (-603.624) * (-605.090) (-606.817) (-604.392) [-603.962] -- 0:00:35
      424500 -- [-604.408] (-605.403) (-601.314) (-604.131) * [-604.543] (-602.458) (-601.493) (-601.219) -- 0:00:35
      425000 -- (-600.210) (-602.033) [-601.586] (-602.652) * (-610.339) (-601.180) (-600.165) [-602.586] -- 0:00:35

      Average standard deviation of split frequencies: 0.013141

      425500 -- (-605.327) (-602.517) [-601.854] (-602.959) * (-604.745) (-607.322) [-600.446] (-602.396) -- 0:00:35
      426000 -- (-603.792) (-606.758) (-604.964) [-601.092] * (-603.078) [-603.894] (-601.460) (-607.629) -- 0:00:35
      426500 -- (-602.142) (-602.814) (-604.759) [-601.242] * (-601.584) (-600.787) (-601.635) [-607.449] -- 0:00:34
      427000 -- (-601.683) (-605.171) [-601.090] (-603.360) * (-603.862) (-601.080) [-603.831] (-600.882) -- 0:00:34
      427500 -- (-601.664) (-604.091) (-601.463) [-602.143] * (-601.264) (-602.187) (-600.181) [-602.492] -- 0:00:34
      428000 -- (-601.544) (-600.947) [-601.180] (-602.287) * (-600.478) [-602.283] (-602.963) (-603.165) -- 0:00:34
      428500 -- (-600.669) [-600.392] (-602.616) (-602.771) * (-602.436) (-600.871) (-601.364) [-600.856] -- 0:00:34
      429000 -- (-603.395) [-601.702] (-601.999) (-603.084) * (-600.525) (-602.364) [-601.910] (-600.733) -- 0:00:34
      429500 -- (-601.087) (-602.072) [-602.463] (-602.944) * (-605.444) (-600.894) (-601.233) [-600.889] -- 0:00:34
      430000 -- (-601.836) (-601.155) [-601.099] (-601.303) * (-603.340) (-601.914) (-604.889) [-605.874] -- 0:00:34

      Average standard deviation of split frequencies: 0.012519

      430500 -- (-603.840) (-600.674) (-602.741) [-600.830] * (-602.730) [-603.306] (-600.761) (-607.038) -- 0:00:34
      431000 -- (-606.104) (-601.039) [-601.412] (-600.750) * (-601.966) [-602.736] (-601.765) (-602.957) -- 0:00:34
      431500 -- [-603.367] (-604.318) (-602.381) (-601.840) * (-600.428) (-602.433) [-606.679] (-600.643) -- 0:00:34
      432000 -- (-601.435) (-602.586) [-600.296] (-602.653) * (-601.079) [-602.689] (-601.878) (-600.677) -- 0:00:34
      432500 -- (-602.498) [-601.486] (-606.484) (-602.239) * (-601.149) (-601.971) [-605.095] (-601.819) -- 0:00:34
      433000 -- (-604.167) (-602.392) (-606.550) [-600.761] * (-602.269) (-602.182) [-602.217] (-602.135) -- 0:00:34
      433500 -- [-604.667] (-601.793) (-603.715) (-602.202) * (-601.764) (-601.454) (-601.489) [-600.796] -- 0:00:33
      434000 -- (-602.160) (-602.537) (-600.333) [-601.160] * (-603.871) [-602.466] (-601.538) (-600.759) -- 0:00:33
      434500 -- (-604.186) (-600.218) [-600.896] (-602.438) * (-601.796) [-603.000] (-602.768) (-600.991) -- 0:00:33
      435000 -- [-602.422] (-604.134) (-603.157) (-602.482) * (-602.742) (-604.003) [-602.660] (-602.307) -- 0:00:35

      Average standard deviation of split frequencies: 0.012366

      435500 -- (-603.202) (-603.038) [-600.131] (-604.301) * (-604.237) (-602.506) (-603.207) [-606.091] -- 0:00:34
      436000 -- (-606.480) (-602.171) (-602.636) [-600.257] * (-602.614) [-601.001] (-602.882) (-601.659) -- 0:00:34
      436500 -- (-607.741) [-604.981] (-601.940) (-602.684) * (-602.818) (-602.228) [-604.396] (-600.105) -- 0:00:34
      437000 -- (-604.653) [-601.681] (-602.943) (-601.454) * (-602.266) (-605.143) [-605.193] (-603.120) -- 0:00:34
      437500 -- (-602.949) (-601.147) [-602.182] (-601.890) * (-604.081) (-601.976) [-604.356] (-603.085) -- 0:00:34
      438000 -- (-602.145) (-601.115) [-603.321] (-600.725) * (-605.146) (-603.051) [-600.250] (-604.007) -- 0:00:34
      438500 -- [-604.935] (-602.607) (-602.065) (-603.730) * (-603.089) (-601.443) [-600.116] (-605.114) -- 0:00:34
      439000 -- (-601.059) (-604.457) (-601.456) [-602.142] * [-601.048] (-600.940) (-600.831) (-600.016) -- 0:00:34
      439500 -- (-602.817) (-601.661) (-601.771) [-601.066] * [-601.891] (-601.465) (-604.156) (-602.993) -- 0:00:34
      440000 -- (-601.005) (-602.189) (-601.190) [-600.998] * (-600.988) (-604.175) (-603.040) [-603.317] -- 0:00:34

      Average standard deviation of split frequencies: 0.012770

      440500 -- (-601.331) (-607.139) [-602.548] (-602.136) * (-601.104) (-604.693) (-602.492) [-601.230] -- 0:00:34
      441000 -- (-601.647) (-605.227) [-602.835] (-601.623) * (-602.626) (-600.335) [-604.400] (-601.455) -- 0:00:34
      441500 -- (-604.565) (-607.994) [-600.855] (-601.328) * [-600.863] (-602.076) (-600.319) (-604.382) -- 0:00:34
      442000 -- (-605.837) [-601.364] (-600.539) (-600.604) * (-602.668) (-600.514) [-601.427] (-602.081) -- 0:00:34
      442500 -- (-600.799) (-603.695) (-600.608) [-602.347] * (-602.438) (-603.202) [-601.427] (-601.078) -- 0:00:34
      443000 -- (-603.864) (-601.601) (-601.622) [-600.896] * (-613.090) (-607.763) [-605.379] (-602.080) -- 0:00:33
      443500 -- (-605.791) [-601.004] (-602.247) (-603.586) * (-605.225) (-605.621) [-601.730] (-604.316) -- 0:00:33
      444000 -- [-603.526] (-601.971) (-603.661) (-602.934) * (-600.749) (-603.825) (-603.385) [-603.573] -- 0:00:33
      444500 -- (-602.349) [-600.760] (-602.353) (-602.173) * (-601.195) (-604.484) (-603.401) [-602.478] -- 0:00:33
      445000 -- (-601.603) (-600.819) [-600.619] (-604.228) * (-604.575) (-605.982) [-603.585] (-601.874) -- 0:00:33

      Average standard deviation of split frequencies: 0.012684

      445500 -- (-603.972) (-602.228) [-600.115] (-602.699) * (-602.531) [-605.757] (-605.182) (-600.568) -- 0:00:33
      446000 -- (-600.897) (-604.218) [-601.180] (-600.419) * (-602.048) (-605.226) (-608.101) [-603.919] -- 0:00:33
      446500 -- [-601.704] (-603.232) (-601.555) (-601.966) * (-606.063) (-609.493) (-608.153) [-603.176] -- 0:00:33
      447000 -- (-603.712) [-600.314] (-600.478) (-605.755) * (-605.569) (-602.128) [-601.867] (-603.014) -- 0:00:33
      447500 -- (-601.964) (-603.060) (-601.105) [-604.321] * (-606.413) (-604.670) [-601.240] (-604.074) -- 0:00:33
      448000 -- [-605.300] (-603.515) (-601.383) (-600.726) * (-605.586) [-600.715] (-603.389) (-601.745) -- 0:00:33
      448500 -- (-608.589) (-603.810) [-600.713] (-601.455) * (-604.161) (-605.671) (-601.175) [-602.009] -- 0:00:33
      449000 -- [-602.988] (-601.837) (-602.424) (-601.791) * [-601.481] (-602.964) (-602.946) (-602.224) -- 0:00:33
      449500 -- (-601.740) (-602.474) (-605.180) [-601.069] * [-603.700] (-600.497) (-602.612) (-604.239) -- 0:00:33
      450000 -- (-600.456) (-604.074) [-601.679] (-604.696) * (-601.333) [-600.453] (-606.259) (-601.010) -- 0:00:33

      Average standard deviation of split frequencies: 0.013206

      450500 -- (-600.404) (-600.576) (-600.910) [-603.829] * (-600.376) (-600.167) (-605.166) [-601.675] -- 0:00:32
      451000 -- (-601.710) (-601.003) [-604.716] (-604.870) * (-603.121) (-601.556) (-602.371) [-601.170] -- 0:00:32
      451500 -- [-600.822] (-603.824) (-601.923) (-601.822) * [-601.489] (-607.392) (-604.356) (-602.919) -- 0:00:32
      452000 -- (-601.878) (-603.869) [-603.345] (-601.466) * [-601.583] (-601.280) (-604.086) (-601.028) -- 0:00:33
      452500 -- (-605.471) (-604.359) [-600.695] (-602.866) * (-600.616) (-606.511) [-602.479] (-601.755) -- 0:00:33
      453000 -- (-603.303) (-602.127) [-602.996] (-602.754) * (-600.405) [-606.115] (-600.932) (-600.652) -- 0:00:33
      453500 -- (-602.190) (-602.611) (-603.571) [-602.245] * [-602.948] (-607.414) (-600.755) (-601.165) -- 0:00:33
      454000 -- (-600.994) [-603.406] (-601.002) (-600.732) * [-604.501] (-602.829) (-602.920) (-602.534) -- 0:00:33
      454500 -- [-604.608] (-605.964) (-600.585) (-601.409) * (-601.921) (-600.969) (-603.221) [-600.638] -- 0:00:33
      455000 -- (-604.562) (-600.997) [-604.754] (-601.861) * [-601.486] (-602.960) (-605.594) (-603.581) -- 0:00:33

      Average standard deviation of split frequencies: 0.013504

      455500 -- [-602.741] (-602.699) (-602.528) (-604.277) * (-601.462) (-603.275) (-603.726) [-602.112] -- 0:00:33
      456000 -- (-606.688) (-601.832) (-601.858) [-603.715] * [-601.637] (-600.604) (-602.365) (-603.444) -- 0:00:33
      456500 -- (-602.736) (-601.942) [-603.029] (-602.226) * (-600.598) [-601.603] (-603.059) (-603.951) -- 0:00:33
      457000 -- (-602.157) (-604.294) (-601.882) [-602.321] * (-600.370) (-601.771) [-600.106] (-604.085) -- 0:00:33
      457500 -- (-600.678) [-600.456] (-604.519) (-604.406) * (-602.417) [-601.687] (-600.436) (-601.464) -- 0:00:33
      458000 -- (-604.641) [-600.719] (-600.818) (-603.480) * (-603.985) (-601.263) [-604.348] (-602.105) -- 0:00:33
      458500 -- [-602.311] (-602.323) (-605.420) (-609.015) * (-600.360) (-603.542) [-600.837] (-600.670) -- 0:00:33
      459000 -- (-602.494) (-603.364) (-601.271) [-604.165] * (-606.002) (-607.153) (-601.742) [-604.234] -- 0:00:33
      459500 -- (-607.430) [-603.331] (-600.298) (-603.330) * (-601.110) (-601.002) [-600.704] (-604.000) -- 0:00:32
      460000 -- (-602.917) [-604.164] (-602.888) (-605.561) * [-601.604] (-600.950) (-600.246) (-602.160) -- 0:00:32

      Average standard deviation of split frequencies: 0.013879

      460500 -- (-601.895) (-603.500) [-600.776] (-601.639) * (-602.983) (-603.260) (-601.446) [-603.491] -- 0:00:32
      461000 -- (-600.500) (-601.627) [-602.221] (-602.388) * (-603.662) (-602.413) (-603.770) [-602.607] -- 0:00:32
      461500 -- (-602.250) [-600.557] (-601.852) (-602.498) * [-600.066] (-601.343) (-602.881) (-600.950) -- 0:00:32
      462000 -- (-600.478) (-601.107) (-606.084) [-600.680] * (-602.259) [-600.768] (-603.946) (-602.137) -- 0:00:32
      462500 -- [-601.055] (-600.609) (-602.577) (-600.340) * (-600.354) [-601.124] (-602.608) (-600.908) -- 0:00:32
      463000 -- (-599.949) [-601.411] (-601.672) (-603.669) * [-602.508] (-603.317) (-601.565) (-601.693) -- 0:00:32
      463500 -- (-600.450) (-601.650) [-602.863] (-602.921) * (-601.875) (-601.755) (-606.026) [-604.203] -- 0:00:32
      464000 -- (-600.943) (-602.110) [-600.840] (-600.116) * (-602.832) [-602.301] (-602.344) (-602.240) -- 0:00:32
      464500 -- (-602.224) (-600.664) [-601.695] (-600.438) * (-602.645) (-602.301) [-600.517] (-601.713) -- 0:00:32
      465000 -- [-603.458] (-601.037) (-601.890) (-600.513) * (-602.002) (-600.929) (-600.735) [-601.375] -- 0:00:32

      Average standard deviation of split frequencies: 0.013909

      465500 -- [-605.098] (-601.378) (-601.208) (-603.848) * (-602.837) (-603.532) [-600.981] (-600.460) -- 0:00:32
      466000 -- [-601.180] (-606.347) (-601.286) (-602.292) * (-602.794) (-602.574) (-605.213) [-599.979] -- 0:00:32
      466500 -- [-601.917] (-602.892) (-601.522) (-601.149) * (-603.607) (-601.336) (-604.518) [-600.111] -- 0:00:32
      467000 -- (-600.583) (-601.639) (-601.107) [-601.718] * (-606.446) (-604.853) (-605.708) [-600.598] -- 0:00:31
      467500 -- [-601.854] (-602.532) (-603.424) (-601.636) * (-602.895) (-603.316) (-606.075) [-601.234] -- 0:00:31
      468000 -- [-604.373] (-602.866) (-604.343) (-600.348) * [-602.867] (-603.500) (-602.135) (-602.830) -- 0:00:31
      468500 -- (-602.696) [-600.417] (-606.664) (-602.570) * [-608.194] (-602.474) (-600.201) (-602.934) -- 0:00:32
      469000 -- (-605.155) [-600.091] (-601.883) (-601.802) * (-602.352) (-605.502) [-601.851] (-600.837) -- 0:00:32
      469500 -- (-601.576) (-603.546) [-603.022] (-602.501) * [-604.571] (-601.391) (-604.261) (-603.750) -- 0:00:32
      470000 -- (-605.469) (-602.283) (-601.776) [-601.074] * (-604.202) [-605.878] (-604.600) (-602.452) -- 0:00:32

      Average standard deviation of split frequencies: 0.013208

      470500 -- (-603.100) [-602.112] (-603.733) (-602.166) * (-601.518) [-602.763] (-603.602) (-601.625) -- 0:00:32
      471000 -- (-603.084) [-604.476] (-603.039) (-604.230) * [-603.735] (-601.749) (-601.625) (-605.709) -- 0:00:32
      471500 -- (-601.636) [-602.749] (-603.355) (-602.777) * (-601.691) (-600.489) [-600.341] (-607.198) -- 0:00:32
      472000 -- (-605.312) (-601.633) (-602.703) [-601.223] * (-606.820) [-600.490] (-601.642) (-602.984) -- 0:00:32
      472500 -- [-601.418] (-600.645) (-604.873) (-604.496) * [-600.394] (-601.321) (-600.355) (-605.480) -- 0:00:32
      473000 -- [-600.859] (-602.399) (-605.014) (-600.996) * (-601.690) (-605.156) [-600.177] (-601.371) -- 0:00:32
      473500 -- (-602.401) (-601.700) (-600.615) [-601.478] * (-604.544) (-601.373) (-601.376) [-601.524] -- 0:00:32
      474000 -- (-601.336) [-600.879] (-601.910) (-601.689) * (-603.131) (-601.682) (-601.141) [-600.290] -- 0:00:32
      474500 -- (-603.103) (-602.620) [-604.140] (-601.330) * (-602.805) (-602.665) (-602.562) [-600.156] -- 0:00:32
      475000 -- [-603.333] (-608.416) (-603.348) (-601.833) * (-605.382) (-601.839) [-604.191] (-600.091) -- 0:00:32

      Average standard deviation of split frequencies: 0.012936

      475500 -- (-600.764) [-605.590] (-602.013) (-603.121) * (-604.635) (-601.514) [-602.766] (-602.394) -- 0:00:31
      476000 -- (-600.682) (-602.500) (-602.924) [-602.189] * (-605.687) (-600.395) [-604.862] (-602.900) -- 0:00:31
      476500 -- [-600.265] (-603.082) (-600.789) (-602.219) * (-601.514) (-600.763) [-601.965] (-600.471) -- 0:00:31
      477000 -- (-601.004) [-602.030] (-600.362) (-601.734) * [-601.158] (-601.111) (-601.523) (-600.971) -- 0:00:31
      477500 -- (-602.280) (-602.323) [-601.369] (-602.383) * [-600.171] (-606.042) (-602.390) (-602.241) -- 0:00:31
      478000 -- [-604.766] (-604.945) (-605.388) (-604.858) * (-600.789) [-602.858] (-601.768) (-600.330) -- 0:00:31
      478500 -- (-603.358) (-603.017) (-601.586) [-601.112] * (-605.598) (-603.017) (-601.429) [-603.072] -- 0:00:31
      479000 -- (-600.405) (-602.197) [-601.839] (-602.741) * [-602.394] (-602.514) (-602.511) (-603.860) -- 0:00:31
      479500 -- [-602.594] (-604.100) (-604.443) (-605.058) * (-605.264) (-601.990) (-601.346) [-602.327] -- 0:00:31
      480000 -- (-603.983) (-603.268) (-605.143) [-602.176] * (-602.603) (-602.844) (-601.815) [-601.646] -- 0:00:31

      Average standard deviation of split frequencies: 0.013179

      480500 -- (-601.945) [-600.945] (-603.350) (-601.790) * (-602.871) [-602.896] (-603.208) (-607.538) -- 0:00:31
      481000 -- [-601.488] (-602.332) (-606.211) (-601.439) * (-601.986) (-601.441) (-602.288) [-602.952] -- 0:00:31
      481500 -- (-600.565) (-604.465) [-600.183] (-600.801) * (-601.862) (-602.598) [-601.750] (-602.854) -- 0:00:31
      482000 -- [-600.370] (-602.660) (-600.266) (-602.916) * (-602.061) (-603.493) [-604.576] (-607.050) -- 0:00:31
      482500 -- (-608.883) [-605.535] (-608.146) (-601.223) * (-605.082) [-602.498] (-601.239) (-603.670) -- 0:00:31
      483000 -- [-602.966] (-602.447) (-602.537) (-602.218) * (-603.918) (-601.740) (-602.072) [-604.193] -- 0:00:31
      483500 -- (-604.759) (-602.250) (-601.754) [-602.937] * (-607.519) [-602.622] (-602.361) (-602.159) -- 0:00:30
      484000 -- (-602.012) [-601.345] (-604.515) (-603.957) * (-600.999) (-601.108) (-602.582) [-603.849] -- 0:00:30
      484500 -- (-601.124) [-602.220] (-602.183) (-603.673) * (-600.867) (-602.897) [-610.147] (-600.984) -- 0:00:30
      485000 -- (-600.595) (-601.205) (-603.297) [-604.189] * (-603.165) (-606.463) (-614.946) [-601.309] -- 0:00:30

      Average standard deviation of split frequencies: 0.012913

      485500 -- (-600.550) (-600.907) (-601.113) [-604.389] * [-602.773] (-602.463) (-602.147) (-601.709) -- 0:00:31
      486000 -- [-600.440] (-601.038) (-604.341) (-609.632) * (-603.067) [-601.772] (-600.739) (-600.925) -- 0:00:31
      486500 -- (-602.986) (-600.635) (-603.180) [-600.294] * (-601.240) (-609.179) (-604.419) [-601.012] -- 0:00:31
      487000 -- (-602.327) [-600.232] (-603.409) (-600.086) * [-603.542] (-601.979) (-602.601) (-600.860) -- 0:00:31
      487500 -- [-602.001] (-601.972) (-606.445) (-600.318) * (-601.699) (-601.755) (-603.711) [-601.696] -- 0:00:31
      488000 -- [-606.780] (-602.756) (-602.362) (-602.904) * (-601.486) (-602.140) [-604.956] (-600.917) -- 0:00:31
      488500 -- (-601.454) (-600.632) [-600.374] (-606.952) * [-606.209] (-600.897) (-604.691) (-600.785) -- 0:00:31
      489000 -- (-601.222) (-604.452) [-601.491] (-600.648) * [-602.721] (-604.105) (-600.730) (-607.184) -- 0:00:31
      489500 -- [-600.028] (-600.188) (-604.202) (-605.970) * (-603.832) (-604.030) (-603.373) [-605.032] -- 0:00:31
      490000 -- (-602.735) [-601.581] (-602.074) (-601.178) * (-600.585) [-602.279] (-602.768) (-602.405) -- 0:00:31

      Average standard deviation of split frequencies: 0.013090

      490500 -- (-601.887) (-603.030) [-600.696] (-600.443) * (-603.846) (-602.913) (-601.185) [-601.543] -- 0:00:31
      491000 -- (-603.052) (-602.795) [-600.551] (-600.282) * (-600.366) [-605.880] (-603.905) (-601.484) -- 0:00:31
      491500 -- (-600.113) [-603.694] (-603.129) (-601.054) * (-602.667) (-603.600) [-602.056] (-603.796) -- 0:00:31
      492000 -- [-601.724] (-604.386) (-600.251) (-600.393) * (-600.984) [-600.487] (-600.884) (-604.805) -- 0:00:30
      492500 -- [-603.353] (-600.665) (-605.008) (-604.864) * (-603.449) [-600.555] (-602.018) (-602.711) -- 0:00:30
      493000 -- (-602.765) [-599.986] (-604.125) (-600.054) * (-606.557) (-600.484) [-603.034] (-602.095) -- 0:00:30
      493500 -- [-605.613] (-601.999) (-605.078) (-602.647) * (-601.788) [-602.031] (-605.040) (-602.012) -- 0:00:30
      494000 -- (-606.695) (-599.875) (-606.181) [-602.442] * (-602.517) (-602.163) [-601.313] (-608.105) -- 0:00:30
      494500 -- (-604.709) (-601.429) (-602.563) [-600.647] * (-604.652) (-605.655) (-603.535) [-602.331] -- 0:00:30
      495000 -- (-601.764) (-600.039) (-605.944) [-601.238] * (-601.449) (-603.426) (-601.612) [-605.914] -- 0:00:30

      Average standard deviation of split frequencies: 0.012652

      495500 -- (-600.220) (-601.596) [-600.620] (-602.440) * (-602.231) (-603.946) [-606.595] (-601.517) -- 0:00:30
      496000 -- [-603.570] (-601.900) (-600.376) (-602.006) * (-601.377) [-604.556] (-602.924) (-601.331) -- 0:00:30
      496500 -- (-600.945) [-601.934] (-600.212) (-601.079) * (-601.753) [-602.901] (-602.914) (-601.888) -- 0:00:30
      497000 -- [-601.099] (-601.672) (-604.117) (-600.490) * (-603.437) (-601.239) [-602.296] (-601.733) -- 0:00:30
      497500 -- (-601.214) (-602.495) (-602.756) [-602.176] * [-603.892] (-602.310) (-604.742) (-601.993) -- 0:00:30
      498000 -- (-602.672) [-602.164] (-604.297) (-605.830) * [-602.397] (-602.275) (-602.656) (-600.863) -- 0:00:30
      498500 -- (-601.754) (-601.696) (-601.993) [-601.746] * (-601.313) (-600.961) [-606.485] (-601.848) -- 0:00:30
      499000 -- [-605.325] (-603.709) (-603.603) (-601.719) * (-600.973) (-606.264) (-602.710) [-601.008] -- 0:00:30
      499500 -- (-602.105) (-601.566) (-602.340) [-601.580] * (-602.397) (-606.303) (-601.620) [-602.266] -- 0:00:30
      500000 -- (-600.630) [-600.816] (-607.969) (-602.557) * [-602.109] (-603.816) (-601.543) (-601.699) -- 0:00:30

      Average standard deviation of split frequencies: 0.012476

      500500 -- (-601.489) [-602.994] (-607.331) (-604.155) * (-602.723) (-602.372) (-601.540) [-601.911] -- 0:00:29
      501000 -- (-601.216) [-602.445] (-602.206) (-600.317) * (-601.969) [-601.749] (-602.390) (-602.509) -- 0:00:29
      501500 -- (-600.406) (-603.235) (-602.279) [-600.995] * (-606.468) [-601.227] (-601.836) (-602.185) -- 0:00:29
      502000 -- (-600.878) (-602.643) (-601.347) [-601.779] * (-605.385) (-601.305) (-604.803) [-600.780] -- 0:00:30
      502500 -- [-603.021] (-604.064) (-602.660) (-601.526) * [-600.983] (-603.511) (-605.106) (-600.176) -- 0:00:30
      503000 -- (-600.716) (-601.569) (-601.479) [-601.590] * (-603.167) (-601.598) [-600.794] (-600.121) -- 0:00:30
      503500 -- (-600.489) [-601.148] (-600.844) (-606.032) * (-604.702) (-600.330) [-600.668] (-600.865) -- 0:00:30
      504000 -- (-601.428) (-602.008) (-604.179) [-604.972] * [-603.690] (-602.560) (-601.136) (-600.857) -- 0:00:30
      504500 -- (-604.324) (-601.099) (-605.905) [-601.127] * (-605.227) (-603.269) (-602.364) [-600.205] -- 0:00:30
      505000 -- (-604.115) [-603.993] (-602.886) (-600.781) * (-601.127) (-602.621) [-602.813] (-601.159) -- 0:00:30

      Average standard deviation of split frequencies: 0.012868

      505500 -- (-607.683) (-602.097) [-603.122] (-603.923) * (-600.275) (-605.509) (-601.294) [-603.571] -- 0:00:30
      506000 -- [-601.801] (-600.998) (-602.182) (-605.168) * (-601.397) (-600.168) [-605.024] (-602.253) -- 0:00:30
      506500 -- [-602.245] (-600.549) (-601.476) (-601.364) * [-601.746] (-602.756) (-611.375) (-601.502) -- 0:00:30
      507000 -- (-602.215) [-602.030] (-604.369) (-602.172) * (-600.552) (-603.201) [-600.537] (-604.276) -- 0:00:30
      507500 -- (-602.950) (-600.438) [-601.220] (-603.047) * (-604.346) (-601.549) [-601.325] (-604.683) -- 0:00:30
      508000 -- (-603.392) (-600.140) (-601.257) [-606.780] * [-603.269] (-600.277) (-601.596) (-604.504) -- 0:00:30
      508500 -- (-607.779) [-601.466] (-614.887) (-603.587) * (-601.384) [-600.276] (-602.354) (-602.370) -- 0:00:29
      509000 -- (-601.160) [-600.336] (-605.877) (-602.491) * [-600.184] (-605.659) (-603.649) (-601.818) -- 0:00:29
      509500 -- (-604.063) (-605.461) [-600.783] (-602.317) * [-600.731] (-605.500) (-601.867) (-600.657) -- 0:00:29
      510000 -- (-600.209) [-603.146] (-602.041) (-600.782) * [-605.764] (-605.401) (-601.237) (-604.771) -- 0:00:29

      Average standard deviation of split frequencies: 0.012462

      510500 -- (-600.219) (-603.081) (-601.628) [-602.812] * (-601.633) (-603.344) [-603.895] (-601.634) -- 0:00:29
      511000 -- (-601.249) [-604.177] (-602.643) (-605.295) * (-600.808) (-603.986) [-604.252] (-603.138) -- 0:00:29
      511500 -- (-602.006) [-604.268] (-602.814) (-607.642) * (-605.515) (-602.524) [-601.931] (-602.048) -- 0:00:29
      512000 -- (-602.558) (-603.973) [-601.798] (-605.041) * [-603.761] (-601.052) (-604.362) (-601.270) -- 0:00:29
      512500 -- (-601.728) (-600.844) [-602.925] (-601.286) * (-601.071) (-600.843) [-603.722] (-603.480) -- 0:00:29
      513000 -- (-602.548) (-602.461) (-600.578) [-601.087] * [-603.111] (-605.328) (-601.634) (-602.693) -- 0:00:29
      513500 -- [-605.762] (-606.123) (-601.557) (-605.686) * (-601.484) [-601.429] (-605.788) (-605.883) -- 0:00:29
      514000 -- [-599.981] (-600.321) (-601.311) (-606.320) * (-601.564) (-605.271) [-601.594] (-604.124) -- 0:00:29
      514500 -- [-601.621] (-602.908) (-601.567) (-606.636) * (-601.445) (-602.575) [-603.259] (-603.375) -- 0:00:29
      515000 -- [-601.343] (-604.269) (-603.273) (-601.284) * (-602.694) [-605.445] (-602.549) (-603.099) -- 0:00:29

      Average standard deviation of split frequencies: 0.012105

      515500 -- (-600.384) [-601.266] (-603.359) (-603.145) * (-610.166) (-602.107) (-602.724) [-602.934] -- 0:00:29
      516000 -- (-603.475) (-601.092) [-601.455] (-600.662) * (-604.005) (-602.947) [-601.536] (-602.998) -- 0:00:29
      516500 -- (-604.157) (-600.960) (-600.945) [-604.474] * (-601.595) [-602.947] (-601.853) (-601.608) -- 0:00:29
      517000 -- (-601.840) (-600.814) (-601.193) [-602.535] * (-602.361) (-601.435) (-604.757) [-601.189] -- 0:00:28
      517500 -- (-607.788) [-603.728] (-601.854) (-603.497) * [-599.957] (-602.781) (-601.337) (-600.327) -- 0:00:28
      518000 -- [-601.644] (-604.619) (-602.388) (-607.475) * (-603.029) (-603.047) (-603.369) [-600.154] -- 0:00:29
      518500 -- (-603.204) (-601.663) [-600.937] (-606.762) * (-603.760) [-603.075] (-600.919) (-601.552) -- 0:00:29
      519000 -- [-603.673] (-603.443) (-601.134) (-603.245) * [-601.284] (-602.829) (-604.322) (-601.489) -- 0:00:29
      519500 -- (-601.646) [-601.594] (-601.117) (-601.604) * (-602.628) (-605.307) [-607.859] (-600.960) -- 0:00:29
      520000 -- (-602.731) (-603.486) [-600.125] (-602.985) * (-605.130) [-605.014] (-603.918) (-602.041) -- 0:00:29

      Average standard deviation of split frequencies: 0.011408

      520500 -- (-602.897) [-604.368] (-600.332) (-602.511) * [-602.875] (-600.103) (-601.267) (-600.491) -- 0:00:29
      521000 -- (-602.144) (-605.104) [-600.492] (-600.754) * [-603.821] (-602.651) (-604.142) (-601.249) -- 0:00:29
      521500 -- (-604.030) (-601.110) [-602.119] (-601.624) * (-603.650) (-611.456) [-603.352] (-603.826) -- 0:00:29
      522000 -- [-602.915] (-600.934) (-607.106) (-600.887) * [-600.756] (-606.727) (-601.035) (-600.094) -- 0:00:29
      522500 -- [-601.286] (-603.062) (-604.586) (-603.436) * (-601.212) (-605.506) (-603.231) [-601.311] -- 0:00:29
      523000 -- (-604.299) (-605.347) [-602.104] (-600.806) * (-602.233) (-602.747) (-605.911) [-603.565] -- 0:00:29
      523500 -- (-601.579) (-602.079) [-604.243] (-606.897) * (-601.781) (-604.401) [-601.868] (-601.663) -- 0:00:29
      524000 -- (-602.173) (-601.510) [-604.542] (-604.875) * [-603.307] (-600.260) (-602.599) (-602.183) -- 0:00:29
      524500 -- (-604.381) (-602.492) [-605.436] (-602.379) * (-600.623) [-600.452] (-601.217) (-603.969) -- 0:00:29
      525000 -- (-604.837) (-602.350) [-606.995] (-601.195) * (-600.294) (-603.875) [-605.543] (-603.745) -- 0:00:28

      Average standard deviation of split frequencies: 0.010695

      525500 -- (-600.777) (-602.022) (-605.415) [-601.302] * [-600.240] (-603.721) (-606.705) (-603.934) -- 0:00:28
      526000 -- (-601.759) [-602.583] (-603.768) (-601.420) * (-602.440) (-602.712) [-602.635] (-604.916) -- 0:00:28
      526500 -- (-601.252) (-601.102) (-604.943) [-600.341] * (-605.705) (-600.912) (-604.031) [-602.607] -- 0:00:28
      527000 -- (-602.411) [-603.499] (-602.251) (-600.533) * (-601.445) [-600.479] (-603.360) (-605.545) -- 0:00:28
      527500 -- (-605.869) (-604.816) [-603.134] (-605.009) * [-602.640] (-601.062) (-602.785) (-605.176) -- 0:00:28
      528000 -- (-605.780) (-601.388) [-600.908] (-601.181) * (-600.007) (-603.906) [-600.362] (-600.868) -- 0:00:28
      528500 -- (-601.681) (-600.679) [-603.547] (-602.120) * [-600.927] (-601.386) (-601.077) (-603.297) -- 0:00:28
      529000 -- [-601.241] (-602.500) (-603.547) (-603.866) * (-604.683) [-602.702] (-603.661) (-601.173) -- 0:00:28
      529500 -- (-602.717) (-603.867) [-601.341] (-602.976) * (-602.202) (-601.165) [-600.781] (-601.188) -- 0:00:28
      530000 -- [-600.155] (-600.776) (-602.305) (-604.531) * [-600.856] (-602.098) (-601.847) (-602.548) -- 0:00:28

      Average standard deviation of split frequencies: 0.010956

      530500 -- [-602.715] (-601.948) (-603.492) (-602.003) * (-601.410) (-600.842) [-601.818] (-601.980) -- 0:00:28
      531000 -- (-601.614) (-601.907) [-603.236] (-601.753) * (-601.859) (-600.539) (-602.610) [-601.252] -- 0:00:28
      531500 -- (-607.972) (-601.200) (-604.510) [-602.327] * (-605.141) (-601.882) [-603.274] (-602.200) -- 0:00:28
      532000 -- [-603.561] (-605.141) (-602.943) (-602.360) * [-602.824] (-604.020) (-605.882) (-602.930) -- 0:00:28
      532500 -- [-602.925] (-604.813) (-604.161) (-604.529) * (-605.364) (-603.067) [-601.999] (-601.692) -- 0:00:28
      533000 -- (-604.036) (-604.362) [-605.915] (-602.988) * (-603.353) (-604.023) [-602.909] (-600.883) -- 0:00:28
      533500 -- (-602.658) (-601.442) [-606.916] (-605.303) * (-601.664) [-601.348] (-604.276) (-601.720) -- 0:00:27
      534000 -- (-601.216) [-602.467] (-602.031) (-604.601) * (-601.553) (-608.777) [-602.443] (-602.307) -- 0:00:28
      534500 -- (-603.774) (-602.179) (-600.909) [-601.235] * (-601.700) [-600.187] (-604.577) (-600.693) -- 0:00:28
      535000 -- (-605.098) (-603.659) [-600.744] (-603.236) * (-603.959) (-605.274) (-601.727) [-603.153] -- 0:00:28

      Average standard deviation of split frequencies: 0.010847

      535500 -- (-602.361) [-605.506] (-603.964) (-605.187) * (-603.998) [-604.176] (-603.617) (-608.045) -- 0:00:28
      536000 -- [-601.435] (-603.974) (-604.458) (-605.149) * (-604.567) (-602.259) [-602.349] (-603.928) -- 0:00:28
      536500 -- (-600.949) (-602.826) [-600.515] (-604.422) * (-600.333) (-601.850) [-602.273] (-604.912) -- 0:00:28
      537000 -- (-601.239) [-601.260] (-600.046) (-607.382) * (-600.274) [-602.277] (-603.441) (-606.300) -- 0:00:28
      537500 -- (-601.381) [-600.622] (-601.743) (-605.152) * [-600.572] (-602.001) (-602.138) (-603.982) -- 0:00:28
      538000 -- (-602.953) [-604.615] (-600.844) (-603.319) * (-601.192) (-603.257) [-601.132] (-601.556) -- 0:00:28
      538500 -- (-600.019) [-602.095] (-602.959) (-605.452) * (-601.302) (-603.727) (-600.874) [-600.476] -- 0:00:28
      539000 -- (-603.248) [-602.761] (-602.072) (-604.948) * (-605.504) (-602.663) (-600.565) [-605.022] -- 0:00:28
      539500 -- (-604.609) (-602.772) [-600.843] (-601.218) * (-609.309) (-603.318) [-600.822] (-600.813) -- 0:00:28
      540000 -- (-600.769) [-602.675] (-601.496) (-603.545) * (-604.942) (-603.463) [-605.267] (-601.414) -- 0:00:28

      Average standard deviation of split frequencies: 0.010870

      540500 -- [-603.804] (-603.176) (-601.944) (-600.573) * [-603.727] (-601.584) (-603.824) (-604.532) -- 0:00:28
      541000 -- [-604.053] (-602.938) (-603.255) (-601.840) * (-602.451) (-601.481) (-603.465) [-603.847] -- 0:00:27
      541500 -- [-601.740] (-604.722) (-604.197) (-602.144) * (-601.268) (-603.259) (-603.490) [-601.755] -- 0:00:27
      542000 -- (-603.559) [-601.767] (-603.952) (-601.363) * (-600.891) (-602.118) (-601.888) [-601.695] -- 0:00:27
      542500 -- (-606.991) (-601.671) (-601.221) [-604.206] * (-600.961) (-603.247) [-607.188] (-602.165) -- 0:00:27
      543000 -- (-600.703) (-602.433) [-602.231] (-603.683) * [-602.794] (-604.410) (-603.776) (-604.472) -- 0:00:27
      543500 -- [-601.034] (-601.352) (-600.614) (-603.522) * (-600.734) [-600.882] (-603.091) (-601.976) -- 0:00:27
      544000 -- (-600.949) (-603.502) [-601.347] (-602.254) * (-601.244) [-601.297] (-605.988) (-600.984) -- 0:00:27
      544500 -- [-600.588] (-606.291) (-601.466) (-600.496) * [-605.187] (-602.871) (-600.824) (-600.512) -- 0:00:27
      545000 -- (-602.005) (-601.124) (-601.160) [-601.839] * [-601.274] (-600.589) (-603.801) (-603.772) -- 0:00:27

      Average standard deviation of split frequencies: 0.010576

      545500 -- (-601.414) (-603.123) (-603.542) [-603.995] * [-600.831] (-600.520) (-605.234) (-603.295) -- 0:00:27
      546000 -- (-602.764) [-602.715] (-614.122) (-600.760) * (-601.266) (-603.556) (-601.131) [-601.946] -- 0:00:27
      546500 -- (-604.589) [-606.159] (-601.388) (-601.455) * (-603.677) (-601.046) (-602.723) [-601.360] -- 0:00:27
      547000 -- (-608.058) (-601.268) (-600.947) [-600.607] * (-602.938) (-601.737) (-607.800) [-602.904] -- 0:00:27
      547500 -- (-600.507) (-600.992) (-601.778) [-602.964] * (-603.109) (-601.378) [-607.307] (-601.583) -- 0:00:27
      548000 -- (-601.928) [-600.760] (-603.075) (-601.864) * (-604.960) (-601.690) (-601.149) [-600.670] -- 0:00:27
      548500 -- (-601.013) (-600.471) (-603.857) [-601.254] * (-607.883) [-601.250] (-600.799) (-603.979) -- 0:00:27
      549000 -- (-601.833) [-600.128] (-606.351) (-601.995) * (-605.409) [-599.980] (-601.079) (-604.955) -- 0:00:27
      549500 -- (-599.997) (-601.153) (-607.010) [-601.317] * (-602.598) (-601.094) (-602.098) [-602.432] -- 0:00:27
      550000 -- [-600.157] (-600.939) (-609.568) (-602.029) * (-600.580) (-604.190) [-601.773] (-600.995) -- 0:00:27

      Average standard deviation of split frequencies: 0.010166

      550500 -- (-604.363) [-601.870] (-606.480) (-603.080) * (-602.671) (-602.627) [-603.024] (-605.027) -- 0:00:27
      551000 -- (-601.077) (-600.424) (-600.334) [-603.351] * (-600.255) [-605.865] (-606.748) (-601.072) -- 0:00:27
      551500 -- (-600.721) (-602.330) (-600.670) [-600.116] * (-600.195) (-605.081) (-607.158) [-600.308] -- 0:00:27
      552000 -- [-603.713] (-600.189) (-603.933) (-605.170) * (-602.466) [-603.237] (-601.234) (-603.424) -- 0:00:27
      552500 -- (-601.933) [-600.404] (-601.379) (-600.527) * (-601.468) (-602.277) (-602.119) [-601.326] -- 0:00:27
      553000 -- (-603.428) (-602.979) [-601.463] (-600.764) * (-601.861) (-602.229) (-602.469) [-603.240] -- 0:00:27
      553500 -- (-602.243) (-605.880) [-603.483] (-600.441) * [-600.984] (-601.434) (-606.526) (-606.060) -- 0:00:27
      554000 -- (-601.354) (-603.852) [-603.457] (-602.669) * (-601.859) (-608.114) (-607.655) [-605.581] -- 0:00:27
      554500 -- (-601.043) (-604.407) (-602.958) [-600.950] * (-602.596) (-607.171) [-600.512] (-603.223) -- 0:00:27
      555000 -- [-600.562] (-603.384) (-601.375) (-605.016) * (-602.954) (-602.219) (-602.919) [-602.984] -- 0:00:27

      Average standard deviation of split frequencies: 0.010280

      555500 -- [-602.333] (-602.101) (-608.613) (-604.578) * (-602.084) (-600.462) [-601.578] (-600.420) -- 0:00:27
      556000 -- [-603.094] (-604.449) (-603.477) (-602.741) * (-600.871) (-602.543) [-601.253] (-601.053) -- 0:00:27
      556500 -- (-605.845) (-601.734) [-601.023] (-601.599) * (-600.755) (-603.988) (-602.873) [-602.534] -- 0:00:27
      557000 -- (-604.718) (-601.866) [-604.043] (-600.120) * (-600.027) (-601.340) (-604.941) [-601.872] -- 0:00:27
      557500 -- [-603.578] (-605.684) (-602.306) (-602.550) * (-600.388) (-601.629) [-603.060] (-601.308) -- 0:00:26
      558000 -- (-601.120) (-601.589) (-603.691) [-600.255] * (-605.195) [-602.191] (-605.495) (-602.547) -- 0:00:26
      558500 -- [-601.139] (-600.244) (-603.709) (-601.740) * (-603.512) [-603.001] (-602.003) (-600.897) -- 0:00:26
      559000 -- (-602.509) [-602.321] (-603.365) (-603.559) * [-604.480] (-604.095) (-602.175) (-602.063) -- 0:00:26
      559500 -- (-602.672) [-602.885] (-602.025) (-601.690) * (-602.514) [-602.681] (-602.441) (-601.135) -- 0:00:26
      560000 -- (-606.449) (-602.044) [-602.948] (-601.015) * [-602.152] (-604.225) (-602.633) (-605.911) -- 0:00:26

      Average standard deviation of split frequencies: 0.009722

      560500 -- (-601.603) [-601.884] (-608.171) (-601.873) * (-601.383) (-602.527) (-603.355) [-605.600] -- 0:00:26
      561000 -- [-603.720] (-601.003) (-608.806) (-604.691) * (-605.846) (-604.253) [-602.928] (-602.347) -- 0:00:26
      561500 -- (-600.660) [-601.459] (-606.900) (-604.060) * (-606.847) [-601.424] (-602.889) (-600.235) -- 0:00:26
      562000 -- (-600.985) [-604.361] (-600.945) (-603.655) * (-602.208) [-601.302] (-601.706) (-601.081) -- 0:00:26
      562500 -- (-601.136) (-604.022) [-600.528] (-601.771) * (-602.304) [-601.148] (-601.298) (-602.211) -- 0:00:26
      563000 -- (-603.884) (-602.031) [-601.197] (-600.718) * [-601.297] (-601.367) (-601.199) (-603.155) -- 0:00:26
      563500 -- (-606.890) (-602.973) [-602.091] (-605.855) * (-601.247) (-601.741) (-604.094) [-603.149] -- 0:00:26
      564000 -- (-602.640) (-600.863) [-602.674] (-603.702) * (-603.821) (-601.622) (-602.558) [-601.108] -- 0:00:26
      564500 -- (-600.743) (-601.683) [-601.995] (-604.071) * (-601.929) [-601.738] (-600.844) (-600.979) -- 0:00:26
      565000 -- (-600.511) (-604.516) (-603.073) [-600.657] * (-601.033) (-603.263) [-600.691] (-601.380) -- 0:00:26

      Average standard deviation of split frequencies: 0.010046

      565500 -- (-601.744) (-601.527) [-602.284] (-601.401) * (-604.087) (-601.316) [-602.704] (-607.811) -- 0:00:26
      566000 -- (-601.388) (-603.508) [-602.389] (-602.012) * [-605.167] (-601.709) (-604.238) (-607.505) -- 0:00:26
      566500 -- (-602.411) [-600.808] (-602.252) (-601.713) * (-601.560) (-602.284) [-604.643] (-601.435) -- 0:00:26
      567000 -- (-604.261) (-600.887) [-603.138] (-600.938) * (-609.797) [-602.806] (-601.160) (-604.018) -- 0:00:26
      567500 -- (-603.910) [-600.594] (-601.883) (-600.067) * (-601.479) [-600.792] (-601.005) (-605.773) -- 0:00:26
      568000 -- (-601.550) [-602.062] (-612.861) (-602.345) * [-605.781] (-601.323) (-603.558) (-601.523) -- 0:00:26
      568500 -- (-601.757) (-603.502) [-601.410] (-601.347) * (-602.035) (-602.592) [-600.944] (-606.592) -- 0:00:26
      569000 -- (-601.660) [-602.597] (-601.586) (-600.821) * (-602.316) (-603.959) (-603.880) [-607.369] -- 0:00:26
      569500 -- (-603.998) (-601.494) [-601.886] (-602.886) * (-601.555) [-605.748] (-602.065) (-603.305) -- 0:00:26
      570000 -- [-602.365] (-601.466) (-601.462) (-602.002) * (-601.416) [-600.852] (-602.851) (-600.639) -- 0:00:26

      Average standard deviation of split frequencies: 0.009706

      570500 -- (-602.422) (-603.246) [-601.800] (-602.698) * [-601.691] (-607.229) (-603.389) (-600.810) -- 0:00:26
      571000 -- (-601.407) [-600.556] (-600.871) (-602.691) * [-601.616] (-601.153) (-601.565) (-603.217) -- 0:00:26
      571500 -- (-601.152) (-603.733) (-600.593) [-603.561] * (-603.499) [-602.664] (-602.983) (-604.690) -- 0:00:26
      572000 -- [-601.550] (-602.617) (-601.204) (-605.205) * (-602.321) (-609.923) (-603.822) [-602.861] -- 0:00:26
      572500 -- (-600.845) (-602.032) [-604.183] (-600.498) * [-602.681] (-603.917) (-602.731) (-601.953) -- 0:00:26
      573000 -- [-603.457] (-602.965) (-601.553) (-601.980) * (-601.044) (-602.199) (-602.611) [-600.922] -- 0:00:26
      573500 -- (-606.310) [-600.911] (-601.581) (-601.988) * (-601.616) (-600.432) [-603.167] (-600.298) -- 0:00:26
      574000 -- (-603.739) (-602.600) [-602.108] (-604.111) * (-607.473) (-600.693) [-602.477] (-603.831) -- 0:00:25
      574500 -- (-601.582) (-600.730) (-602.514) [-607.657] * [-603.210] (-601.675) (-601.717) (-601.380) -- 0:00:25
      575000 -- (-602.432) (-603.310) [-602.696] (-600.586) * (-604.576) (-602.772) [-600.644] (-602.150) -- 0:00:25

      Average standard deviation of split frequencies: 0.009514

      575500 -- (-602.116) (-605.103) (-601.705) [-601.631] * (-602.044) (-603.825) [-601.317] (-602.160) -- 0:00:25
      576000 -- (-602.121) (-602.107) (-600.622) [-601.922] * (-601.338) [-604.556] (-603.839) (-600.859) -- 0:00:25
      576500 -- [-603.215] (-606.754) (-601.089) (-603.567) * (-603.048) (-604.420) [-601.930] (-601.786) -- 0:00:25
      577000 -- (-602.320) (-602.993) [-601.598] (-603.061) * (-600.318) (-601.873) [-602.618] (-600.332) -- 0:00:25
      577500 -- (-604.607) (-602.200) (-601.852) [-602.921] * [-601.129] (-600.551) (-600.654) (-600.588) -- 0:00:25
      578000 -- (-601.864) [-601.217] (-601.165) (-604.234) * (-601.924) [-600.940] (-600.636) (-600.862) -- 0:00:25
      578500 -- [-601.598] (-604.195) (-601.899) (-602.511) * (-601.007) (-600.844) (-601.221) [-601.536] -- 0:00:25
      579000 -- (-604.529) (-605.192) [-601.009] (-604.377) * (-604.986) [-603.759] (-601.508) (-603.648) -- 0:00:25
      579500 -- (-601.682) [-601.150] (-603.468) (-603.381) * (-603.881) (-606.014) (-600.379) [-600.585] -- 0:00:25
      580000 -- (-604.439) (-601.628) [-603.534] (-600.527) * [-605.321] (-602.502) (-602.057) (-603.649) -- 0:00:25

      Average standard deviation of split frequencies: 0.009691

      580500 -- (-601.621) (-603.126) (-601.376) [-601.599] * (-605.001) (-601.212) [-602.017] (-602.694) -- 0:00:25
      581000 -- (-601.437) [-603.847] (-602.484) (-600.082) * (-605.791) [-602.007] (-605.496) (-601.895) -- 0:00:25
      581500 -- (-602.226) (-604.390) (-602.678) [-600.733] * (-600.967) (-602.659) [-602.168] (-602.261) -- 0:00:25
      582000 -- (-601.431) (-603.780) (-606.778) [-603.594] * (-602.002) (-601.625) (-603.748) [-602.243] -- 0:00:25
      582500 -- (-604.848) (-608.377) (-601.125) [-602.661] * [-600.731] (-605.624) (-601.398) (-601.287) -- 0:00:25
      583000 -- (-602.018) [-600.751] (-602.188) (-601.826) * [-603.044] (-603.142) (-601.304) (-600.227) -- 0:00:25
      583500 -- (-603.142) [-603.215] (-600.868) (-608.454) * (-603.055) [-601.248] (-608.939) (-601.647) -- 0:00:25
      584000 -- (-605.145) (-601.561) [-601.499] (-601.002) * (-600.613) [-600.608] (-602.863) (-604.239) -- 0:00:25
      584500 -- (-603.320) [-602.353] (-604.777) (-602.899) * (-601.001) [-601.595] (-601.129) (-603.946) -- 0:00:25
      585000 -- (-604.582) [-602.277] (-602.053) (-600.860) * (-601.811) (-603.358) [-602.795] (-603.270) -- 0:00:25

      Average standard deviation of split frequencies: 0.009151

      585500 -- (-603.301) (-603.425) [-601.798] (-602.061) * (-599.814) (-603.455) (-602.787) [-601.849] -- 0:00:25
      586000 -- [-602.805] (-604.750) (-601.861) (-602.814) * (-600.106) (-603.016) [-604.602] (-600.988) -- 0:00:25
      586500 -- (-603.074) (-601.410) [-606.100] (-601.653) * (-600.743) (-600.272) [-604.857] (-600.455) -- 0:00:25
      587000 -- (-603.362) (-605.212) (-605.776) [-602.137] * [-601.656] (-602.710) (-601.390) (-605.157) -- 0:00:25
      587500 -- (-601.795) [-603.002] (-606.311) (-601.303) * (-604.229) (-602.307) (-600.845) [-601.784] -- 0:00:25
      588000 -- (-607.342) [-600.263] (-600.879) (-600.808) * (-603.604) (-603.251) (-600.717) [-604.530] -- 0:00:25
      588500 -- [-604.388] (-605.113) (-600.068) (-603.963) * [-600.859] (-603.404) (-600.290) (-600.912) -- 0:00:25
      589000 -- (-601.058) [-602.403] (-602.170) (-604.670) * (-601.134) [-601.906] (-600.428) (-601.967) -- 0:00:25
      589500 -- (-602.005) [-601.494] (-601.672) (-602.703) * (-602.616) [-602.024] (-600.854) (-601.951) -- 0:00:25
      590000 -- (-603.508) (-604.162) [-606.335] (-602.409) * (-600.765) (-603.426) (-601.103) [-602.462] -- 0:00:25

      Average standard deviation of split frequencies: 0.008979

      590500 -- (-603.664) (-607.864) (-603.289) [-600.002] * [-602.238] (-602.064) (-604.585) (-601.749) -- 0:00:24
      591000 -- [-602.761] (-606.160) (-606.715) (-605.694) * (-600.657) (-601.314) (-601.235) [-600.677] -- 0:00:24
      591500 -- (-601.730) [-601.236] (-601.007) (-602.105) * (-603.753) (-601.479) (-604.282) [-600.650] -- 0:00:24
      592000 -- [-603.179] (-603.333) (-602.501) (-605.641) * (-601.162) (-601.544) [-601.091] (-601.418) -- 0:00:24
      592500 -- (-606.322) (-602.091) (-602.758) [-601.454] * (-604.212) (-602.135) (-604.123) [-601.879] -- 0:00:24
      593000 -- (-604.352) (-603.544) (-601.893) [-602.400] * [-603.554] (-602.118) (-605.784) (-607.062) -- 0:00:24
      593500 -- [-603.198] (-605.007) (-602.897) (-600.564) * (-601.585) [-601.389] (-604.881) (-600.414) -- 0:00:24
      594000 -- (-601.958) [-600.569] (-601.835) (-605.369) * (-604.604) [-601.415] (-600.688) (-601.708) -- 0:00:24
      594500 -- (-602.352) (-601.485) [-602.648] (-601.864) * (-605.682) [-601.162] (-601.188) (-601.800) -- 0:00:24
      595000 -- (-601.486) (-602.078) (-600.400) [-601.155] * (-605.153) [-602.774] (-601.546) (-600.624) -- 0:00:24

      Average standard deviation of split frequencies: 0.008700

      595500 -- [-606.339] (-600.714) (-601.215) (-601.104) * (-600.533) (-605.943) (-600.983) [-603.746] -- 0:00:24
      596000 -- (-603.830) (-602.418) [-602.359] (-602.323) * (-602.110) [-602.088] (-604.298) (-602.351) -- 0:00:24
      596500 -- [-604.201] (-601.444) (-601.978) (-602.014) * [-601.658] (-606.225) (-600.970) (-602.165) -- 0:00:24
      597000 -- (-603.735) (-602.545) (-601.931) [-601.932] * (-602.732) (-604.160) [-600.804] (-602.073) -- 0:00:24
      597500 -- [-603.327] (-603.224) (-604.244) (-601.450) * (-600.843) (-601.701) (-600.778) [-601.460] -- 0:00:24
      598000 -- (-601.263) (-610.680) (-604.709) [-602.206] * (-601.207) (-603.586) (-601.438) [-600.713] -- 0:00:24
      598500 -- (-604.925) (-607.885) (-606.647) [-600.257] * [-600.988] (-602.853) (-601.353) (-601.617) -- 0:00:24
      599000 -- (-601.365) [-602.616] (-602.561) (-602.893) * [-600.935] (-601.120) (-601.646) (-601.921) -- 0:00:24
      599500 -- (-602.869) (-602.836) (-601.690) [-602.855] * (-604.041) [-602.144] (-602.419) (-613.735) -- 0:00:24
      600000 -- (-603.226) (-601.064) (-603.596) [-602.832] * (-603.826) [-601.092] (-607.588) (-604.632) -- 0:00:24

      Average standard deviation of split frequencies: 0.008682

      600500 -- (-600.041) (-601.194) [-601.984] (-603.288) * (-604.362) [-600.821] (-601.343) (-604.165) -- 0:00:24
      601000 -- (-600.464) (-600.887) (-601.604) [-608.619] * (-601.237) [-601.480] (-600.633) (-606.275) -- 0:00:24
      601500 -- (-600.374) (-600.791) [-603.048] (-603.020) * [-601.729] (-606.251) (-600.471) (-604.733) -- 0:00:24
      602000 -- (-603.346) (-602.279) [-600.960] (-602.299) * [-604.329] (-604.422) (-601.608) (-601.000) -- 0:00:24
      602500 -- [-600.557] (-602.469) (-600.700) (-603.823) * (-605.375) (-601.562) [-601.356] (-602.955) -- 0:00:24
      603000 -- [-601.659] (-600.912) (-603.065) (-604.871) * [-601.005] (-602.199) (-601.505) (-604.798) -- 0:00:24
      603500 -- (-601.026) (-603.526) [-602.005] (-601.290) * (-602.802) (-603.365) [-601.190] (-602.414) -- 0:00:24
      604000 -- (-603.770) (-603.836) (-601.950) [-604.230] * (-601.116) (-602.163) (-605.089) [-601.794] -- 0:00:24
      604500 -- [-601.111] (-603.099) (-602.865) (-605.221) * (-604.283) [-602.132] (-603.423) (-602.540) -- 0:00:24
      605000 -- (-603.443) (-602.051) (-600.746) [-602.416] * (-600.711) [-601.848] (-602.211) (-602.044) -- 0:00:24

      Average standard deviation of split frequencies: 0.008508

      605500 -- (-603.196) (-602.610) (-600.737) [-600.341] * (-600.179) (-606.537) (-606.354) [-605.269] -- 0:00:24
      606000 -- (-602.628) [-601.315] (-601.685) (-602.748) * (-606.007) [-602.333] (-601.609) (-605.973) -- 0:00:24
      606500 -- (-607.552) (-600.544) [-602.375] (-603.089) * [-602.070] (-601.041) (-602.721) (-604.921) -- 0:00:24
      607000 -- (-600.305) [-603.023] (-601.368) (-605.764) * (-600.951) (-603.001) (-604.222) [-601.871] -- 0:00:23
      607500 -- (-603.129) (-600.395) [-604.814] (-601.350) * (-602.582) [-600.825] (-604.192) (-602.550) -- 0:00:23
      608000 -- (-602.265) [-601.815] (-603.272) (-602.124) * (-601.261) (-604.592) (-605.304) [-601.512] -- 0:00:23
      608500 -- (-602.348) (-602.570) [-602.307] (-601.229) * [-601.287] (-602.266) (-604.510) (-602.462) -- 0:00:23
      609000 -- (-604.783) (-605.399) (-603.405) [-600.724] * (-602.577) (-602.091) [-600.391] (-602.169) -- 0:00:23
      609500 -- (-602.541) [-602.276] (-599.998) (-602.714) * (-606.203) (-600.774) [-600.984] (-601.383) -- 0:00:23
      610000 -- (-609.156) (-602.810) (-602.214) [-603.849] * (-603.519) (-600.418) (-602.962) [-601.327] -- 0:00:23

      Average standard deviation of split frequencies: 0.008684

      610500 -- [-601.530] (-601.812) (-603.409) (-605.021) * (-607.095) (-600.632) (-600.856) [-600.583] -- 0:00:23
      611000 -- (-604.126) (-602.530) [-602.455] (-600.768) * (-612.519) (-600.580) [-601.676] (-603.834) -- 0:00:23
      611500 -- (-600.642) [-600.979] (-603.073) (-603.027) * (-602.527) (-603.236) [-602.159] (-602.904) -- 0:00:23
      612000 -- (-608.866) (-601.104) [-605.029] (-602.982) * [-601.027] (-605.847) (-600.840) (-602.380) -- 0:00:23
      612500 -- (-602.876) (-600.194) (-605.266) [-606.104] * (-603.119) [-601.789] (-600.959) (-603.163) -- 0:00:23
      613000 -- (-602.361) [-599.959] (-605.449) (-604.640) * [-604.317] (-600.093) (-603.591) (-601.524) -- 0:00:23
      613500 -- (-601.936) (-604.655) (-607.086) [-604.513] * (-607.540) [-601.912] (-600.270) (-603.293) -- 0:00:23
      614000 -- (-602.481) [-601.820] (-601.020) (-601.995) * (-604.956) (-600.079) (-601.924) [-601.716] -- 0:00:23
      614500 -- (-602.335) (-601.948) (-608.392) [-600.680] * (-600.787) [-601.146] (-601.343) (-603.946) -- 0:00:23
      615000 -- (-600.503) (-602.172) [-600.265] (-604.460) * (-602.389) (-602.033) [-603.203] (-604.125) -- 0:00:23

      Average standard deviation of split frequencies: 0.008778

      615500 -- (-609.236) (-600.181) [-600.481] (-604.424) * [-601.036] (-601.694) (-601.499) (-601.805) -- 0:00:23
      616000 -- (-602.435) [-602.226] (-600.401) (-603.214) * [-601.315] (-601.444) (-601.155) (-603.125) -- 0:00:23
      616500 -- (-602.052) (-606.616) (-602.488) [-600.927] * (-603.635) [-601.542] (-604.366) (-602.376) -- 0:00:23
      617000 -- (-606.298) (-604.629) (-602.954) [-600.536] * (-601.660) [-601.554] (-601.653) (-601.771) -- 0:00:23
      617500 -- (-608.543) (-603.856) (-602.895) [-604.105] * (-604.246) (-602.271) (-602.333) [-600.845] -- 0:00:23
      618000 -- [-603.035] (-601.889) (-601.763) (-605.297) * (-600.428) (-600.717) [-600.608] (-601.138) -- 0:00:23
      618500 -- (-602.692) [-603.669] (-601.237) (-605.186) * (-602.914) [-603.246] (-601.346) (-610.071) -- 0:00:23
      619000 -- (-607.207) (-603.572) (-601.813) [-603.380] * (-601.513) [-601.282] (-601.311) (-603.373) -- 0:00:23
      619500 -- [-603.256] (-601.626) (-600.044) (-603.967) * (-602.655) (-601.279) (-602.856) [-600.335] -- 0:00:23
      620000 -- [-601.371] (-601.482) (-603.872) (-601.489) * (-603.772) (-601.026) [-603.368] (-605.833) -- 0:00:23

      Average standard deviation of split frequencies: 0.009541

      620500 -- (-600.812) (-601.631) [-603.056] (-601.109) * (-602.168) (-600.197) [-601.016] (-603.138) -- 0:00:23
      621000 -- (-602.126) (-601.610) (-604.720) [-605.096] * [-602.485] (-603.993) (-601.424) (-602.360) -- 0:00:23
      621500 -- (-604.154) (-601.157) (-602.811) [-602.235] * (-602.609) [-601.773] (-601.092) (-604.136) -- 0:00:23
      622000 -- [-602.120] (-602.328) (-600.070) (-601.167) * (-603.237) (-602.684) (-601.324) [-602.242] -- 0:00:23
      622500 -- (-600.701) [-601.753] (-604.447) (-600.454) * (-603.889) (-603.122) (-600.612) [-601.409] -- 0:00:23
      623000 -- [-601.159] (-599.850) (-604.028) (-602.036) * (-602.480) (-601.832) [-602.530] (-601.549) -- 0:00:22
      623500 -- (-601.944) (-602.491) [-604.182] (-607.360) * [-601.943] (-602.585) (-602.868) (-605.215) -- 0:00:22
      624000 -- (-601.321) (-602.808) (-602.570) [-602.680] * (-604.180) (-602.908) (-608.513) [-601.746] -- 0:00:22
      624500 -- (-601.204) [-604.321] (-602.287) (-603.181) * (-606.777) (-600.603) [-607.334] (-600.501) -- 0:00:22
      625000 -- [-601.846] (-602.236) (-601.827) (-602.517) * (-601.879) (-600.943) [-603.625] (-601.898) -- 0:00:22

      Average standard deviation of split frequencies: 0.009084

      625500 -- (-603.327) (-601.063) (-601.514) [-600.797] * (-601.884) [-602.338] (-604.845) (-602.149) -- 0:00:22
      626000 -- (-603.517) (-600.898) (-603.036) [-602.701] * (-601.131) (-601.634) [-602.318] (-604.653) -- 0:00:22
      626500 -- (-602.806) (-601.485) (-603.615) [-605.514] * (-600.860) [-602.347] (-603.120) (-606.694) -- 0:00:22
      627000 -- (-601.111) (-602.848) (-603.149) [-601.995] * (-604.306) (-602.929) (-601.945) [-601.180] -- 0:00:22
      627500 -- (-601.045) (-603.515) (-608.539) [-607.149] * (-601.619) [-600.974] (-604.219) (-601.557) -- 0:00:22
      628000 -- [-600.435] (-601.394) (-606.539) (-602.243) * (-603.895) (-600.561) [-603.814] (-603.551) -- 0:00:22
      628500 -- [-601.248] (-601.101) (-604.359) (-601.751) * (-600.821) (-602.304) (-603.235) [-604.520] -- 0:00:22
      629000 -- [-600.803] (-604.140) (-603.811) (-603.099) * [-602.284] (-600.571) (-602.589) (-602.621) -- 0:00:22
      629500 -- (-602.747) (-604.419) [-600.500] (-603.716) * (-603.673) (-601.145) (-601.909) [-602.044] -- 0:00:22
      630000 -- (-601.758) [-601.781] (-600.498) (-601.665) * (-601.970) (-602.567) [-602.913] (-602.281) -- 0:00:22

      Average standard deviation of split frequencies: 0.008643

      630500 -- (-605.327) (-608.263) (-602.064) [-602.099] * [-604.064] (-601.026) (-600.569) (-601.727) -- 0:00:22
      631000 -- [-600.571] (-606.609) (-602.755) (-600.633) * (-605.476) [-602.264] (-600.604) (-602.487) -- 0:00:22
      631500 -- [-604.842] (-604.441) (-601.296) (-601.661) * (-603.201) (-603.816) [-602.752] (-603.589) -- 0:00:22
      632000 -- (-600.574) [-602.999] (-603.659) (-600.457) * (-607.992) (-601.001) [-601.227] (-604.574) -- 0:00:22
      632500 -- (-600.344) [-602.484] (-603.315) (-604.298) * (-606.602) [-601.252] (-603.589) (-601.370) -- 0:00:22
      633000 -- (-602.060) [-601.114] (-602.765) (-603.640) * (-600.891) (-601.143) [-602.390] (-602.933) -- 0:00:22
      633500 -- (-604.035) (-600.341) [-602.776] (-602.164) * (-600.603) (-602.528) [-600.664] (-602.686) -- 0:00:22
      634000 -- [-601.010] (-606.879) (-603.549) (-604.202) * [-602.128] (-601.495) (-601.359) (-603.020) -- 0:00:22
      634500 -- [-600.065] (-606.161) (-601.968) (-603.435) * (-601.648) (-601.732) [-601.945] (-603.459) -- 0:00:22
      635000 -- (-601.680) (-603.262) [-601.916] (-602.644) * [-604.017] (-602.322) (-605.589) (-605.169) -- 0:00:22

      Average standard deviation of split frequencies: 0.008848

      635500 -- [-607.790] (-601.881) (-602.886) (-602.271) * (-601.609) (-604.713) (-602.010) [-601.621] -- 0:00:22
      636000 -- (-606.423) (-603.455) [-602.384] (-601.388) * [-602.598] (-603.861) (-602.268) (-602.755) -- 0:00:22
      636500 -- (-602.165) (-603.797) [-601.315] (-606.700) * (-602.141) [-601.391] (-601.065) (-602.512) -- 0:00:22
      637000 -- (-601.485) [-601.518] (-603.849) (-603.187) * (-602.025) [-601.247] (-603.975) (-604.070) -- 0:00:22
      637500 -- [-604.020] (-601.176) (-606.188) (-601.336) * (-609.351) (-606.240) [-604.280] (-602.787) -- 0:00:22
      638000 -- (-602.064) [-600.554] (-600.585) (-601.713) * (-602.098) [-603.962] (-603.102) (-604.951) -- 0:00:22
      638500 -- (-601.416) (-604.723) (-604.991) [-601.998] * (-600.928) (-601.339) (-603.969) [-601.814] -- 0:00:22
      639000 -- [-600.919] (-602.412) (-602.471) (-604.414) * (-602.291) (-600.577) [-604.024] (-602.504) -- 0:00:22
      639500 -- [-602.684] (-601.310) (-603.929) (-601.104) * (-603.062) (-602.801) [-602.252] (-601.699) -- 0:00:21
      640000 -- (-602.988) [-601.486] (-602.910) (-603.322) * (-602.089) [-603.213] (-602.670) (-606.943) -- 0:00:21

      Average standard deviation of split frequencies: 0.007849

      640500 -- (-601.955) [-603.295] (-603.461) (-602.759) * (-601.178) (-602.724) [-602.773] (-601.674) -- 0:00:21
      641000 -- [-601.438] (-602.587) (-601.258) (-601.359) * (-602.297) (-602.609) (-603.985) [-602.503] -- 0:00:21
      641500 -- (-606.446) (-609.887) (-600.680) [-600.977] * (-603.284) [-601.653] (-603.071) (-603.825) -- 0:00:21
      642000 -- (-601.636) (-608.690) [-601.310] (-601.268) * (-611.577) [-601.725] (-601.318) (-604.538) -- 0:00:21
      642500 -- (-603.586) (-600.598) (-603.366) [-606.253] * (-604.776) (-604.214) [-605.078] (-603.550) -- 0:00:21
      643000 -- (-600.272) (-600.084) (-602.616) [-603.227] * (-603.145) (-606.454) [-601.579] (-605.074) -- 0:00:21
      643500 -- (-600.020) (-601.700) (-601.000) [-603.287] * (-604.060) (-604.628) (-600.512) [-600.973] -- 0:00:21
      644000 -- (-604.094) (-601.431) [-601.696] (-602.924) * (-603.250) (-604.888) (-602.635) [-600.808] -- 0:00:21
      644500 -- (-600.842) (-601.687) [-602.486] (-602.087) * [-602.887] (-602.378) (-604.806) (-603.342) -- 0:00:21
      645000 -- (-603.147) (-602.905) (-601.355) [-601.112] * (-603.594) (-601.138) (-601.100) [-603.239] -- 0:00:21

      Average standard deviation of split frequencies: 0.007684

      645500 -- (-603.257) (-603.197) (-601.796) [-603.985] * (-604.032) (-600.623) (-601.204) [-600.928] -- 0:00:21
      646000 -- [-605.842] (-602.659) (-601.395) (-605.273) * (-603.856) (-600.909) (-600.958) [-601.546] -- 0:00:21
      646500 -- (-602.464) [-602.632] (-602.770) (-603.681) * [-604.850] (-601.232) (-602.021) (-600.358) -- 0:00:21
      647000 -- (-602.947) (-602.104) (-603.546) [-606.158] * (-602.352) (-603.024) (-602.611) [-601.418] -- 0:00:21
      647500 -- [-602.295] (-601.720) (-602.943) (-602.667) * (-604.174) (-602.351) [-600.868] (-603.512) -- 0:00:21
      648000 -- [-601.595] (-601.197) (-600.925) (-600.662) * (-603.181) (-602.339) [-602.253] (-602.455) -- 0:00:21
      648500 -- [-601.351] (-601.632) (-604.158) (-602.287) * (-601.734) [-602.244] (-602.589) (-602.671) -- 0:00:21
      649000 -- (-601.524) (-600.659) (-602.263) [-601.757] * [-602.762] (-602.635) (-604.640) (-603.396) -- 0:00:21
      649500 -- [-600.815] (-602.167) (-605.080) (-600.992) * (-603.740) (-600.914) (-606.202) [-600.108] -- 0:00:21
      650000 -- (-605.082) [-605.564] (-602.816) (-602.967) * [-601.741] (-602.019) (-603.526) (-605.194) -- 0:00:21

      Average standard deviation of split frequencies: 0.007842

      650500 -- (-605.363) [-601.075] (-601.104) (-601.956) * (-601.526) [-602.713] (-604.941) (-604.723) -- 0:00:21
      651000 -- (-601.004) (-604.674) (-601.078) [-601.930] * (-602.643) (-607.027) [-602.592] (-601.040) -- 0:00:21
      651500 -- (-601.552) [-605.115] (-600.382) (-603.174) * (-603.618) (-606.907) [-601.553] (-600.979) -- 0:00:21
      652000 -- (-604.303) (-602.460) (-602.037) [-601.513] * (-603.273) [-603.657] (-602.592) (-600.880) -- 0:00:21
      652500 -- [-601.116] (-601.429) (-604.775) (-600.823) * [-603.697] (-600.869) (-600.877) (-605.564) -- 0:00:21
      653000 -- (-602.217) (-600.913) [-605.748] (-608.376) * (-601.395) (-603.490) (-601.649) [-601.611] -- 0:00:21
      653500 -- (-601.588) (-600.206) (-601.006) [-603.341] * (-605.360) [-604.556] (-605.482) (-601.685) -- 0:00:21
      654000 -- (-603.911) [-604.081] (-603.590) (-601.776) * (-602.444) [-601.233] (-602.722) (-603.993) -- 0:00:21
      654500 -- (-601.058) (-600.895) (-605.191) [-601.579] * (-606.585) (-600.391) [-603.123] (-601.129) -- 0:00:21
      655000 -- (-601.812) (-604.262) (-604.563) [-601.173] * (-603.267) (-600.959) (-602.124) [-600.826] -- 0:00:21

      Average standard deviation of split frequencies: 0.007860

      655500 -- (-602.760) (-603.698) (-601.711) [-601.249] * (-603.009) (-601.838) (-601.019) [-601.325] -- 0:00:21
      656000 -- [-604.882] (-601.443) (-601.039) (-603.515) * [-602.105] (-599.899) (-601.743) (-600.738) -- 0:00:20
      656500 -- (-601.043) (-603.583) [-600.721] (-602.944) * (-600.792) [-605.848] (-601.417) (-603.228) -- 0:00:20
      657000 -- (-601.349) (-604.205) [-601.880] (-600.852) * (-601.666) [-610.388] (-603.422) (-600.625) -- 0:00:20
      657500 -- [-601.632] (-601.489) (-601.222) (-600.928) * (-607.554) (-603.472) [-601.076] (-602.906) -- 0:00:20
      658000 -- [-602.483] (-602.870) (-601.422) (-602.013) * (-604.191) (-603.811) [-601.099] (-601.765) -- 0:00:20
      658500 -- (-603.009) (-603.534) [-601.431] (-602.641) * (-601.318) (-600.726) (-602.087) [-602.885] -- 0:00:20
      659000 -- [-600.989] (-603.476) (-601.233) (-602.568) * (-600.935) (-602.125) [-603.431] (-602.739) -- 0:00:20
      659500 -- (-601.260) [-600.188] (-600.683) (-604.197) * [-602.110] (-602.000) (-602.714) (-601.857) -- 0:00:20
      660000 -- [-602.545] (-600.319) (-600.434) (-602.724) * (-601.844) (-601.633) [-602.843] (-601.897) -- 0:00:20

      Average standard deviation of split frequencies: 0.007893

      660500 -- (-602.582) (-604.288) (-603.514) [-603.792] * (-607.886) (-602.838) [-600.029] (-603.306) -- 0:00:20
      661000 -- [-601.709] (-601.616) (-602.309) (-600.993) * [-601.655] (-605.219) (-601.183) (-601.290) -- 0:00:20
      661500 -- (-601.433) (-602.194) (-601.241) [-602.940] * (-600.836) (-601.872) [-601.067] (-601.448) -- 0:00:20
      662000 -- (-600.997) (-601.538) [-600.503] (-603.271) * (-600.207) (-600.528) [-601.893] (-603.069) -- 0:00:20
      662500 -- [-601.920] (-605.452) (-602.877) (-604.449) * (-602.096) (-603.238) [-604.500] (-608.778) -- 0:00:20
      663000 -- (-604.780) [-602.460] (-602.323) (-601.943) * (-602.543) (-601.250) [-602.751] (-603.732) -- 0:00:20
      663500 -- (-606.687) (-604.283) [-602.063] (-605.749) * (-600.345) [-601.348] (-602.275) (-603.634) -- 0:00:20
      664000 -- [-606.742] (-602.799) (-606.126) (-603.715) * (-601.883) [-600.965] (-601.570) (-603.079) -- 0:00:20
      664500 -- (-604.795) (-601.090) (-602.757) [-602.538] * [-601.405] (-603.489) (-601.936) (-603.991) -- 0:00:20
      665000 -- [-603.492] (-605.629) (-602.715) (-601.326) * (-601.210) [-601.635] (-600.295) (-601.530) -- 0:00:20

      Average standard deviation of split frequencies: 0.007874

      665500 -- (-601.785) (-601.231) [-600.651] (-603.287) * (-602.538) (-605.954) (-606.925) [-600.836] -- 0:00:20
      666000 -- (-603.298) [-602.497] (-601.096) (-603.026) * (-601.752) (-602.299) [-603.014] (-602.354) -- 0:00:20
      666500 -- (-604.025) (-602.986) [-603.425] (-600.609) * [-601.629] (-602.011) (-603.823) (-602.050) -- 0:00:20
      667000 -- (-602.333) (-607.714) [-606.437] (-600.954) * (-602.133) [-600.580] (-603.063) (-600.691) -- 0:00:20
      667500 -- [-605.281] (-600.825) (-604.205) (-602.741) * [-601.355] (-600.112) (-603.135) (-600.931) -- 0:00:20
      668000 -- (-600.424) (-603.102) [-600.172] (-602.991) * [-599.919] (-600.112) (-603.390) (-600.536) -- 0:00:20
      668500 -- [-601.149] (-605.419) (-601.285) (-601.292) * (-603.453) [-605.143] (-604.897) (-602.567) -- 0:00:20
      669000 -- (-603.065) (-604.512) (-601.331) [-601.656] * (-602.043) (-604.052) (-606.741) [-602.218] -- 0:00:20
      669500 -- (-604.827) (-601.122) (-601.969) [-601.156] * (-601.263) [-601.848] (-602.221) (-601.497) -- 0:00:20
      670000 -- [-600.770] (-601.302) (-602.085) (-601.648) * (-602.073) (-601.931) (-601.760) [-600.449] -- 0:00:20

      Average standard deviation of split frequencies: 0.007688

      670500 -- [-601.186] (-601.446) (-602.803) (-606.833) * (-601.241) [-606.653] (-601.335) (-602.345) -- 0:00:20
      671000 -- (-600.579) (-601.354) [-600.980] (-601.148) * (-601.817) (-605.255) (-601.166) [-602.208] -- 0:00:20
      671500 -- (-604.071) [-603.388] (-605.383) (-606.911) * (-601.614) [-602.776] (-605.291) (-601.088) -- 0:00:20
      672000 -- (-600.979) (-601.494) [-602.533] (-601.540) * (-601.191) [-602.642] (-600.877) (-601.094) -- 0:00:20
      672500 -- (-601.323) [-602.741] (-600.903) (-604.350) * (-601.274) (-603.700) (-601.995) [-599.994] -- 0:00:19
      673000 -- (-601.562) [-604.494] (-600.507) (-604.652) * (-600.957) [-600.277] (-603.108) (-601.179) -- 0:00:19
      673500 -- [-601.892] (-601.799) (-602.835) (-606.219) * (-602.297) [-601.408] (-604.759) (-601.747) -- 0:00:19
      674000 -- [-605.163] (-603.080) (-602.681) (-601.375) * (-604.863) [-601.747] (-602.140) (-605.486) -- 0:00:19
      674500 -- (-602.841) (-602.463) (-600.903) [-601.493] * [-601.545] (-601.481) (-600.904) (-600.891) -- 0:00:19
      675000 -- [-602.405] (-601.877) (-602.312) (-603.509) * (-605.406) (-601.808) [-603.318] (-601.191) -- 0:00:19

      Average standard deviation of split frequencies: 0.008368

      675500 -- [-601.999] (-600.904) (-604.816) (-600.791) * [-602.602] (-601.922) (-601.475) (-600.509) -- 0:00:19
      676000 -- [-602.864] (-601.669) (-603.103) (-601.044) * [-603.248] (-607.903) (-602.473) (-602.340) -- 0:00:19
      676500 -- (-604.571) (-601.085) [-603.712] (-603.306) * (-602.893) [-603.511] (-601.491) (-601.481) -- 0:00:19
      677000 -- (-601.921) [-602.186] (-603.219) (-601.806) * (-605.181) (-600.629) [-601.253] (-601.833) -- 0:00:19
      677500 -- (-601.897) (-603.300) [-603.032] (-600.160) * (-601.681) (-602.555) (-601.834) [-601.018] -- 0:00:19
      678000 -- [-603.705] (-601.317) (-603.769) (-601.137) * [-603.106] (-603.715) (-603.315) (-607.975) -- 0:00:19
      678500 -- [-600.412] (-601.031) (-601.218) (-603.156) * (-603.681) [-604.232] (-605.029) (-607.861) -- 0:00:19
      679000 -- (-601.649) (-602.945) (-601.044) [-601.177] * [-602.649] (-604.851) (-604.954) (-608.223) -- 0:00:19
      679500 -- (-601.219) [-601.027] (-600.557) (-602.424) * (-603.567) [-601.532] (-602.092) (-601.861) -- 0:00:19
      680000 -- (-606.973) [-600.471] (-601.922) (-601.904) * [-602.024] (-600.884) (-601.236) (-607.689) -- 0:00:19

      Average standard deviation of split frequencies: 0.008397

      680500 -- (-604.078) (-602.481) (-601.324) [-601.462] * (-602.614) (-600.647) [-601.501] (-607.567) -- 0:00:19
      681000 -- (-602.571) [-600.930] (-606.960) (-601.245) * (-601.662) (-601.200) (-603.596) [-604.277] -- 0:00:19
      681500 -- (-602.218) [-600.307] (-603.332) (-601.565) * [-604.171] (-602.398) (-604.716) (-601.891) -- 0:00:19
      682000 -- (-603.342) [-601.705] (-600.875) (-602.856) * [-603.406] (-603.078) (-603.940) (-604.958) -- 0:00:19
      682500 -- (-601.942) (-602.868) [-601.988] (-601.828) * (-602.294) (-602.093) (-604.229) [-601.943] -- 0:00:19
      683000 -- (-602.389) (-601.826) [-601.163] (-599.993) * (-603.010) (-601.616) (-603.925) [-602.448] -- 0:00:19
      683500 -- (-601.883) (-601.056) (-601.217) [-602.573] * (-605.729) [-601.372] (-601.714) (-609.059) -- 0:00:18
      684000 -- [-601.422] (-601.274) (-602.490) (-601.682) * (-605.616) [-603.646] (-602.325) (-605.685) -- 0:00:19
      684500 -- (-600.981) (-601.542) [-600.572] (-602.541) * (-606.511) (-603.988) (-603.895) [-601.255] -- 0:00:19
      685000 -- (-600.687) (-603.114) [-601.401] (-602.094) * (-601.460) [-605.419] (-603.975) (-603.061) -- 0:00:19

      Average standard deviation of split frequencies: 0.008031

      685500 -- (-601.551) [-605.337] (-601.577) (-601.232) * [-600.681] (-603.553) (-602.162) (-603.138) -- 0:00:19
      686000 -- (-600.668) (-600.981) [-601.826] (-603.000) * [-604.354] (-601.966) (-600.793) (-601.346) -- 0:00:19
      686500 -- (-601.453) (-602.134) [-600.215] (-603.144) * (-605.935) [-601.200] (-605.396) (-601.919) -- 0:00:19
      687000 -- (-600.758) [-601.844] (-601.103) (-605.200) * [-602.035] (-600.302) (-600.784) (-601.662) -- 0:00:19
      687500 -- (-601.566) (-604.083) [-600.071] (-602.380) * (-602.818) (-600.033) (-600.748) [-602.900] -- 0:00:19
      688000 -- [-601.113] (-608.577) (-600.444) (-602.727) * (-601.877) (-603.772) [-601.912] (-601.370) -- 0:00:19
      688500 -- (-604.975) (-605.930) (-601.068) [-603.026] * (-600.299) (-610.381) [-602.584] (-601.671) -- 0:00:19
      689000 -- (-602.238) (-601.208) (-602.213) [-600.901] * (-602.221) [-603.658] (-602.147) (-600.966) -- 0:00:18
      689500 -- (-603.443) (-603.422) [-608.095] (-600.206) * (-606.468) (-601.757) (-604.787) [-603.251] -- 0:00:18
      690000 -- (-601.293) (-604.682) [-601.821] (-600.272) * (-603.047) [-601.894] (-602.298) (-605.285) -- 0:00:18

      Average standard deviation of split frequencies: 0.007892

      690500 -- (-603.017) [-603.546] (-601.074) (-601.651) * (-603.266) (-604.196) [-602.575] (-602.022) -- 0:00:18
      691000 -- (-603.104) (-603.506) [-602.573] (-602.122) * [-601.237] (-601.773) (-602.678) (-603.170) -- 0:00:18
      691500 -- (-600.700) [-602.122] (-600.816) (-601.616) * [-602.059] (-603.738) (-602.170) (-602.780) -- 0:00:18
      692000 -- [-600.898] (-601.113) (-603.369) (-603.028) * (-604.989) [-604.217] (-602.174) (-600.942) -- 0:00:18
      692500 -- [-601.222] (-605.452) (-603.236) (-601.754) * (-601.998) [-600.200] (-601.494) (-603.389) -- 0:00:18
      693000 -- [-602.049] (-602.911) (-601.437) (-601.910) * [-601.166] (-602.633) (-601.873) (-605.519) -- 0:00:18
      693500 -- [-605.573] (-606.173) (-602.445) (-605.135) * (-601.533) (-604.902) [-602.060] (-604.490) -- 0:00:18
      694000 -- (-600.294) (-602.341) (-602.893) [-600.475] * (-604.727) [-603.785] (-603.120) (-604.765) -- 0:00:18
      694500 -- (-600.854) (-601.123) (-603.306) [-601.243] * (-607.128) (-605.238) (-602.771) [-601.148] -- 0:00:18
      695000 -- (-601.094) (-604.661) [-600.887] (-603.945) * (-605.654) (-606.127) (-602.944) [-601.080] -- 0:00:18

      Average standard deviation of split frequencies: 0.007874

      695500 -- (-600.426) (-601.812) (-602.481) [-601.228] * [-602.767] (-604.116) (-602.207) (-602.146) -- 0:00:18
      696000 -- (-603.055) (-601.014) [-601.318] (-603.073) * [-602.605] (-605.317) (-606.246) (-601.973) -- 0:00:18
      696500 -- (-602.754) [-604.828] (-601.121) (-604.133) * (-601.776) [-601.762] (-605.625) (-607.147) -- 0:00:18
      697000 -- [-602.313] (-600.516) (-602.451) (-602.946) * (-600.707) [-600.988] (-608.212) (-601.833) -- 0:00:18
      697500 -- [-602.670] (-603.189) (-601.373) (-601.931) * (-601.179) [-604.320] (-603.336) (-600.399) -- 0:00:18
      698000 -- (-602.032) (-607.269) [-600.323] (-601.568) * (-607.791) (-603.115) (-602.392) [-600.492] -- 0:00:18
      698500 -- (-601.662) (-608.190) (-601.588) [-601.685] * (-601.095) (-603.958) [-602.426] (-601.204) -- 0:00:18
      699000 -- (-601.519) (-608.381) (-601.651) [-600.482] * (-604.373) [-602.574] (-601.233) (-600.303) -- 0:00:18
      699500 -- (-601.140) (-600.597) [-603.876] (-601.541) * (-603.172) (-601.529) (-601.578) [-607.948] -- 0:00:18
      700000 -- (-601.929) (-600.894) (-604.134) [-601.370] * [-612.079] (-600.992) (-604.696) (-605.529) -- 0:00:18

      Average standard deviation of split frequencies: 0.007695

      700500 -- (-601.580) (-601.826) [-601.433] (-601.645) * (-602.597) [-600.191] (-603.595) (-604.539) -- 0:00:17
      701000 -- (-601.941) (-603.406) (-600.538) [-600.481] * [-601.198] (-602.908) (-604.122) (-602.425) -- 0:00:18
      701500 -- (-600.831) (-601.981) [-601.029] (-601.010) * (-601.804) (-603.083) [-606.753] (-604.259) -- 0:00:18
      702000 -- [-605.893] (-603.615) (-600.902) (-601.044) * (-602.802) [-601.395] (-603.457) (-604.549) -- 0:00:18
      702500 -- (-603.712) [-600.371] (-600.221) (-601.579) * (-602.807) (-607.320) [-603.282] (-602.228) -- 0:00:18
      703000 -- (-606.945) [-600.333] (-601.836) (-601.254) * (-601.860) (-605.405) (-602.804) [-606.072] -- 0:00:18
      703500 -- [-604.330] (-603.393) (-602.168) (-601.128) * (-601.322) (-602.245) (-601.289) [-601.760] -- 0:00:18
      704000 -- (-603.615) (-603.083) [-602.396] (-603.848) * [-600.734] (-604.869) (-602.576) (-611.069) -- 0:00:18
      704500 -- (-604.605) (-604.920) (-601.953) [-603.121] * (-602.153) [-602.235] (-602.388) (-603.094) -- 0:00:18
      705000 -- (-602.034) [-611.699] (-600.478) (-607.119) * [-600.836] (-604.048) (-601.433) (-603.317) -- 0:00:17

      Average standard deviation of split frequencies: 0.007553

      705500 -- [-601.121] (-606.835) (-602.368) (-603.343) * (-603.920) (-603.160) (-601.434) [-601.538] -- 0:00:17
      706000 -- (-603.518) (-605.961) [-603.498] (-606.396) * (-601.398) [-603.269] (-602.923) (-604.322) -- 0:00:17
      706500 -- (-601.606) (-603.785) (-602.769) [-602.573] * (-605.209) (-601.724) [-601.647] (-601.451) -- 0:00:17
      707000 -- (-600.289) (-602.424) [-601.775] (-607.614) * (-602.937) [-600.339] (-607.550) (-600.932) -- 0:00:17
      707500 -- (-600.745) (-602.455) [-603.258] (-607.628) * [-600.208] (-603.783) (-603.832) (-601.204) -- 0:00:17
      708000 -- (-601.156) [-601.232] (-605.042) (-610.797) * [-603.280] (-604.022) (-600.654) (-606.290) -- 0:00:17
      708500 -- (-600.725) [-601.379] (-603.416) (-608.393) * (-601.841) [-608.063] (-601.229) (-604.806) -- 0:00:17
      709000 -- (-607.327) (-603.938) [-600.087] (-602.761) * (-602.459) (-600.109) (-603.031) [-600.852] -- 0:00:17
      709500 -- (-605.051) (-603.675) (-603.911) [-603.508] * (-603.815) (-605.971) [-604.989] (-600.790) -- 0:00:17
      710000 -- (-605.296) [-600.823] (-601.737) (-603.766) * [-601.836] (-601.467) (-606.814) (-601.701) -- 0:00:17

      Average standard deviation of split frequencies: 0.007628

      710500 -- (-604.265) (-605.462) [-602.838] (-605.587) * (-602.513) [-601.140] (-602.653) (-600.397) -- 0:00:17
      711000 -- [-601.654] (-603.591) (-601.683) (-603.568) * (-601.248) [-605.064] (-600.618) (-604.263) -- 0:00:17
      711500 -- [-603.045] (-601.664) (-601.281) (-603.439) * (-601.084) (-601.842) [-600.688] (-604.648) -- 0:00:17
      712000 -- (-601.623) [-601.151] (-602.248) (-605.426) * (-601.494) [-601.902] (-600.660) (-603.633) -- 0:00:17
      712500 -- (-607.281) [-601.650] (-602.436) (-600.110) * (-601.978) (-602.206) [-601.137] (-607.963) -- 0:00:17
      713000 -- (-601.257) (-603.848) (-600.461) [-603.230] * (-600.912) [-601.837] (-602.261) (-603.892) -- 0:00:17
      713500 -- [-601.294] (-603.335) (-606.799) (-603.082) * [-600.489] (-604.516) (-605.016) (-602.700) -- 0:00:17
      714000 -- (-601.893) (-603.130) (-602.264) [-601.211] * (-602.185) (-601.296) (-601.028) [-600.074] -- 0:00:17
      714500 -- (-601.701) (-604.766) [-602.533] (-600.742) * (-602.497) (-606.433) [-602.690] (-601.393) -- 0:00:17
      715000 -- [-600.694] (-601.669) (-603.081) (-604.977) * [-603.145] (-601.516) (-601.925) (-601.827) -- 0:00:17

      Average standard deviation of split frequencies: 0.007818

      715500 -- (-600.791) (-601.437) (-605.682) [-601.659] * (-603.155) [-602.158] (-601.224) (-601.441) -- 0:00:17
      716000 -- (-601.518) [-601.312] (-601.564) (-603.055) * (-601.946) (-607.492) (-602.255) [-600.507] -- 0:00:17
      716500 -- (-601.931) (-602.378) [-604.663] (-603.294) * [-600.982] (-602.398) (-604.390) (-602.838) -- 0:00:17
      717000 -- (-603.543) (-604.196) (-603.668) [-600.457] * [-601.804] (-605.027) (-603.845) (-600.967) -- 0:00:16
      717500 -- (-601.899) (-604.950) [-601.885] (-602.982) * (-603.764) (-604.765) [-600.513] (-604.935) -- 0:00:16
      718000 -- [-601.572] (-604.351) (-601.812) (-600.860) * (-601.564) (-604.628) [-601.320] (-606.350) -- 0:00:17
      718500 -- (-600.768) (-600.666) (-600.928) [-602.148] * [-604.083] (-600.912) (-604.193) (-601.314) -- 0:00:17
      719000 -- (-600.414) [-603.012] (-600.630) (-601.382) * (-605.034) (-600.949) [-602.232] (-602.545) -- 0:00:17
      719500 -- (-601.702) [-602.867] (-604.055) (-602.807) * [-601.092] (-600.587) (-605.936) (-602.795) -- 0:00:17
      720000 -- (-601.135) (-604.465) [-601.362] (-600.915) * (-602.501) (-604.464) [-603.188] (-600.789) -- 0:00:17

      Average standard deviation of split frequencies: 0.007972

      720500 -- (-601.616) [-605.297] (-603.912) (-601.443) * (-601.722) [-602.223] (-602.681) (-601.959) -- 0:00:17
      721000 -- (-603.089) (-604.922) [-601.378] (-601.822) * (-602.376) [-601.785] (-604.117) (-604.276) -- 0:00:17
      721500 -- (-601.132) (-606.463) (-601.848) [-604.135] * (-603.803) (-604.422) (-603.738) [-601.014] -- 0:00:16
      722000 -- (-603.168) (-600.459) (-601.535) [-603.676] * (-602.029) [-602.762] (-605.255) (-604.518) -- 0:00:16
      722500 -- (-603.157) (-602.033) (-601.900) [-602.595] * (-603.319) (-601.059) (-601.922) [-604.705] -- 0:00:16
      723000 -- (-602.172) (-601.439) [-602.028] (-608.018) * [-602.802] (-600.684) (-601.830) (-602.519) -- 0:00:16
      723500 -- (-601.036) (-601.688) (-602.211) [-604.561] * (-604.326) (-602.909) (-602.227) [-601.126] -- 0:00:16
      724000 -- [-601.635] (-604.160) (-608.380) (-602.838) * (-602.780) (-601.539) (-602.630) [-601.457] -- 0:00:16
      724500 -- (-603.820) (-603.940) [-603.013] (-602.751) * (-602.140) (-600.944) [-602.340] (-603.832) -- 0:00:16
      725000 -- [-602.354] (-602.540) (-601.048) (-605.285) * (-601.096) [-604.031] (-601.823) (-603.525) -- 0:00:16

      Average standard deviation of split frequencies: 0.008522

      725500 -- (-601.026) (-601.647) (-602.389) [-604.187] * (-605.033) (-603.603) (-602.575) [-601.805] -- 0:00:16
      726000 -- [-601.622] (-602.245) (-601.827) (-600.822) * (-600.478) [-603.132] (-604.048) (-602.340) -- 0:00:16
      726500 -- (-603.060) (-601.322) (-604.854) [-599.898] * (-604.387) (-604.669) (-602.369) [-603.853] -- 0:00:16
      727000 -- (-601.124) (-600.816) [-600.530] (-599.938) * (-600.505) [-601.152] (-603.108) (-605.757) -- 0:00:16
      727500 -- [-603.059] (-604.255) (-600.863) (-600.507) * (-600.342) [-602.021] (-600.887) (-604.678) -- 0:00:16
      728000 -- (-602.161) (-605.825) [-602.591] (-603.493) * [-601.191] (-603.920) (-604.257) (-603.939) -- 0:00:16
      728500 -- (-601.926) (-601.298) [-601.343] (-603.955) * (-600.145) (-602.531) [-600.766] (-603.708) -- 0:00:16
      729000 -- (-602.081) (-606.263) [-600.838] (-601.184) * [-600.515] (-604.576) (-602.780) (-608.872) -- 0:00:16
      729500 -- (-604.177) (-605.833) [-603.635] (-605.129) * (-601.915) [-601.400] (-601.462) (-604.827) -- 0:00:16
      730000 -- (-607.110) [-603.138] (-601.790) (-602.196) * (-603.138) (-600.228) [-601.400] (-601.473) -- 0:00:16

      Average standard deviation of split frequencies: 0.008508

      730500 -- (-601.479) (-605.672) (-602.832) [-603.826] * [-601.879] (-607.039) (-602.931) (-604.292) -- 0:00:16
      731000 -- (-601.388) (-601.362) [-600.383] (-602.004) * (-601.887) [-602.559] (-603.447) (-601.580) -- 0:00:16
      731500 -- [-600.252] (-601.192) (-601.137) (-601.924) * [-601.183] (-600.767) (-601.958) (-601.023) -- 0:00:16
      732000 -- [-601.427] (-602.613) (-605.061) (-600.738) * (-603.751) (-604.809) [-602.512] (-600.989) -- 0:00:16
      732500 -- (-600.167) [-600.122] (-602.513) (-600.818) * (-603.347) (-605.122) (-600.999) [-602.642] -- 0:00:16
      733000 -- [-602.655] (-603.499) (-610.499) (-601.218) * (-602.112) (-601.010) (-601.750) [-602.469] -- 0:00:16
      733500 -- (-607.554) [-604.233] (-611.207) (-601.489) * (-601.601) (-599.981) [-601.552] (-601.508) -- 0:00:15
      734000 -- (-605.357) (-601.763) (-600.693) [-601.614] * [-600.758] (-606.540) (-602.738) (-601.899) -- 0:00:15
      734500 -- (-604.579) (-604.061) [-602.854] (-603.674) * [-602.624] (-601.094) (-601.128) (-600.602) -- 0:00:16
      735000 -- (-605.765) [-600.642] (-600.867) (-600.711) * [-600.473] (-605.014) (-602.099) (-603.845) -- 0:00:16

      Average standard deviation of split frequencies: 0.008447

      735500 -- (-601.139) (-600.740) [-607.341] (-600.331) * (-601.608) (-601.390) (-602.563) [-606.776] -- 0:00:16
      736000 -- (-601.037) [-606.669] (-602.520) (-604.022) * (-605.622) [-606.028] (-605.686) (-607.400) -- 0:00:16
      736500 -- (-600.426) (-603.026) (-601.176) [-601.096] * [-601.245] (-604.250) (-602.816) (-601.944) -- 0:00:16
      737000 -- (-605.742) (-602.369) [-601.082] (-600.873) * (-601.722) [-601.168] (-601.454) (-604.607) -- 0:00:16
      737500 -- (-601.642) [-601.285] (-601.251) (-602.974) * [-603.664] (-604.564) (-602.278) (-605.386) -- 0:00:16
      738000 -- [-601.794] (-602.786) (-601.871) (-602.588) * (-602.805) (-603.034) (-602.065) [-605.373] -- 0:00:15
      738500 -- (-604.007) (-600.743) [-602.060] (-608.406) * (-600.750) (-603.070) (-601.194) [-605.228] -- 0:00:15
      739000 -- (-601.979) (-601.278) [-600.710] (-601.892) * [-601.110] (-603.377) (-601.773) (-609.369) -- 0:00:15
      739500 -- (-601.891) (-602.907) [-602.266] (-603.775) * (-601.702) [-601.278] (-605.514) (-612.591) -- 0:00:15
      740000 -- [-602.084] (-601.143) (-602.594) (-604.894) * (-602.561) (-601.417) (-607.834) [-601.931] -- 0:00:15

      Average standard deviation of split frequencies: 0.008672

      740500 -- (-602.574) (-601.590) (-604.326) [-600.519] * [-602.449] (-602.023) (-603.008) (-601.878) -- 0:00:15
      741000 -- (-601.515) (-603.494) (-602.237) [-601.921] * [-602.173] (-600.685) (-601.716) (-600.505) -- 0:00:15
      741500 -- (-601.487) (-601.446) [-603.485] (-603.839) * (-604.858) (-605.365) [-602.701] (-603.768) -- 0:00:15
      742000 -- [-605.844] (-600.677) (-601.734) (-601.905) * (-603.747) [-601.448] (-602.240) (-602.367) -- 0:00:15
      742500 -- (-604.442) [-602.332] (-601.369) (-603.284) * (-601.101) (-600.977) [-603.736] (-600.598) -- 0:00:15
      743000 -- [-600.486] (-601.250) (-600.319) (-601.271) * (-604.049) [-601.197] (-601.004) (-600.533) -- 0:00:15
      743500 -- (-601.993) (-601.814) (-600.783) [-600.833] * (-602.892) (-602.387) [-601.854] (-602.287) -- 0:00:15
      744000 -- (-601.216) (-606.661) [-600.829] (-602.034) * (-601.987) [-600.629] (-604.895) (-602.215) -- 0:00:15
      744500 -- [-600.597] (-605.552) (-603.429) (-601.273) * (-600.866) (-601.613) [-606.331] (-601.514) -- 0:00:15
      745000 -- (-602.443) (-601.558) (-604.416) [-601.336] * (-601.464) (-601.699) (-601.057) [-601.891] -- 0:00:15

      Average standard deviation of split frequencies: 0.008610

      745500 -- (-602.064) [-600.996] (-604.865) (-601.676) * [-602.725] (-601.532) (-601.013) (-602.648) -- 0:00:15
      746000 -- (-602.268) (-602.079) (-602.316) [-600.607] * (-603.672) (-601.896) (-601.184) [-603.079] -- 0:00:15
      746500 -- [-601.137] (-606.427) (-602.429) (-600.546) * (-604.633) [-600.059] (-602.720) (-602.950) -- 0:00:15
      747000 -- (-601.319) [-601.272] (-601.991) (-601.016) * [-603.277] (-600.415) (-602.779) (-600.890) -- 0:00:15
      747500 -- (-600.639) (-603.266) (-601.568) [-600.867] * (-603.148) (-601.476) (-602.452) [-601.035] -- 0:00:15
      748000 -- [-603.005] (-602.168) (-601.477) (-604.678) * [-600.663] (-611.567) (-601.272) (-603.727) -- 0:00:15
      748500 -- (-603.754) (-600.915) [-601.213] (-608.638) * (-605.464) (-605.410) (-601.894) [-604.998] -- 0:00:15
      749000 -- [-604.255] (-606.779) (-603.683) (-603.239) * (-602.109) (-604.339) [-601.394] (-601.780) -- 0:00:15
      749500 -- (-600.579) (-602.000) [-601.924] (-601.321) * (-604.347) [-602.631] (-602.888) (-600.959) -- 0:00:15
      750000 -- (-600.820) [-601.070] (-600.265) (-601.938) * (-602.016) [-601.715] (-603.721) (-600.982) -- 0:00:15

      Average standard deviation of split frequencies: 0.008275

      750500 -- [-604.260] (-604.493) (-602.476) (-600.291) * (-601.250) [-602.777] (-600.525) (-601.223) -- 0:00:14
      751000 -- (-602.093) [-603.822] (-603.209) (-602.158) * (-600.221) [-601.000] (-601.564) (-603.327) -- 0:00:14
      751500 -- (-603.543) (-603.291) (-600.027) [-601.187] * [-601.147] (-601.177) (-602.628) (-603.274) -- 0:00:15
      752000 -- [-601.352] (-601.059) (-607.180) (-604.287) * (-603.463) [-601.716] (-601.689) (-602.042) -- 0:00:15
      752500 -- (-602.998) (-600.690) [-601.480] (-602.533) * (-604.856) (-601.734) [-601.791] (-602.361) -- 0:00:15
      753000 -- (-600.858) (-600.493) (-601.025) [-601.589] * (-606.334) [-604.119] (-602.105) (-604.532) -- 0:00:15
      753500 -- [-600.628] (-605.088) (-600.634) (-604.173) * (-605.005) (-601.639) [-602.462] (-604.964) -- 0:00:15
      754000 -- [-600.689] (-601.690) (-601.011) (-603.314) * (-601.319) (-601.145) [-602.187] (-603.357) -- 0:00:15
      754500 -- (-602.041) (-601.056) [-601.495] (-600.811) * (-605.050) (-601.343) [-602.278] (-602.653) -- 0:00:14
      755000 -- (-600.476) [-601.547] (-601.495) (-601.664) * (-602.798) (-602.859) (-602.657) [-602.417] -- 0:00:14

      Average standard deviation of split frequencies: 0.008979

      755500 -- (-603.516) (-601.161) (-602.720) [-602.249] * (-600.999) [-601.923] (-604.386) (-602.026) -- 0:00:14
      756000 -- (-603.924) (-601.712) [-601.509] (-600.938) * (-603.164) (-605.510) [-602.041] (-604.069) -- 0:00:14
      756500 -- (-605.088) (