--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:20:26 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/sodC/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -978.37          -982.21
2       -978.32          -981.88
--------------------------------------
TOTAL     -978.34          -982.06
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.883088    0.088960    0.332389    1.450201    0.850294   1266.61   1310.46    1.000
r(A<->C){all}   0.165139    0.019800    0.000070    0.450294    0.127356    145.06    148.87    1.001
r(A<->G){all}   0.162869    0.019262    0.000104    0.444349    0.128510    187.16    260.24    1.000
r(A<->T){all}   0.166939    0.021235    0.000006    0.468323    0.124780    142.27    193.55    1.003
r(C<->G){all}   0.176239    0.022359    0.000019    0.481182    0.135307    210.88    230.67    1.006
r(C<->T){all}   0.168691    0.019481    0.000037    0.452433    0.132259    232.97    257.73    1.000
r(G<->T){all}   0.160124    0.019889    0.000086    0.451582    0.122541    270.32    275.16    1.000
pi(A){all}      0.205712    0.000222    0.175887    0.234366    0.205620   1328.57   1357.39    1.000
pi(C){all}      0.328606    0.000299    0.295388    0.361722    0.328137   1183.03   1275.15    1.000
pi(G){all}      0.287117    0.000276    0.252763    0.317856    0.287100   1265.03   1314.02    1.000
pi(T){all}      0.178565    0.000195    0.149597    0.204997    0.178471   1130.25   1219.72    1.001
alpha{1,2}      0.419459    0.227917    0.000122    1.395508    0.240716   1264.03   1272.21    1.000
alpha{3}        0.449759    0.224121    0.000254    1.400428    0.295382    973.32    994.98    1.000
pinvar{all}     0.997805    0.000007    0.992905    0.999999    0.998662   1344.74   1349.05    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-945.448788
Model 2: PositiveSelection	-945.448816
Model 0: one-ratio	-945.448834
Model 7: beta	-945.448788
Model 8: beta&w>1	-945.448788


Model 0 vs 1	9.1999999995096E-5

Model 2 vs 1	5.599999985861359E-5

Model 8 vs 7	0.0
>C1
MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
>C2
MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
>C3
MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
>C4
MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
>C5
MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
>C6
MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=240 

C1              MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
C2              MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
C3              MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
C4              MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
C5              MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
C6              MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
                **************************************************

C1              TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
C2              TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
C3              TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
C4              TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
C5              TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
C6              TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
                **************************************************

C1              ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
C2              ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
C3              ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
C4              ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
C5              ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
C6              ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
                **************************************************

C1              TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
C2              TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
C3              TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
C4              TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
C5              TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
C6              TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
                **************************************************

C1              FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
C2              FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
C3              FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
C4              FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
C5              FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
C6              FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
                ****************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7200]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [7200]--->[7200]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.481 Mb, Max= 30.780 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
C2              MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
C3              MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
C4              MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
C5              MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
C6              MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
                **************************************************

C1              TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
C2              TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
C3              TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
C4              TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
C5              TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
C6              TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
                **************************************************

C1              ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
C2              ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
C3              ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
C4              ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
C5              ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
C6              ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
                **************************************************

C1              TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
C2              TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
C3              TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
C4              TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
C5              TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
C6              TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
                **************************************************

C1              FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
C2              FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
C3              FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
C4              FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
C5              FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
C6              FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
                ****************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC
C2              ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC
C3              ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC
C4              ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC
C5              ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC
C6              ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC
                **************************************************

C1              GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA
C2              GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA
C3              GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA
C4              GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA
C5              GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA
C6              GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA
                **************************************************

C1              TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG
C2              TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG
C3              TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG
C4              TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG
C5              TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG
C6              TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG
                **************************************************

C1              ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT
C2              ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT
C3              ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT
C4              ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT
C5              ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT
C6              ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT
                **************************************************

C1              GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG
C2              GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG
C3              GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG
C4              GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG
C5              GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG
C6              GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG
                **************************************************

C1              TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC
C2              TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC
C3              TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC
C4              TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC
C5              TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC
C6              TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC
                **************************************************

C1              GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT
C2              GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT
C3              GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT
C4              GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT
C5              GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT
C6              GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT
                **************************************************

C1              TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG
C2              TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG
C3              TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG
C4              TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG
C5              TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG
C6              TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG
                **************************************************

C1              CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC
C2              CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC
C3              CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC
C4              CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC
C5              CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC
C6              CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC
                **************************************************

C1              ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA
C2              ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA
C3              ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA
C4              ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA
C5              ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA
C6              ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA
                **************************************************

C1              CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC
C2              CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC
C3              CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC
C4              CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC
C5              CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC
C6              CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC
                **************************************************

C1              TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC
C2              TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC
C3              TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC
C4              TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC
C5              TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC
C6              TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC
                **************************************************

C1              TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG
C2              TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG
C3              TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG
C4              TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG
C5              TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG
C6              TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG
                **************************************************

C1              TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT
C2              TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT
C3              TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT
C4              TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT
C5              TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT
C6              TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT
                **************************************************

C1              GCGGTGTCATCGGCGCCGAC
C2              GCGGTGTCATCGGCGCCGAC
C3              GCGGTGTCATCGGCGCCGAC
C4              GCGGTGTCATCGGCGCCGAC
C5              GCGGTGTCATCGGCGCCGAC
C6              GCGGTGTCATCGGCGCCGAC
                ********************



>C1
ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC
GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA
TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG
ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT
GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG
TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC
GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT
TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG
CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC
ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA
CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC
TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC
TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG
TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT
GCGGTGTCATCGGCGCCGAC
>C2
ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC
GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA
TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG
ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT
GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG
TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC
GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT
TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG
CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC
ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA
CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC
TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC
TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG
TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT
GCGGTGTCATCGGCGCCGAC
>C3
ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC
GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA
TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG
ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT
GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG
TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC
GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT
TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG
CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC
ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA
CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC
TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC
TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG
TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT
GCGGTGTCATCGGCGCCGAC
>C4
ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC
GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA
TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG
ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT
GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG
TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC
GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT
TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG
CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC
ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA
CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC
TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC
TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG
TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT
GCGGTGTCATCGGCGCCGAC
>C5
ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC
GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA
TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG
ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT
GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG
TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC
GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT
TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG
CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC
ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA
CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC
TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC
TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG
TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT
GCGGTGTCATCGGCGCCGAC
>C6
ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC
GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA
TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG
ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT
GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG
TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC
GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT
TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG
CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC
ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA
CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC
TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC
TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG
TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT
GCGGTGTCATCGGCGCCGAC
>C1
MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
>C2
MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
>C3
MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
>C4
MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
>C5
MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
>C6
MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 720 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579789146
      Setting output file names to "/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 887554597
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0962090388
      Seed = 811946194
      Swapseed = 1579789146
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1611.394522 -- -24.965149
         Chain 2 -- -1611.394522 -- -24.965149
         Chain 3 -- -1611.394522 -- -24.965149
         Chain 4 -- -1611.394276 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1611.394276 -- -24.965149
         Chain 2 -- -1611.394430 -- -24.965149
         Chain 3 -- -1611.394522 -- -24.965149
         Chain 4 -- -1611.394430 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1611.395] (-1611.395) (-1611.395) (-1611.394) * [-1611.394] (-1611.394) (-1611.395) (-1611.394) 
        500 -- (-997.798) (-997.125) (-995.067) [-995.318] * (-986.077) [-1001.544] (-995.274) (-998.195) -- 0:00:00
       1000 -- (-989.373) (-990.115) [-984.438] (-986.218) * [-988.233] (-997.441) (-991.428) (-992.398) -- 0:00:00
       1500 -- (-982.518) (-992.732) [-990.023] (-993.298) * (-982.968) (-982.363) [-986.965] (-991.379) -- 0:00:00
       2000 -- (-989.192) (-990.866) [-991.189] (-988.405) * [-984.736] (-988.320) (-991.395) (-990.963) -- 0:00:00
       2500 -- (-987.753) [-985.158] (-992.186) (-986.567) * (-987.848) [-987.488] (-988.740) (-993.044) -- 0:00:00
       3000 -- (-985.121) (-990.390) (-985.343) [-989.807] * (-986.159) [-991.207] (-983.732) (-988.085) -- 0:00:00
       3500 -- [-988.645] (-994.446) (-988.019) (-987.743) * (-993.734) (-993.242) [-985.517] (-993.648) -- 0:00:00
       4000 -- [-988.020] (-990.307) (-989.042) (-989.829) * (-984.248) (-988.597) [-984.338] (-990.388) -- 0:00:00
       4500 -- (-989.274) (-985.519) [-992.290] (-983.664) * (-987.949) (-994.408) (-982.510) [-983.194] -- 0:00:00
       5000 -- (-987.962) [-981.224] (-989.521) (-984.307) * (-992.606) [-988.888] (-983.701) (-989.303) -- 0:00:00

      Average standard deviation of split frequencies: 0.081983

       5500 -- [-997.414] (-986.950) (-983.355) (-994.556) * (-984.966) [-985.731] (-988.640) (-990.419) -- 0:00:00
       6000 -- (-985.788) (-989.308) [-983.714] (-991.471) * (-985.641) (-992.096) (-983.884) [-989.812] -- 0:00:00
       6500 -- [-985.541] (-991.652) (-992.467) (-984.973) * (-994.106) [-987.864] (-989.232) (-989.484) -- 0:00:00
       7000 -- (-988.967) (-993.582) [-988.116] (-985.644) * (-990.554) (-988.244) [-987.784] (-984.994) -- 0:00:00
       7500 -- (-991.259) (-994.237) [-987.676] (-994.123) * [-987.717] (-986.705) (-988.045) (-993.443) -- 0:00:00
       8000 -- (-986.669) (-986.783) [-992.263] (-992.859) * (-989.090) [-986.162] (-995.852) (-986.734) -- 0:00:00
       8500 -- [-990.171] (-989.122) (-992.000) (-991.918) * [-986.345] (-992.343) (-990.077) (-986.781) -- 0:00:00
       9000 -- (-986.594) (-989.662) (-987.897) [-984.124] * [-990.668] (-988.796) (-984.869) (-998.554) -- 0:00:00
       9500 -- (-991.378) (-985.410) [-985.453] (-984.980) * (-989.715) (-994.438) [-987.903] (-987.574) -- 0:00:00
      10000 -- (-986.825) (-999.703) [-986.839] (-987.424) * (-991.813) [-986.362] (-987.862) (-987.866) -- 0:01:39

      Average standard deviation of split frequencies: 0.061872

      10500 -- (-987.771) (-990.962) (-983.011) [-987.360] * (-987.828) (-989.354) [-991.309] (-984.683) -- 0:01:34
      11000 -- (-986.294) (-986.624) (-986.067) [-983.121] * [-983.133] (-983.953) (-997.019) (-986.883) -- 0:01:29
      11500 -- (-985.086) [-986.314] (-992.063) (-994.669) * [-981.961] (-988.535) (-988.502) (-990.459) -- 0:01:25
      12000 -- (-990.144) (-986.922) [-987.832] (-986.755) * (-987.993) (-989.695) [-981.827] (-987.496) -- 0:01:22
      12500 -- (-994.713) [-984.399] (-995.116) (-981.295) * (-986.654) (-985.586) [-984.654] (-985.373) -- 0:01:19
      13000 -- (-986.309) [-989.819] (-987.296) (-989.208) * (-994.170) (-986.422) (-998.560) [-991.559] -- 0:01:15
      13500 -- (-987.537) (-989.676) [-985.652] (-991.005) * (-989.510) [-984.516] (-986.262) (-984.905) -- 0:01:13
      14000 -- (-986.330) (-986.070) [-983.131] (-991.441) * (-989.685) (-996.874) [-996.730] (-990.238) -- 0:01:10
      14500 -- (-987.587) (-990.262) (-988.599) [-987.573] * (-984.108) [-987.774] (-986.345) (-994.138) -- 0:01:07
      15000 -- (-993.977) [-989.350] (-989.384) (-982.878) * (-991.001) (-991.239) [-984.178] (-993.390) -- 0:01:05

      Average standard deviation of split frequencies: 0.064538

      15500 -- (-985.172) [-987.207] (-985.423) (-986.215) * (-990.166) [-986.998] (-983.680) (-994.602) -- 0:01:03
      16000 -- (-986.030) (-985.044) (-985.573) [-990.549] * [-987.711] (-991.211) (-992.689) (-990.082) -- 0:01:01
      16500 -- (-990.214) (-985.983) [-986.218] (-986.883) * (-989.820) [-994.512] (-990.405) (-991.576) -- 0:00:59
      17000 -- [-986.783] (-989.752) (-990.756) (-988.227) * (-987.577) [-984.033] (-989.415) (-989.567) -- 0:00:57
      17500 -- [-989.410] (-990.691) (-993.673) (-990.650) * (-989.243) (-990.992) (-985.191) [-994.223] -- 0:00:56
      18000 -- [-983.776] (-987.236) (-990.989) (-981.764) * [-985.023] (-993.745) (-987.519) (-1001.739) -- 0:00:54
      18500 -- (-995.896) (-992.724) [-983.168] (-987.720) * [-979.865] (-990.561) (-986.947) (-990.004) -- 0:00:53
      19000 -- [-990.514] (-992.279) (-997.097) (-998.446) * (-988.213) [-988.268] (-990.450) (-997.256) -- 0:00:51
      19500 -- (-993.467) (-992.021) [-989.414] (-987.248) * (-988.436) [-993.932] (-1004.883) (-990.661) -- 0:00:50
      20000 -- (-990.224) [-987.845] (-989.469) (-988.796) * (-987.216) [-987.580] (-989.348) (-988.363) -- 0:00:49

      Average standard deviation of split frequencies: 0.046820

      20500 -- [-983.212] (-979.282) (-993.187) (-988.474) * (-987.783) (-987.601) [-988.849] (-995.443) -- 0:00:47
      21000 -- [-985.073] (-988.069) (-986.482) (-993.408) * (-988.516) (-986.886) (-991.990) [-991.284] -- 0:00:46
      21500 -- (-990.828) [-991.176] (-989.572) (-987.208) * [-985.517] (-995.614) (-1004.271) (-985.214) -- 0:00:45
      22000 -- (-983.746) (-981.393) (-988.710) [-982.837] * [-986.218] (-988.036) (-987.200) (-993.914) -- 0:00:44
      22500 -- (-985.815) (-990.190) (-989.902) [-990.212] * [-988.666] (-991.391) (-992.663) (-983.480) -- 0:00:43
      23000 -- (-993.612) (-985.060) [-986.086] (-988.911) * (-988.184) [-992.066] (-982.385) (-987.732) -- 0:00:42
      23500 -- [-986.057] (-989.015) (-991.229) (-990.794) * [-992.362] (-983.903) (-982.861) (-989.079) -- 0:00:41
      24000 -- [-992.512] (-988.028) (-993.152) (-989.801) * (-992.898) (-985.096) (-981.651) [-994.066] -- 0:00:40
      24500 -- (-991.394) (-989.105) [-992.788] (-984.538) * [-991.004] (-990.950) (-980.737) (-985.978) -- 0:00:39
      25000 -- [-983.330] (-988.738) (-989.234) (-993.647) * (-989.546) (-983.433) (-978.438) [-989.407] -- 0:00:39

      Average standard deviation of split frequencies: 0.044032

      25500 -- (-983.932) (-988.360) [-987.009] (-992.687) * (-985.192) (-990.334) (-980.454) [-988.353] -- 0:01:16
      26000 -- (-993.682) (-984.705) (-995.833) [-989.217] * (-989.076) (-991.959) (-978.570) [-984.412] -- 0:01:14
      26500 -- [-988.682] (-982.015) (-992.855) (-978.558) * (-990.432) [-983.236] (-978.234) (-985.990) -- 0:01:13
      27000 -- (-991.139) (-989.248) (-983.327) [-980.288] * (-989.505) (-997.750) [-978.071] (-990.946) -- 0:01:12
      27500 -- (-992.134) (-993.628) (-985.645) [-977.551] * (-1007.667) [-984.889] (-980.459) (-989.705) -- 0:01:10
      28000 -- (-984.982) (-985.905) [-995.528] (-979.313) * (-994.857) (-980.289) (-979.655) [-984.395] -- 0:01:09
      28500 -- (-992.305) (-990.346) [-986.355] (-981.786) * [-978.814] (-982.148) (-980.665) (-1001.177) -- 0:01:08
      29000 -- (-992.571) (-991.683) (-988.117) [-983.695] * (-983.658) (-980.366) (-980.425) [-989.897] -- 0:01:06
      29500 -- (-983.991) [-991.236] (-987.445) (-979.811) * (-980.363) [-984.318] (-980.496) (-990.497) -- 0:01:05
      30000 -- [-985.045] (-992.025) (-982.911) (-979.287) * [-977.954] (-983.768) (-979.296) (-994.427) -- 0:01:04

      Average standard deviation of split frequencies: 0.047734

      30500 -- (-984.480) (-990.450) [-987.897] (-978.776) * [-978.100] (-978.466) (-980.209) (-987.533) -- 0:01:03
      31000 -- (-987.348) [-982.192] (-996.295) (-979.173) * (-980.071) (-980.087) [-979.023] (-987.983) -- 0:01:02
      31500 -- (-993.468) (-987.098) (-983.571) [-977.331] * [-979.860] (-982.217) (-980.724) (-987.376) -- 0:01:01
      32000 -- (-992.679) [-984.958] (-986.276) (-977.671) * (-985.447) (-979.490) [-980.643] (-989.537) -- 0:01:00
      32500 -- (-986.887) [-991.903] (-985.224) (-979.074) * (-986.787) [-980.124] (-983.363) (-987.790) -- 0:00:59
      33000 -- [-983.125] (-989.777) (-991.914) (-977.556) * [-981.865] (-981.567) (-983.739) (-988.548) -- 0:00:58
      33500 -- [-991.067] (-991.139) (-987.315) (-978.514) * (-979.085) (-979.569) (-979.641) [-986.804] -- 0:00:57
      34000 -- (-986.677) [-983.403] (-988.366) (-978.823) * (-977.451) (-980.991) (-980.818) [-986.863] -- 0:00:56
      34500 -- (-984.458) (-989.742) (-987.162) [-977.204] * [-978.120] (-977.246) (-980.858) (-991.439) -- 0:00:55
      35000 -- [-988.852] (-992.988) (-995.016) (-977.758) * [-978.583] (-979.446) (-978.561) (-986.414) -- 0:00:55

      Average standard deviation of split frequencies: 0.035542

      35500 -- [-987.097] (-980.102) (-993.024) (-978.761) * (-979.833) (-979.995) (-982.180) [-989.590] -- 0:00:54
      36000 -- [-984.798] (-987.093) (-989.738) (-978.925) * (-979.012) (-977.609) [-977.941] (-985.941) -- 0:00:53
      36500 -- (-986.951) [-980.459] (-992.318) (-984.412) * (-979.805) [-977.283] (-977.980) (-987.140) -- 0:00:52
      37000 -- (-987.422) (-978.427) [-988.291] (-977.965) * (-978.293) (-978.463) [-978.782] (-991.437) -- 0:00:52
      37500 -- [-985.173] (-978.801) (-985.781) (-977.636) * (-981.683) (-977.259) (-977.050) [-985.240] -- 0:00:51
      38000 -- (-987.254) (-979.866) (-988.739) [-979.729] * (-980.438) (-978.308) (-978.993) [-984.478] -- 0:00:50
      38500 -- (-985.093) [-982.999] (-991.967) (-977.233) * (-978.791) (-979.825) [-980.271] (-991.645) -- 0:00:49
      39000 -- (-989.466) (-981.131) (-991.901) [-977.610] * [-979.582] (-979.227) (-978.904) (-987.073) -- 0:00:49
      39500 -- [-992.534] (-979.497) (-989.194) (-977.737) * (-978.703) (-978.725) [-976.789] (-997.416) -- 0:00:48
      40000 -- (-988.592) [-979.363] (-983.181) (-980.631) * (-978.893) (-978.270) [-980.416] (-993.125) -- 0:00:48

      Average standard deviation of split frequencies: 0.029285

      40500 -- (-984.027) [-977.736] (-981.429) (-978.681) * (-982.085) (-979.905) [-981.485] (-989.121) -- 0:01:11
      41000 -- (-983.746) [-977.326] (-979.568) (-979.271) * (-977.506) (-977.936) [-980.627] (-985.978) -- 0:01:10
      41500 -- [-985.647] (-977.454) (-981.983) (-981.009) * [-977.388] (-977.769) (-977.403) (-996.910) -- 0:01:09
      42000 -- (-984.646) (-977.609) [-979.870] (-984.038) * (-977.753) [-976.835] (-976.686) (-998.305) -- 0:01:08
      42500 -- (-987.674) (-979.049) (-978.849) [-981.672] * (-979.822) (-978.007) (-981.479) [-988.338] -- 0:01:07
      43000 -- (-987.813) (-977.741) (-978.867) [-979.457] * (-978.959) [-981.279] (-981.771) (-981.646) -- 0:01:06
      43500 -- (-982.061) [-978.482] (-977.995) (-978.714) * [-978.838] (-981.193) (-987.239) (-981.615) -- 0:01:05
      44000 -- (-986.997) (-982.012) (-980.547) [-979.024] * (-979.029) [-981.626] (-985.609) (-981.410) -- 0:01:05
      44500 -- (-986.909) (-981.311) (-980.037) [-978.325] * (-977.010) (-983.741) [-978.914] (-979.855) -- 0:01:04
      45000 -- [-981.625] (-977.319) (-979.441) (-977.327) * (-978.922) (-979.557) (-978.123) [-980.261] -- 0:01:03

      Average standard deviation of split frequencies: 0.025620

      45500 -- (-988.910) (-981.241) [-979.138] (-977.480) * (-980.116) [-978.428] (-979.637) (-978.765) -- 0:01:02
      46000 -- [-986.880] (-977.738) (-978.451) (-978.649) * (-977.882) (-980.426) (-979.134) [-978.096] -- 0:01:02
      46500 -- [-984.147] (-979.119) (-978.552) (-979.820) * (-978.193) (-980.788) [-979.057] (-983.711) -- 0:01:01
      47000 -- [-990.590] (-977.148) (-979.708) (-978.484) * (-977.020) (-979.766) (-980.234) [-979.314] -- 0:01:00
      47500 -- [-987.065] (-977.789) (-980.895) (-980.347) * (-978.894) (-980.964) (-978.398) [-981.912] -- 0:01:00
      48000 -- (-987.311) [-980.512] (-983.659) (-979.746) * (-978.155) (-979.110) [-977.850] (-978.207) -- 0:00:59
      48500 -- [-986.071] (-984.920) (-979.792) (-979.493) * (-979.267) [-979.551] (-977.729) (-977.559) -- 0:00:58
      49000 -- [-986.558] (-979.228) (-981.984) (-979.851) * (-979.923) (-982.099) (-978.775) [-978.946] -- 0:00:58
      49500 -- [-986.283] (-978.404) (-980.850) (-980.414) * (-978.867) [-980.191] (-980.747) (-978.844) -- 0:00:57
      50000 -- [-988.990] (-980.236) (-983.054) (-979.413) * [-978.903] (-977.996) (-977.499) (-979.205) -- 0:00:57

      Average standard deviation of split frequencies: 0.028721

      50500 -- [-990.486] (-981.826) (-983.415) (-978.490) * (-978.957) [-982.471] (-977.980) (-979.618) -- 0:00:56
      51000 -- [-988.254] (-979.211) (-979.927) (-978.222) * (-978.006) [-980.597] (-980.511) (-979.193) -- 0:00:55
      51500 -- (-988.126) (-977.422) (-977.444) [-977.150] * (-979.768) [-977.301] (-980.711) (-977.295) -- 0:00:55
      52000 -- (-991.714) (-978.217) (-979.906) [-978.939] * (-978.379) (-978.983) (-977.374) [-976.769] -- 0:00:54
      52500 -- (-990.455) (-977.463) [-978.504] (-979.340) * (-979.424) (-980.845) (-978.617) [-979.644] -- 0:00:54
      53000 -- (-990.136) [-977.507] (-980.931) (-976.832) * (-977.235) (-978.329) (-978.735) [-976.943] -- 0:00:53
      53500 -- [-992.368] (-977.407) (-979.960) (-977.202) * [-979.169] (-977.787) (-978.764) (-978.381) -- 0:00:53
      54000 -- (-992.171) (-979.331) (-978.628) [-978.064] * (-979.275) (-978.615) (-979.553) [-979.211] -- 0:00:52
      54500 -- (-986.172) (-981.046) [-977.974] (-978.305) * [-982.136] (-979.200) (-978.539) (-980.489) -- 0:00:52
      55000 -- (-990.309) (-980.591) (-977.519) [-979.005] * [-982.756] (-981.340) (-981.615) (-978.386) -- 0:00:51

      Average standard deviation of split frequencies: 0.024489

      55500 -- (-985.465) (-977.814) [-977.314] (-978.284) * (-982.908) [-978.158] (-980.355) (-980.567) -- 0:01:08
      56000 -- (-989.621) (-977.328) [-976.950] (-979.362) * (-980.075) (-978.467) [-979.999] (-978.075) -- 0:01:07
      56500 -- (-990.359) (-977.293) [-980.206] (-980.915) * (-978.041) (-978.857) (-981.551) [-978.422] -- 0:01:06
      57000 -- (-991.237) [-980.675] (-978.214) (-981.514) * (-981.341) [-980.146] (-979.398) (-978.685) -- 0:01:06
      57500 -- (-998.698) (-978.652) (-980.484) [-981.379] * [-979.815] (-981.873) (-981.549) (-977.485) -- 0:01:05
      58000 -- [-993.828] (-977.350) (-977.835) (-980.165) * (-978.895) (-979.595) (-980.307) [-978.232] -- 0:01:04
      58500 -- [-984.771] (-977.426) (-978.502) (-980.848) * [-979.704] (-980.004) (-979.423) (-978.085) -- 0:01:04
      59000 -- (-988.292) (-979.308) [-977.516] (-979.095) * (-980.575) (-982.877) [-979.873] (-979.967) -- 0:01:03
      59500 -- (-986.985) [-977.475] (-977.860) (-981.687) * [-979.980] (-984.975) (-979.270) (-979.927) -- 0:01:03
      60000 -- (-984.506) (-977.792) [-978.007] (-985.459) * (-983.630) [-981.379] (-980.398) (-980.249) -- 0:01:02

      Average standard deviation of split frequencies: 0.025642

      60500 -- (-987.097) [-977.118] (-982.092) (-983.142) * (-977.709) (-979.395) (-980.291) [-979.780] -- 0:01:02
      61000 -- [-984.093] (-978.864) (-980.474) (-978.591) * (-980.249) [-978.502] (-981.294) (-979.335) -- 0:01:01
      61500 -- (-987.267) (-983.750) [-979.041] (-977.628) * (-981.290) [-984.995] (-977.384) (-980.378) -- 0:01:01
      62000 -- [-991.764] (-983.180) (-978.739) (-978.261) * [-978.768] (-984.611) (-977.680) (-979.494) -- 0:01:00
      62500 -- [-983.301] (-982.020) (-978.002) (-978.235) * (-981.572) (-977.182) (-977.765) [-978.881] -- 0:01:00
      63000 -- (-986.647) (-977.968) [-980.376] (-979.360) * [-982.145] (-980.730) (-978.870) (-981.630) -- 0:00:59
      63500 -- (-998.009) [-979.827] (-979.322) (-980.966) * (-979.441) (-980.151) [-982.322] (-980.956) -- 0:00:58
      64000 -- (-987.897) (-978.775) [-978.637] (-979.905) * (-978.498) (-978.906) (-983.043) [-980.626] -- 0:00:58
      64500 -- (-987.954) (-980.034) (-978.404) [-978.248] * [-978.857] (-977.825) (-979.769) (-979.369) -- 0:00:58
      65000 -- (-987.590) [-983.692] (-977.344) (-977.638) * (-977.564) [-979.747] (-978.374) (-978.623) -- 0:00:57

      Average standard deviation of split frequencies: 0.026086

      65500 -- [-987.167] (-980.603) (-977.043) (-977.854) * [-978.015] (-981.663) (-978.464) (-979.440) -- 0:00:57
      66000 -- [-986.891] (-988.434) (-977.960) (-977.961) * (-979.048) [-978.306] (-980.797) (-980.950) -- 0:00:56
      66500 -- [-986.020] (-981.750) (-978.777) (-980.591) * (-980.219) [-977.108] (-980.075) (-978.568) -- 0:00:56
      67000 -- (-977.925) (-979.160) (-979.375) [-977.761] * (-979.937) (-977.014) [-978.939] (-980.146) -- 0:00:55
      67500 -- [-979.021] (-981.526) (-978.230) (-981.457) * [-980.645] (-978.269) (-979.623) (-978.096) -- 0:00:55
      68000 -- (-977.843) [-981.453] (-980.943) (-980.400) * (-978.910) [-980.580] (-980.011) (-981.978) -- 0:00:54
      68500 -- (-979.924) (-979.828) [-983.498] (-979.551) * (-980.752) (-980.136) (-979.482) [-979.550] -- 0:00:54
      69000 -- [-979.632] (-980.364) (-977.715) (-979.278) * (-978.647) (-979.086) [-979.514] (-982.334) -- 0:00:53
      69500 -- (-979.514) (-979.861) (-977.674) [-983.427] * [-979.356] (-977.709) (-981.062) (-983.836) -- 0:00:53
      70000 -- (-976.703) (-980.898) (-977.231) [-977.991] * (-979.042) (-978.804) (-977.371) [-977.216] -- 0:00:53

      Average standard deviation of split frequencies: 0.024864

      70500 -- (-979.691) (-978.696) [-978.262] (-978.664) * (-978.239) (-978.212) [-977.269] (-977.071) -- 0:00:52
      71000 -- [-978.831] (-978.094) (-977.979) (-977.432) * (-978.182) (-977.794) [-977.539] (-978.312) -- 0:00:52
      71500 -- (-980.753) [-978.162] (-980.611) (-976.674) * [-979.971] (-978.149) (-977.736) (-979.970) -- 0:01:04
      72000 -- (-983.988) (-978.885) (-980.708) [-978.762] * [-977.843] (-978.385) (-978.442) (-979.940) -- 0:01:04
      72500 -- (-979.115) (-981.358) [-978.666] (-980.120) * [-979.703] (-978.618) (-980.354) (-978.938) -- 0:01:03
      73000 -- (-977.822) (-979.749) (-981.542) [-979.729] * (-980.785) [-977.424] (-977.616) (-978.197) -- 0:01:03
      73500 -- (-978.773) (-982.376) [-977.952] (-977.336) * (-978.082) (-979.799) [-978.926] (-984.346) -- 0:01:03
      74000 -- (-982.264) (-977.802) [-977.268] (-977.552) * (-978.224) (-978.344) (-978.081) [-978.998] -- 0:01:02
      74500 -- [-979.069] (-978.398) (-977.037) (-979.258) * (-979.830) [-977.108] (-978.839) (-979.070) -- 0:01:02
      75000 -- (-978.398) (-976.988) [-979.173] (-978.217) * (-980.861) (-977.622) (-979.984) [-977.982] -- 0:01:01

      Average standard deviation of split frequencies: 0.023119

      75500 -- (-979.058) [-979.251] (-980.194) (-977.059) * (-980.684) (-979.421) [-976.946] (-979.160) -- 0:01:01
      76000 -- [-978.207] (-979.318) (-981.185) (-981.286) * [-977.421] (-981.276) (-977.329) (-978.769) -- 0:01:00
      76500 -- (-978.609) [-981.367] (-978.486) (-979.923) * [-979.712] (-980.651) (-977.139) (-978.618) -- 0:01:00
      77000 -- [-979.437] (-978.281) (-981.079) (-984.240) * [-979.481] (-981.714) (-977.415) (-979.006) -- 0:00:59
      77500 -- (-979.205) (-978.287) (-977.744) [-979.693] * (-980.724) [-979.767] (-978.749) (-980.376) -- 0:00:59
      78000 -- [-978.143] (-979.244) (-979.535) (-985.852) * (-980.499) (-977.095) [-978.690] (-977.968) -- 0:00:59
      78500 -- [-977.354] (-980.363) (-976.782) (-980.304) * (-978.061) (-978.193) (-977.790) [-980.714] -- 0:00:58
      79000 -- (-979.339) (-982.505) (-981.208) [-979.730] * (-978.906) (-977.039) [-977.646] (-977.222) -- 0:00:58
      79500 -- [-978.425] (-977.835) (-979.172) (-978.260) * (-979.021) (-977.148) [-978.112] (-981.423) -- 0:00:57
      80000 -- (-982.370) (-977.272) (-978.144) [-977.781] * (-978.983) (-976.938) (-979.785) [-978.421] -- 0:00:57

      Average standard deviation of split frequencies: 0.025235

      80500 -- (-982.440) (-978.316) [-977.949] (-981.302) * (-978.349) (-979.985) (-978.046) [-980.482] -- 0:00:57
      81000 -- (-980.391) (-978.442) [-977.856] (-978.586) * (-978.211) [-978.329] (-978.755) (-980.337) -- 0:00:56
      81500 -- (-980.023) (-981.635) (-977.595) [-977.978] * (-978.211) (-978.975) (-979.162) [-978.237] -- 0:00:56
      82000 -- (-978.630) [-979.170] (-980.666) (-978.703) * (-977.873) (-977.329) (-980.972) [-978.896] -- 0:00:55
      82500 -- (-978.622) [-979.203] (-978.311) (-979.079) * (-978.164) (-977.587) [-977.590] (-980.193) -- 0:00:55
      83000 -- (-982.187) (-977.031) [-977.844] (-980.584) * (-982.901) (-978.899) (-981.284) [-978.208] -- 0:00:55
      83500 -- (-984.379) [-977.222] (-978.914) (-979.524) * (-978.985) (-981.192) (-979.962) [-978.322] -- 0:00:54
      84000 -- [-977.976] (-977.538) (-979.264) (-978.777) * (-979.740) (-979.653) (-980.976) [-981.909] -- 0:00:54
      84500 -- [-978.943] (-979.004) (-983.530) (-977.158) * (-978.139) [-981.434] (-978.088) (-982.178) -- 0:00:54
      85000 -- (-979.224) (-978.189) (-979.592) [-978.198] * (-980.019) (-981.538) (-977.820) [-981.091] -- 0:00:53

      Average standard deviation of split frequencies: 0.024014

      85500 -- (-979.665) (-978.616) [-981.267] (-978.805) * [-978.669] (-978.015) (-977.793) (-978.893) -- 0:00:53
      86000 -- (-977.841) [-979.564] (-981.031) (-982.226) * (-985.465) (-979.721) [-977.855] (-982.759) -- 0:00:53
      86500 -- (-978.729) (-979.013) (-982.274) [-980.596] * (-979.646) (-980.341) (-979.154) [-979.768] -- 0:00:52
      87000 -- [-979.192] (-979.800) (-977.327) (-977.768) * [-978.820] (-978.488) (-978.261) (-980.378) -- 0:00:52
      87500 -- (-978.015) (-978.132) [-978.182] (-976.860) * (-978.632) (-978.097) [-980.586] (-987.716) -- 0:01:02
      88000 -- (-977.235) (-979.839) [-979.613] (-978.615) * (-979.194) (-978.983) [-978.929] (-984.057) -- 0:01:02
      88500 -- (-976.976) (-976.841) [-979.583] (-979.267) * [-978.306] (-981.673) (-979.199) (-977.280) -- 0:01:01
      89000 -- [-978.635] (-976.796) (-978.580) (-982.354) * (-979.002) (-987.900) (-980.017) [-977.699] -- 0:01:01
      89500 -- (-977.755) [-976.817] (-978.619) (-982.343) * (-979.894) (-982.593) [-979.972] (-977.699) -- 0:01:01
      90000 -- [-977.779] (-977.822) (-980.602) (-980.341) * (-979.515) (-985.062) [-979.933] (-977.382) -- 0:01:00

      Average standard deviation of split frequencies: 0.020277

      90500 -- (-980.917) (-978.617) [-977.367] (-978.015) * (-979.133) (-982.386) [-979.183] (-979.760) -- 0:01:00
      91000 -- (-978.437) (-980.328) (-977.828) [-977.650] * (-979.785) (-983.335) [-977.518] (-978.921) -- 0:00:59
      91500 -- (-981.850) (-979.324) (-977.816) [-977.361] * (-978.870) (-987.821) [-977.108] (-978.753) -- 0:00:59
      92000 -- (-979.690) [-978.939] (-977.867) (-979.002) * (-980.148) (-977.825) [-977.673] (-980.816) -- 0:00:59
      92500 -- [-978.057] (-977.933) (-977.544) (-981.812) * [-978.346] (-977.671) (-979.518) (-978.878) -- 0:00:58
      93000 -- [-980.017] (-977.163) (-977.388) (-982.583) * (-981.542) (-977.875) [-979.770] (-980.648) -- 0:00:58
      93500 -- [-977.846] (-978.591) (-979.328) (-977.959) * [-979.144] (-978.749) (-979.103) (-978.078) -- 0:00:58
      94000 -- (-977.726) [-977.864] (-979.744) (-979.491) * (-979.552) (-979.180) (-978.676) [-978.957] -- 0:00:57
      94500 -- (-977.735) [-978.471] (-978.464) (-980.311) * (-978.864) (-979.380) (-981.215) [-979.080] -- 0:00:57
      95000 -- (-981.261) [-978.512] (-977.792) (-979.740) * (-978.155) (-980.459) [-981.768] (-978.722) -- 0:00:57

      Average standard deviation of split frequencies: 0.019396

      95500 -- (-978.317) (-980.388) (-979.781) [-981.013] * (-978.689) (-978.681) (-980.277) [-978.302] -- 0:00:56
      96000 -- (-982.338) (-977.915) [-978.660] (-978.644) * [-979.362] (-978.768) (-981.532) (-981.566) -- 0:00:56
      96500 -- (-978.918) [-978.625] (-977.233) (-980.078) * (-978.954) (-979.310) [-980.539] (-982.456) -- 0:00:56
      97000 -- (-978.834) (-977.715) (-977.327) [-982.228] * (-978.352) (-980.081) (-981.611) [-979.739] -- 0:00:55
      97500 -- (-978.802) (-980.722) (-981.782) [-978.500] * [-978.701] (-980.411) (-979.013) (-978.219) -- 0:00:55
      98000 -- (-979.616) [-979.820] (-980.280) (-978.665) * (-978.051) [-978.216] (-978.343) (-981.335) -- 0:00:55
      98500 -- (-981.105) [-979.234] (-978.394) (-979.030) * [-979.984] (-980.237) (-978.387) (-980.679) -- 0:00:54
      99000 -- (-983.012) (-977.787) [-978.312] (-978.302) * (-980.337) (-979.083) (-977.835) [-982.178] -- 0:00:54
      99500 -- (-981.287) (-978.781) [-978.042] (-978.728) * (-980.604) (-980.199) [-978.923] (-978.376) -- 0:00:54
      100000 -- [-978.847] (-977.515) (-978.516) (-977.915) * (-981.143) (-981.731) (-980.462) [-979.326] -- 0:00:54

      Average standard deviation of split frequencies: 0.016513

      100500 -- (-979.013) (-981.108) (-978.139) [-977.878] * (-981.633) [-981.110] (-980.255) (-979.021) -- 0:00:53
      101000 -- (-984.302) (-980.890) (-979.369) [-978.144] * [-977.401] (-979.653) (-979.251) (-979.294) -- 0:00:53
      101500 -- (-978.143) (-979.034) [-979.023] (-977.918) * (-978.997) (-978.922) (-978.808) [-978.448] -- 0:00:53
      102000 -- (-979.828) (-980.126) [-978.415] (-980.826) * (-982.177) [-981.586] (-978.543) (-979.607) -- 0:00:52
      102500 -- (-981.111) (-979.856) (-979.622) [-984.357] * [-985.684] (-981.171) (-977.782) (-982.561) -- 0:00:52
      103000 -- [-977.907] (-979.338) (-978.693) (-982.010) * (-981.604) (-981.082) [-982.667] (-977.850) -- 0:00:52
      103500 -- [-978.520] (-979.360) (-978.182) (-984.233) * (-977.316) [-977.958] (-977.547) (-978.991) -- 0:00:51
      104000 -- (-979.223) [-978.665] (-978.745) (-987.508) * (-977.419) [-980.216] (-977.126) (-978.823) -- 0:01:00
      104500 -- (-979.011) [-979.387] (-978.623) (-980.317) * (-978.416) (-977.538) (-979.471) [-979.661] -- 0:00:59
      105000 -- (-979.241) (-978.817) [-982.794] (-980.178) * (-981.296) [-979.991] (-981.546) (-978.186) -- 0:00:59

      Average standard deviation of split frequencies: 0.017555

      105500 -- [-978.553] (-980.131) (-981.770) (-979.596) * [-980.283] (-981.103) (-982.775) (-980.109) -- 0:00:59
      106000 -- (-979.546) (-979.779) (-977.746) [-980.130] * (-982.561) (-978.039) [-983.199] (-978.858) -- 0:00:59
      106500 -- [-978.311] (-978.023) (-977.453) (-984.305) * (-980.600) (-977.875) (-979.943) [-980.509] -- 0:00:58
      107000 -- (-977.028) (-979.190) [-979.146] (-981.223) * (-979.096) (-978.142) [-979.629] (-979.133) -- 0:00:58
      107500 -- (-978.041) (-980.160) [-978.692] (-979.380) * (-979.523) [-977.476] (-979.495) (-977.671) -- 0:00:58
      108000 -- (-978.623) [-977.653] (-980.457) (-979.765) * (-979.508) (-979.351) [-979.949] (-978.406) -- 0:00:57
      108500 -- [-978.538] (-979.534) (-977.540) (-982.572) * (-980.567) [-977.601] (-980.706) (-978.358) -- 0:00:57
      109000 -- (-979.081) (-977.874) [-978.680] (-981.834) * (-979.418) (-978.481) (-980.228) [-977.627] -- 0:00:57
      109500 -- (-977.875) (-981.023) [-978.585] (-981.545) * (-977.176) (-982.036) (-977.890) [-979.930] -- 0:00:56
      110000 -- [-978.613] (-977.777) (-980.545) (-977.404) * [-979.721] (-978.975) (-979.890) (-977.850) -- 0:00:56

      Average standard deviation of split frequencies: 0.015469

      110500 -- (-978.668) (-976.737) (-978.557) [-977.479] * (-980.725) (-979.312) [-979.887] (-978.882) -- 0:00:56
      111000 -- (-978.577) (-977.360) [-980.335] (-977.194) * (-979.514) [-977.720] (-979.626) (-978.551) -- 0:00:56
      111500 -- (-978.248) [-978.439] (-982.753) (-977.555) * (-982.605) (-980.275) (-982.566) [-978.651] -- 0:00:55
      112000 -- (-976.997) (-978.020) [-981.065] (-977.401) * (-979.044) [-981.862] (-985.333) (-978.344) -- 0:00:55
      112500 -- (-977.226) (-979.332) [-985.257] (-981.249) * (-978.961) (-981.670) (-980.233) [-978.504] -- 0:00:55
      113000 -- (-977.868) (-978.725) (-979.271) [-979.517] * (-977.718) [-979.495] (-978.422) (-977.994) -- 0:00:54
      113500 -- (-978.469) [-977.557] (-979.655) (-979.553) * (-978.414) [-979.264] (-977.705) (-980.622) -- 0:00:54
      114000 -- (-977.738) (-979.617) [-979.836] (-980.196) * [-980.467] (-979.155) (-977.408) (-978.674) -- 0:00:54
      114500 -- (-977.817) [-977.403] (-980.937) (-980.650) * (-978.888) (-979.026) [-979.055] (-979.198) -- 0:00:54
      115000 -- (-977.809) (-978.480) [-978.106] (-978.476) * [-979.598] (-978.128) (-978.036) (-977.152) -- 0:00:53

      Average standard deviation of split frequencies: 0.016683

      115500 -- [-980.600] (-977.068) (-978.462) (-979.358) * (-978.553) [-979.846] (-978.019) (-978.703) -- 0:00:53
      116000 -- [-980.097] (-979.488) (-978.624) (-979.851) * [-984.519] (-980.865) (-979.353) (-977.156) -- 0:00:53
      116500 -- (-978.082) [-980.830] (-978.050) (-979.266) * (-978.869) (-981.435) (-978.510) [-977.347] -- 0:00:53
      117000 -- (-978.292) (-978.231) [-978.591] (-979.856) * (-979.470) (-979.168) (-977.516) [-977.994] -- 0:00:52
      117500 -- (-983.980) (-978.235) [-980.466] (-978.936) * (-979.629) (-978.948) (-978.623) [-979.241] -- 0:00:52
      118000 -- (-980.805) [-980.991] (-982.112) (-979.872) * (-980.482) (-978.843) [-978.446] (-979.650) -- 0:00:52
      118500 -- (-980.955) (-981.793) (-983.422) [-978.539] * [-978.136] (-980.343) (-981.700) (-981.163) -- 0:00:52
      119000 -- (-988.000) (-980.481) [-977.961] (-979.179) * (-982.385) (-978.491) (-985.780) [-981.127] -- 0:00:51
      119500 -- (-980.807) [-978.899] (-978.902) (-979.003) * [-978.549] (-977.754) (-979.783) (-977.381) -- 0:00:51
      120000 -- (-980.624) (-982.460) [-977.189] (-979.379) * (-980.249) (-979.503) [-980.288] (-977.224) -- 0:00:58

      Average standard deviation of split frequencies: 0.017971

      120500 -- (-978.849) (-984.997) (-977.213) [-979.957] * (-978.688) (-982.119) (-978.736) [-978.049] -- 0:00:58
      121000 -- [-978.241] (-983.124) (-977.072) (-977.806) * (-978.654) (-979.493) (-979.719) [-977.962] -- 0:00:58
      121500 -- (-978.991) (-983.222) [-980.551] (-978.651) * (-978.274) (-990.916) [-980.042] (-978.602) -- 0:00:57
      122000 -- [-978.089] (-979.060) (-982.136) (-977.875) * (-977.650) [-985.813] (-981.080) (-979.743) -- 0:00:57
      122500 -- (-977.643) (-979.187) [-979.530] (-977.869) * (-978.164) (-981.781) [-978.253] (-983.214) -- 0:00:57
      123000 -- (-978.694) [-982.265] (-979.863) (-977.756) * (-983.793) [-977.226] (-977.421) (-979.711) -- 0:00:57
      123500 -- [-979.346] (-984.919) (-977.525) (-979.135) * (-981.600) [-978.939] (-977.861) (-983.798) -- 0:00:56
      124000 -- (-978.524) (-979.926) (-977.100) [-977.709] * [-981.363] (-977.485) (-982.489) (-981.630) -- 0:00:56
      124500 -- [-976.823] (-979.369) (-977.791) (-978.730) * [-979.315] (-980.165) (-978.348) (-979.945) -- 0:00:56
      125000 -- (-977.449) (-979.174) [-977.719] (-979.862) * (-979.310) [-978.872] (-979.361) (-981.079) -- 0:00:56

      Average standard deviation of split frequencies: 0.016326

      125500 -- (-980.093) (-979.130) (-978.602) [-978.254] * (-978.573) (-978.450) [-980.588] (-979.821) -- 0:00:55
      126000 -- (-979.391) (-978.815) (-977.062) [-977.346] * (-978.728) (-977.806) (-979.622) [-982.509] -- 0:00:55
      126500 -- (-979.864) [-978.875] (-977.583) (-977.838) * (-977.452) (-977.685) (-983.645) [-981.895] -- 0:00:55
      127000 -- (-978.125) (-978.043) [-978.564] (-978.635) * [-980.721] (-977.685) (-984.530) (-978.974) -- 0:00:54
      127500 -- (-977.959) (-977.974) [-978.395] (-977.582) * (-980.976) (-977.877) (-981.071) [-977.924] -- 0:00:54
      128000 -- (-978.566) [-978.142] (-979.679) (-978.240) * [-980.048] (-983.049) (-977.307) (-977.632) -- 0:00:54
      128500 -- (-977.862) (-986.710) [-980.593] (-980.305) * (-982.945) (-980.856) (-979.092) [-978.862] -- 0:00:54
      129000 -- [-978.191] (-980.692) (-978.609) (-980.497) * (-980.494) (-979.918) [-978.565] (-979.483) -- 0:00:54
      129500 -- [-977.576] (-983.228) (-977.843) (-978.983) * [-977.551] (-980.958) (-979.810) (-981.336) -- 0:00:53
      130000 -- [-979.887] (-978.532) (-980.405) (-978.206) * (-980.248) [-983.775] (-977.829) (-978.961) -- 0:00:53

      Average standard deviation of split frequencies: 0.017678

      130500 -- [-977.870] (-978.328) (-978.287) (-978.394) * (-978.831) (-982.090) (-979.270) [-978.397] -- 0:00:53
      131000 -- (-981.290) (-978.298) [-978.082] (-979.284) * (-980.770) (-978.209) (-977.043) [-976.833] -- 0:00:53
      131500 -- (-983.551) [-978.233] (-978.488) (-979.144) * (-980.670) (-978.775) [-976.959] (-979.573) -- 0:00:52
      132000 -- (-982.377) [-978.627] (-978.934) (-981.426) * [-981.657] (-978.296) (-978.781) (-979.539) -- 0:00:52
      132500 -- (-981.291) (-977.478) [-979.962] (-983.969) * (-983.545) [-980.576] (-980.510) (-978.820) -- 0:00:52
      133000 -- (-979.519) (-977.739) (-978.905) [-982.416] * (-983.074) (-979.386) (-978.495) [-979.471] -- 0:00:52
      133500 -- [-978.295] (-977.631) (-979.344) (-986.576) * (-981.075) (-979.485) (-976.906) [-978.016] -- 0:00:51
      134000 -- (-977.822) [-978.101] (-979.060) (-980.862) * [-978.844] (-981.986) (-976.821) (-978.318) -- 0:00:51
      134500 -- (-979.952) (-978.190) (-979.787) [-978.343] * (-981.485) (-977.051) (-976.808) [-980.288] -- 0:00:51
      135000 -- (-985.043) [-977.171] (-982.474) (-980.717) * (-982.240) (-977.589) [-977.867] (-980.065) -- 0:00:51

      Average standard deviation of split frequencies: 0.020451

      135500 -- [-983.785] (-978.385) (-979.035) (-979.383) * (-980.517) (-978.780) (-979.438) [-980.665] -- 0:00:51
      136000 -- (-987.569) [-978.148] (-979.111) (-986.398) * (-980.085) (-978.539) [-978.662] (-979.502) -- 0:00:57
      136500 -- (-982.294) (-980.335) [-980.902] (-980.723) * (-983.206) [-978.939] (-980.359) (-978.167) -- 0:00:56
      137000 -- (-981.210) (-977.664) [-980.379] (-981.855) * (-983.511) (-982.969) (-979.821) [-977.010] -- 0:00:56
      137500 -- (-978.088) [-979.578] (-979.268) (-980.540) * (-980.706) [-979.619] (-977.122) (-980.257) -- 0:00:56
      138000 -- [-978.887] (-978.539) (-978.517) (-979.307) * (-981.306) [-979.635] (-984.174) (-980.337) -- 0:00:56
      138500 -- [-980.181] (-983.699) (-977.969) (-978.913) * (-978.879) (-977.290) (-977.895) [-977.714] -- 0:00:55
      139000 -- (-981.342) [-978.929] (-978.129) (-979.362) * [-980.178] (-980.691) (-977.635) (-979.883) -- 0:00:55
      139500 -- [-979.432] (-978.379) (-976.822) (-979.106) * (-978.435) (-980.085) (-979.893) [-977.268] -- 0:00:55
      140000 -- [-978.404] (-981.022) (-977.462) (-981.937) * [-982.116] (-979.624) (-977.502) (-979.054) -- 0:00:55

      Average standard deviation of split frequencies: 0.019755

      140500 -- (-981.292) (-977.902) [-978.369] (-980.030) * [-979.063] (-979.535) (-979.553) (-977.896) -- 0:00:55
      141000 -- (-981.154) (-981.189) (-978.170) [-978.165] * (-976.960) (-982.392) (-978.667) [-978.492] -- 0:00:54
      141500 -- (-979.706) [-979.254] (-978.913) (-978.165) * [-979.256] (-981.391) (-977.070) (-977.572) -- 0:00:54
      142000 -- (-980.366) [-980.107] (-979.785) (-978.867) * [-977.741] (-977.967) (-978.795) (-979.548) -- 0:00:54
      142500 -- (-982.127) (-977.639) [-978.472] (-980.360) * [-978.633] (-978.460) (-977.878) (-982.324) -- 0:00:54
      143000 -- [-982.343] (-981.182) (-978.936) (-978.676) * (-977.964) (-977.431) [-976.847] (-980.959) -- 0:00:53
      143500 -- (-979.483) (-980.003) [-978.785] (-979.216) * (-981.023) [-978.283] (-978.170) (-982.023) -- 0:00:53
      144000 -- (-984.257) (-980.194) [-977.408] (-980.569) * (-979.916) [-977.501] (-977.078) (-980.262) -- 0:00:53
      144500 -- (-983.049) (-978.357) [-977.954] (-977.983) * (-979.703) (-977.106) (-980.293) [-979.049] -- 0:00:53
      145000 -- (-980.113) (-979.157) (-985.272) [-979.160] * (-980.284) [-977.337] (-977.024) (-982.506) -- 0:00:53

      Average standard deviation of split frequencies: 0.020826

      145500 -- [-977.772] (-982.958) (-987.830) (-978.915) * [-978.844] (-977.930) (-981.026) (-979.378) -- 0:00:52
      146000 -- [-979.736] (-979.422) (-981.051) (-981.326) * (-979.142) (-977.489) [-981.677] (-978.991) -- 0:00:52
      146500 -- [-979.403] (-981.448) (-979.429) (-979.906) * [-979.648] (-978.608) (-978.146) (-979.154) -- 0:00:52
      147000 -- (-978.182) [-977.032] (-980.402) (-979.493) * (-979.778) [-978.434] (-983.489) (-978.429) -- 0:00:52
      147500 -- (-979.183) (-978.053) [-982.152] (-979.361) * (-977.802) (-982.120) (-979.355) [-977.691] -- 0:00:52
      148000 -- (-978.800) (-978.175) (-985.506) [-979.393] * (-983.114) [-977.620] (-979.261) (-977.359) -- 0:00:51
      148500 -- (-983.736) (-979.935) (-980.277) [-978.248] * [-979.913] (-984.422) (-980.563) (-978.545) -- 0:00:51
      149000 -- (-978.573) [-979.100] (-981.667) (-978.849) * (-981.913) (-980.813) (-978.772) [-978.264] -- 0:00:51
      149500 -- (-982.205) [-978.158] (-980.847) (-980.135) * [-981.476] (-977.823) (-979.622) (-980.111) -- 0:00:51
      150000 -- (-980.541) (-978.197) (-978.908) [-978.479] * [-979.758] (-979.558) (-980.872) (-979.672) -- 0:00:51

      Average standard deviation of split frequencies: 0.022066

      150500 -- [-978.643] (-984.049) (-978.955) (-979.142) * (-978.656) [-986.131] (-981.077) (-979.953) -- 0:00:50
      151000 -- [-979.282] (-981.137) (-978.951) (-982.806) * (-978.731) (-979.189) [-979.204] (-979.955) -- 0:00:50
      151500 -- [-982.752] (-981.515) (-978.705) (-977.698) * [-979.561] (-979.088) (-978.128) (-979.925) -- 0:00:50
      152000 -- (-979.257) [-978.486] (-978.514) (-981.642) * (-977.559) [-977.136] (-981.393) (-979.257) -- 0:00:50
      152500 -- (-979.113) (-979.500) [-980.692] (-983.061) * (-978.554) (-976.903) [-978.312] (-979.717) -- 0:00:55
      153000 -- (-977.584) [-980.846] (-979.543) (-978.670) * (-981.073) (-979.429) [-979.918] (-986.914) -- 0:00:55
      153500 -- (-977.597) (-979.940) [-979.388] (-979.932) * (-980.792) (-980.185) (-978.649) [-979.557] -- 0:00:55
      154000 -- [-977.469] (-980.259) (-979.075) (-978.993) * [-980.397] (-978.397) (-980.190) (-977.071) -- 0:00:54
      154500 -- (-979.571) (-978.089) (-979.464) [-977.748] * [-977.767] (-978.957) (-980.311) (-980.822) -- 0:00:54
      155000 -- (-980.012) (-977.001) (-982.735) [-977.583] * (-977.238) (-978.757) [-978.787] (-977.473) -- 0:00:54

      Average standard deviation of split frequencies: 0.020517

      155500 -- [-978.368] (-978.169) (-978.282) (-978.437) * (-981.867) [-978.566] (-979.341) (-977.620) -- 0:00:54
      156000 -- (-984.574) (-980.515) (-981.882) [-978.305] * (-980.698) [-978.346] (-980.422) (-978.482) -- 0:00:54
      156500 -- (-983.318) [-979.713] (-986.216) (-978.806) * (-977.929) (-980.908) (-979.567) [-980.229] -- 0:00:53
      157000 -- (-977.744) (-984.637) (-986.410) [-980.305] * [-977.782] (-982.618) (-978.958) (-982.020) -- 0:00:53
      157500 -- (-979.120) (-980.103) (-980.677) [-977.546] * (-979.150) (-979.263) (-979.642) [-978.120] -- 0:00:53
      158000 -- (-978.036) (-980.930) [-978.368] (-978.534) * (-984.029) (-979.189) (-981.114) [-977.848] -- 0:00:53
      158500 -- (-979.766) (-979.600) [-978.715] (-978.597) * (-983.612) [-979.685] (-981.343) (-977.128) -- 0:00:53
      159000 -- (-979.061) [-978.145] (-983.275) (-984.485) * (-979.856) [-978.767] (-978.093) (-978.074) -- 0:00:52
      159500 -- (-978.502) (-977.230) [-980.804] (-979.484) * (-981.655) [-978.223] (-978.059) (-978.138) -- 0:00:52
      160000 -- [-980.858] (-978.560) (-978.788) (-979.509) * (-979.508) (-977.918) [-977.521] (-980.158) -- 0:00:52

      Average standard deviation of split frequencies: 0.019612

      160500 -- (-981.610) (-978.990) (-979.545) [-985.578] * [-980.975] (-979.686) (-978.239) (-980.426) -- 0:00:52
      161000 -- (-980.833) (-979.773) [-978.099] (-985.219) * (-978.202) (-978.155) (-978.859) [-980.425] -- 0:00:52
      161500 -- (-981.991) [-978.835] (-979.641) (-980.251) * [-981.269] (-982.841) (-978.831) (-985.115) -- 0:00:51
      162000 -- (-980.215) (-979.696) [-978.761] (-981.921) * (-979.784) [-979.043] (-984.813) (-978.503) -- 0:00:51
      162500 -- (-978.639) [-978.766] (-978.896) (-982.462) * [-979.529] (-980.105) (-983.502) (-977.196) -- 0:00:51
      163000 -- (-986.154) (-977.654) [-980.268] (-977.125) * (-979.989) (-980.788) [-982.016] (-978.142) -- 0:00:51
      163500 -- (-981.203) [-978.287] (-978.916) (-978.091) * (-979.057) (-978.673) (-982.301) [-977.656] -- 0:00:51
      164000 -- (-982.510) (-979.283) [-980.151] (-977.852) * [-979.792] (-979.408) (-979.490) (-982.035) -- 0:00:50
      164500 -- (-977.622) (-983.746) [-977.015] (-976.799) * [-980.129] (-981.030) (-976.933) (-980.149) -- 0:00:50
      165000 -- (-982.578) (-984.119) (-980.171) [-978.987] * (-982.521) [-983.607] (-978.589) (-980.013) -- 0:00:50

      Average standard deviation of split frequencies: 0.020177

      165500 -- [-978.400] (-981.820) (-979.347) (-979.156) * (-979.913) [-980.891] (-977.231) (-979.090) -- 0:00:50
      166000 -- [-979.812] (-982.811) (-978.397) (-980.687) * [-976.993] (-981.947) (-977.403) (-978.268) -- 0:00:50
      166500 -- (-980.220) (-980.366) (-978.755) [-980.083] * (-977.703) [-980.695] (-978.989) (-985.778) -- 0:00:50
      167000 -- [-979.692] (-988.542) (-980.110) (-979.685) * (-977.686) (-979.208) [-977.459] (-981.082) -- 0:00:49
      167500 -- (-980.393) [-980.147] (-981.044) (-979.471) * (-982.741) (-979.134) (-977.581) [-981.535] -- 0:00:49
      168000 -- (-977.616) (-981.239) [-983.471] (-977.835) * (-982.657) (-981.157) (-977.917) [-979.489] -- 0:00:49
      168500 -- (-977.136) (-978.994) [-980.407] (-977.483) * [-982.909] (-977.885) (-979.298) (-979.089) -- 0:00:49
      169000 -- (-977.694) [-980.886] (-981.443) (-979.921) * [-977.390] (-980.826) (-977.612) (-980.778) -- 0:00:54
      169500 -- (-977.388) [-977.807] (-983.056) (-978.315) * [-977.390] (-980.259) (-980.953) (-981.497) -- 0:00:53
      170000 -- [-977.416] (-979.846) (-978.483) (-978.381) * (-978.777) (-977.687) [-981.857] (-978.559) -- 0:00:53

      Average standard deviation of split frequencies: 0.020563

      170500 -- (-981.704) (-980.523) (-979.686) [-976.978] * (-978.796) (-979.276) [-984.191] (-979.791) -- 0:00:53
      171000 -- (-980.270) [-979.032] (-980.131) (-979.890) * (-978.667) (-980.917) (-980.108) [-978.586] -- 0:00:53
      171500 -- (-979.384) (-979.764) (-978.522) [-981.866] * (-977.856) (-978.702) (-978.671) [-976.918] -- 0:00:53
      172000 -- (-981.404) [-978.558] (-977.906) (-981.072) * [-978.112] (-978.455) (-980.401) (-978.305) -- 0:00:52
      172500 -- [-979.226] (-979.498) (-979.561) (-979.705) * (-979.091) (-978.725) [-977.719] (-978.590) -- 0:00:52
      173000 -- [-978.399] (-980.652) (-981.324) (-979.662) * (-977.321) [-983.766] (-980.368) (-977.750) -- 0:00:52
      173500 -- (-977.848) (-979.503) (-978.000) [-982.359] * [-979.844] (-978.435) (-979.453) (-978.309) -- 0:00:52
      174000 -- (-979.765) (-981.144) [-977.796] (-978.065) * (-979.825) [-978.180] (-982.382) (-977.674) -- 0:00:52
      174500 -- (-978.807) (-979.346) (-977.540) [-977.998] * [-978.885] (-979.608) (-980.480) (-978.259) -- 0:00:52
      175000 -- (-978.256) (-979.321) (-979.258) [-978.611] * (-978.729) (-979.173) (-978.483) [-978.669] -- 0:00:51

      Average standard deviation of split frequencies: 0.020683

      175500 -- (-981.331) [-979.847] (-977.008) (-979.476) * (-979.559) (-978.722) [-979.258] (-980.085) -- 0:00:51
      176000 -- (-979.294) [-980.725] (-977.055) (-980.575) * (-979.736) (-978.738) (-979.800) [-980.541] -- 0:00:51
      176500 -- (-978.972) (-983.396) [-977.055] (-981.000) * [-977.476] (-978.651) (-981.687) (-978.868) -- 0:00:51
      177000 -- (-978.385) (-977.779) [-977.275] (-984.403) * (-977.783) (-978.843) (-978.682) [-982.589] -- 0:00:51
      177500 -- (-981.413) (-977.789) (-978.040) [-979.094] * (-980.052) (-978.157) (-978.616) [-978.263] -- 0:00:50
      178000 -- (-979.965) (-978.412) [-979.492] (-979.507) * (-981.777) [-978.024] (-978.890) (-977.612) -- 0:00:50
      178500 -- (-979.475) [-978.038] (-978.884) (-977.835) * [-978.566] (-978.097) (-979.152) (-978.147) -- 0:00:50
      179000 -- (-979.006) [-978.052] (-978.772) (-979.014) * (-977.509) (-979.586) (-985.964) [-980.921] -- 0:00:50
      179500 -- (-980.040) [-980.391] (-979.114) (-977.981) * (-978.537) (-980.441) (-980.290) [-978.051] -- 0:00:50
      180000 -- [-978.612] (-980.071) (-981.079) (-976.892) * [-980.561] (-978.455) (-977.014) (-980.730) -- 0:00:50

      Average standard deviation of split frequencies: 0.020294

      180500 -- [-978.655] (-978.701) (-977.140) (-977.222) * (-982.682) [-977.425] (-981.723) (-978.304) -- 0:00:49
      181000 -- (-979.496) [-978.947] (-977.665) (-977.231) * [-981.164] (-977.006) (-983.151) (-978.070) -- 0:00:49
      181500 -- (-981.239) (-979.464) (-977.760) [-980.984] * (-980.797) (-979.223) [-977.708] (-978.100) -- 0:00:49
      182000 -- (-980.916) (-978.374) [-977.666] (-981.618) * (-982.285) (-977.392) [-977.616] (-978.971) -- 0:00:49
      182500 -- (-978.554) [-979.251] (-976.893) (-979.953) * (-977.963) (-977.872) [-980.551] (-979.229) -- 0:00:49
      183000 -- (-979.717) (-980.202) (-978.553) [-981.226] * (-977.473) [-978.022] (-980.965) (-983.440) -- 0:00:49
      183500 -- [-978.427] (-981.486) (-983.493) (-977.854) * (-978.548) (-980.628) [-980.562] (-980.835) -- 0:00:48
      184000 -- (-981.029) (-981.187) [-978.557] (-982.737) * (-978.374) [-977.042] (-982.011) (-980.088) -- 0:00:48
      184500 -- [-978.825] (-977.858) (-979.557) (-979.012) * (-978.898) (-979.883) (-977.550) [-978.991] -- 0:00:48
      185000 -- (-979.899) [-977.714] (-979.778) (-977.007) * (-977.844) (-979.753) (-981.007) [-977.543] -- 0:00:48

      Average standard deviation of split frequencies: 0.021402

      185500 -- (-979.971) [-980.342] (-980.998) (-978.431) * (-978.334) (-981.354) (-977.063) [-978.140] -- 0:00:52
      186000 -- (-979.904) [-978.361] (-979.566) (-977.254) * [-978.641] (-981.972) (-979.065) (-978.050) -- 0:00:52
      186500 -- [-978.363] (-978.348) (-978.265) (-980.097) * (-979.280) [-977.639] (-976.980) (-979.648) -- 0:00:52
      187000 -- (-978.404) [-979.545] (-977.939) (-982.152) * (-977.708) [-977.750] (-977.325) (-980.052) -- 0:00:52
      187500 -- (-979.641) (-980.571) [-977.990] (-978.071) * (-982.234) (-977.897) [-977.832] (-981.461) -- 0:00:52
      188000 -- (-978.700) (-980.545) [-978.575] (-981.587) * (-979.611) (-979.752) (-980.729) [-978.698] -- 0:00:51
      188500 -- [-979.133] (-979.602) (-979.078) (-979.793) * (-980.598) (-977.654) [-980.476] (-978.226) -- 0:00:51
      189000 -- (-980.004) (-979.420) [-978.968] (-977.419) * (-984.531) [-978.428] (-980.865) (-978.221) -- 0:00:51
      189500 -- (-979.172) (-976.906) (-982.176) [-976.943] * [-980.598] (-978.710) (-982.090) (-977.775) -- 0:00:51
      190000 -- [-979.478] (-978.798) (-977.691) (-978.291) * (-978.989) (-977.449) (-977.548) [-978.395] -- 0:00:51

      Average standard deviation of split frequencies: 0.020329

      190500 -- (-981.236) [-978.271] (-980.988) (-978.342) * (-980.526) [-981.258] (-977.937) (-977.714) -- 0:00:50
      191000 -- (-978.591) (-980.549) [-981.992] (-981.226) * [-979.438] (-981.177) (-978.403) (-978.184) -- 0:00:50
      191500 -- [-978.034] (-977.792) (-979.549) (-979.603) * (-977.939) (-978.155) [-978.255] (-977.427) -- 0:00:50
      192000 -- [-979.504] (-981.145) (-980.867) (-984.294) * (-977.777) [-980.041] (-978.102) (-978.846) -- 0:00:50
      192500 -- (-980.043) [-979.759] (-980.539) (-981.818) * (-981.779) (-977.939) [-979.222] (-978.353) -- 0:00:50
      193000 -- (-983.694) (-980.506) (-977.931) [-981.497] * [-977.584] (-977.301) (-980.782) (-978.709) -- 0:00:50
      193500 -- (-981.191) [-981.599] (-980.565) (-979.559) * (-978.220) [-978.105] (-977.593) (-979.137) -- 0:00:50
      194000 -- (-979.578) [-977.859] (-978.321) (-980.723) * (-978.010) (-978.403) (-977.435) [-979.041] -- 0:00:49
      194500 -- (-980.376) [-980.911] (-978.370) (-979.097) * (-978.219) (-978.410) [-981.580] (-979.185) -- 0:00:49
      195000 -- (-979.474) (-980.605) (-978.271) [-980.049] * [-979.598] (-980.099) (-983.371) (-979.157) -- 0:00:49

      Average standard deviation of split frequencies: 0.020176

      195500 -- (-979.981) (-979.722) (-978.663) [-978.544] * (-977.775) (-989.109) [-980.629] (-980.159) -- 0:00:49
      196000 -- (-979.867) [-978.522] (-978.799) (-978.315) * [-982.205] (-980.198) (-981.555) (-979.198) -- 0:00:49
      196500 -- (-979.655) (-978.086) (-979.141) [-978.760] * (-980.787) (-979.517) [-983.461] (-980.618) -- 0:00:49
      197000 -- (-980.569) (-978.657) (-978.695) [-978.656] * (-979.410) (-982.253) [-984.036] (-979.140) -- 0:00:48
      197500 -- (-980.346) (-977.771) (-979.135) [-978.544] * (-978.280) (-978.951) [-983.184] (-980.023) -- 0:00:48
      198000 -- (-979.838) [-978.784] (-978.780) (-977.667) * (-979.612) (-980.009) (-979.473) [-979.068] -- 0:00:48
      198500 -- [-980.862] (-977.632) (-978.309) (-978.148) * [-979.729] (-979.439) (-978.119) (-978.507) -- 0:00:48
      199000 -- (-982.216) (-982.443) (-981.869) [-978.272] * [-979.380] (-977.937) (-980.391) (-978.270) -- 0:00:48
      199500 -- (-979.074) (-978.817) [-981.235] (-978.913) * (-978.502) (-979.016) [-977.660] (-978.091) -- 0:00:48
      200000 -- (-979.455) (-978.362) (-982.098) [-978.238] * (-977.065) [-980.867] (-978.187) (-977.874) -- 0:00:48

      Average standard deviation of split frequencies: 0.020621

      200500 -- (-977.852) (-977.475) [-978.849] (-978.114) * (-977.196) (-983.199) [-980.854] (-978.244) -- 0:00:47
      201000 -- [-981.189] (-980.097) (-981.117) (-979.263) * [-977.345] (-982.902) (-982.852) (-984.258) -- 0:00:47
      201500 -- (-980.445) (-978.778) [-979.235] (-977.630) * (-976.929) (-979.560) (-978.181) [-981.775] -- 0:00:51
      202000 -- (-978.336) [-979.611] (-978.790) (-977.745) * (-977.392) (-979.520) [-977.825] (-980.610) -- 0:00:51
      202500 -- (-980.427) (-982.586) [-977.351] (-978.155) * (-978.642) (-981.496) [-978.417] (-978.511) -- 0:00:51
      203000 -- (-980.043) [-980.717] (-978.115) (-978.627) * (-978.253) (-979.883) (-979.352) [-980.314] -- 0:00:51
      203500 -- (-983.636) [-980.594] (-978.889) (-978.458) * [-976.982] (-977.676) (-979.341) (-978.012) -- 0:00:50
      204000 -- (-983.706) [-979.342] (-978.102) (-981.802) * (-977.608) (-977.256) (-979.661) [-977.097] -- 0:00:50
      204500 -- (-981.292) [-980.419] (-980.862) (-983.246) * [-978.234] (-977.184) (-978.116) (-977.859) -- 0:00:50
      205000 -- (-978.012) (-979.128) (-978.073) [-978.623] * (-979.744) (-977.466) [-977.245] (-981.199) -- 0:00:50

      Average standard deviation of split frequencies: 0.019705

      205500 -- (-977.522) (-980.748) (-980.834) [-978.366] * [-980.832] (-978.136) (-980.885) (-983.439) -- 0:00:50
      206000 -- (-978.050) [-980.006] (-979.643) (-976.975) * [-979.318] (-978.998) (-977.382) (-980.419) -- 0:00:50
      206500 -- (-978.773) (-977.297) (-978.660) [-977.789] * (-979.620) (-979.184) (-982.021) [-979.894] -- 0:00:49
      207000 -- [-979.000] (-978.624) (-977.904) (-977.189) * (-979.543) [-978.990] (-980.408) (-977.399) -- 0:00:49
      207500 -- (-978.955) (-979.647) [-978.440] (-978.845) * [-978.219] (-980.060) (-979.914) (-979.089) -- 0:00:49
      208000 -- (-980.007) (-978.883) (-981.543) [-977.436] * (-977.347) (-979.884) (-980.010) [-977.613] -- 0:00:49
      208500 -- (-978.641) [-978.033] (-979.575) (-981.638) * (-979.299) (-978.573) [-979.223] (-982.135) -- 0:00:49
      209000 -- (-979.378) (-980.573) [-981.080] (-977.131) * (-980.471) (-978.551) (-982.764) [-978.134] -- 0:00:49
      209500 -- (-978.170) (-979.418) [-978.031] (-977.187) * (-978.406) [-979.693] (-978.808) (-978.337) -- 0:00:49
      210000 -- (-981.737) (-977.978) (-977.639) [-976.730] * [-978.430] (-980.076) (-980.025) (-980.834) -- 0:00:48

      Average standard deviation of split frequencies: 0.021982

      210500 -- (-980.315) (-978.447) (-978.182) [-977.720] * (-978.695) (-977.594) [-978.040] (-978.735) -- 0:00:48
      211000 -- (-978.533) (-981.670) [-981.119] (-983.634) * (-981.438) (-980.891) [-980.083] (-980.200) -- 0:00:48
      211500 -- (-978.500) [-982.910] (-978.046) (-979.917) * [-978.318] (-980.461) (-985.662) (-977.860) -- 0:00:48
      212000 -- [-978.835] (-983.551) (-977.691) (-977.079) * (-976.802) [-978.163] (-980.023) (-977.738) -- 0:00:48
      212500 -- (-981.974) (-980.424) [-979.518] (-983.831) * (-982.555) (-979.056) (-982.939) [-979.046] -- 0:00:48
      213000 -- (-977.732) [-979.896] (-981.264) (-980.189) * (-981.634) (-981.276) (-983.606) [-979.797] -- 0:00:48
      213500 -- (-978.567) [-983.948] (-978.291) (-978.314) * [-979.808] (-978.719) (-978.911) (-981.682) -- 0:00:47
      214000 -- [-978.563] (-978.812) (-978.269) (-981.001) * (-980.552) (-978.111) [-979.957] (-981.073) -- 0:00:47
      214500 -- (-984.728) [-979.274] (-979.844) (-977.990) * (-984.046) (-978.434) (-979.382) [-985.098] -- 0:00:47
      215000 -- (-983.689) (-977.204) [-981.741] (-977.983) * (-978.344) (-977.122) [-977.834] (-978.696) -- 0:00:47

      Average standard deviation of split frequencies: 0.021054

      215500 -- (-983.357) [-977.315] (-979.834) (-978.155) * (-977.289) (-978.467) (-980.936) [-978.906] -- 0:00:47
      216000 -- (-983.451) (-978.768) [-978.665] (-979.079) * (-977.514) (-977.586) (-981.985) [-977.955] -- 0:00:47
      216500 -- (-981.123) [-980.654] (-981.304) (-979.279) * (-978.403) (-977.602) (-982.159) [-981.072] -- 0:00:47
      217000 -- (-980.761) (-979.719) [-979.176] (-978.036) * [-979.276] (-979.074) (-983.382) (-977.650) -- 0:00:46
      217500 -- (-978.520) (-980.279) (-983.677) [-979.072] * (-977.540) (-981.937) (-979.443) [-979.625] -- 0:00:46
      218000 -- (-980.161) [-979.632] (-978.498) (-979.716) * (-979.258) [-981.937] (-979.937) (-980.814) -- 0:00:50
      218500 -- (-977.051) [-979.560] (-979.426) (-978.421) * [-977.995] (-981.752) (-980.067) (-980.866) -- 0:00:50
      219000 -- [-977.679] (-980.603) (-979.110) (-977.536) * (-978.653) (-977.069) [-980.789] (-981.883) -- 0:00:49
      219500 -- (-980.278) (-980.091) (-979.559) [-977.939] * (-981.249) (-978.052) [-982.166] (-979.668) -- 0:00:49
      220000 -- (-979.068) (-979.159) [-978.291] (-978.702) * (-980.320) (-976.994) [-978.477] (-981.215) -- 0:00:49

      Average standard deviation of split frequencies: 0.021614

      220500 -- [-978.027] (-980.392) (-978.940) (-977.500) * [-979.939] (-979.395) (-978.951) (-983.022) -- 0:00:49
      221000 -- [-979.318] (-982.210) (-978.405) (-981.049) * (-979.852) [-980.032] (-979.475) (-979.494) -- 0:00:49
      221500 -- (-979.689) (-981.400) (-978.110) [-978.285] * (-978.969) [-977.112] (-978.890) (-979.187) -- 0:00:49
      222000 -- (-979.196) (-979.583) (-979.210) [-977.053] * [-986.453] (-984.056) (-978.304) (-978.695) -- 0:00:49
      222500 -- (-979.461) [-981.097] (-979.085) (-979.694) * (-986.743) (-985.388) (-979.076) [-980.575] -- 0:00:48
      223000 -- (-982.849) (-980.174) (-985.241) [-981.394] * (-977.940) [-979.955] (-980.731) (-980.139) -- 0:00:48
      223500 -- (-981.571) (-979.932) (-982.696) [-979.757] * (-979.649) [-981.656] (-976.701) (-978.471) -- 0:00:48
      224000 -- (-980.045) [-979.604] (-977.898) (-981.534) * (-978.302) (-984.553) [-978.389] (-983.010) -- 0:00:48
      224500 -- (-985.255) [-978.112] (-979.327) (-979.363) * (-980.807) (-976.873) (-977.396) [-978.356] -- 0:00:48
      225000 -- (-979.532) (-977.325) [-979.979] (-980.646) * (-979.663) [-979.628] (-979.307) (-980.507) -- 0:00:48

      Average standard deviation of split frequencies: 0.023067

      225500 -- (-978.503) [-980.122] (-976.880) (-979.246) * (-980.478) (-978.234) (-981.107) [-979.767] -- 0:00:48
      226000 -- (-983.474) [-978.957] (-977.246) (-979.452) * (-979.712) [-977.617] (-978.284) (-980.169) -- 0:00:47
      226500 -- (-978.914) [-978.101] (-976.766) (-978.273) * [-978.117] (-979.160) (-978.653) (-980.290) -- 0:00:47
      227000 -- (-982.987) [-979.847] (-976.884) (-977.972) * (-987.524) (-979.905) (-978.935) [-979.661] -- 0:00:47
      227500 -- [-979.698] (-977.932) (-977.993) (-977.333) * (-984.568) (-978.750) [-977.310] (-977.593) -- 0:00:47
      228000 -- [-977.775] (-979.590) (-977.383) (-978.219) * (-981.483) [-979.467] (-977.188) (-977.826) -- 0:00:47
      228500 -- (-979.201) [-981.303] (-979.826) (-978.908) * (-984.812) [-977.728] (-977.875) (-977.615) -- 0:00:47
      229000 -- [-979.300] (-981.538) (-980.827) (-978.949) * (-987.380) (-979.541) (-981.115) [-979.926] -- 0:00:47
      229500 -- [-980.612] (-978.558) (-980.779) (-978.977) * [-979.198] (-982.109) (-982.439) (-978.614) -- 0:00:47
      230000 -- [-978.617] (-978.542) (-979.154) (-984.214) * (-977.676) [-982.140] (-981.561) (-977.557) -- 0:00:46

      Average standard deviation of split frequencies: 0.024524

      230500 -- (-977.705) (-979.253) (-977.883) [-977.438] * (-981.174) [-978.330] (-980.571) (-978.130) -- 0:00:46
      231000 -- (-979.515) (-978.483) [-978.589] (-977.027) * (-980.472) [-984.829] (-978.542) (-979.966) -- 0:00:46
      231500 -- (-977.574) (-979.794) (-979.194) [-977.309] * (-981.363) (-982.961) (-982.916) [-978.350] -- 0:00:46
      232000 -- (-979.806) [-979.379] (-977.586) (-977.673) * (-977.382) (-978.526) (-978.314) [-977.414] -- 0:00:46
      232500 -- (-976.880) (-980.745) [-977.673] (-978.589) * [-977.828] (-982.150) (-978.219) (-981.310) -- 0:00:46
      233000 -- (-980.080) (-977.445) [-977.920] (-980.877) * [-976.748] (-980.202) (-979.027) (-977.654) -- 0:00:46
      233500 -- (-979.316) (-981.732) (-977.336) [-981.851] * (-979.151) [-977.405] (-983.936) (-980.451) -- 0:00:45
      234000 -- [-977.646] (-978.193) (-978.374) (-980.153) * (-979.640) (-977.130) [-977.887] (-978.726) -- 0:00:45
      234500 -- (-983.609) (-981.256) [-979.110] (-977.409) * (-980.380) [-979.190] (-980.080) (-980.568) -- 0:00:48
      235000 -- [-978.212] (-980.480) (-979.835) (-977.437) * (-978.221) [-978.556] (-985.773) (-982.757) -- 0:00:48

      Average standard deviation of split frequencies: 0.024205

      235500 -- (-979.415) (-983.283) (-978.218) [-978.350] * (-979.238) (-979.130) (-982.295) [-979.675] -- 0:00:48
      236000 -- (-977.663) (-981.558) (-978.529) [-983.153] * (-978.308) [-978.039] (-977.560) (-981.115) -- 0:00:48
      236500 -- [-976.734] (-982.245) (-978.608) (-981.901) * (-978.149) (-979.028) (-977.425) [-977.086] -- 0:00:48
      237000 -- [-977.597] (-977.170) (-979.540) (-979.736) * [-977.454] (-979.216) (-978.293) (-977.401) -- 0:00:48
      237500 -- [-980.596] (-979.255) (-979.098) (-984.395) * [-977.116] (-980.268) (-983.288) (-981.624) -- 0:00:48
      238000 -- [-980.820] (-979.371) (-980.602) (-982.315) * [-976.687] (-979.898) (-981.611) (-978.380) -- 0:00:48
      238500 -- (-977.884) [-979.604] (-979.783) (-979.946) * (-980.864) (-981.359) [-977.716] (-977.816) -- 0:00:47
      239000 -- [-978.077] (-980.384) (-977.989) (-980.295) * (-978.680) [-979.156] (-980.764) (-978.664) -- 0:00:47
      239500 -- [-977.568] (-980.213) (-979.457) (-983.916) * [-978.290] (-976.861) (-980.796) (-978.864) -- 0:00:47
      240000 -- (-979.717) (-977.651) (-980.341) [-980.936] * (-979.725) (-979.423) (-977.558) [-979.272] -- 0:00:47

      Average standard deviation of split frequencies: 0.021892

      240500 -- (-980.598) [-979.125] (-983.524) (-978.006) * [-979.305] (-980.418) (-980.737) (-978.857) -- 0:00:47
      241000 -- (-977.674) [-980.625] (-980.572) (-977.863) * (-980.829) (-981.817) (-978.315) [-979.827] -- 0:00:47
      241500 -- (-979.139) (-980.642) (-978.279) [-978.590] * (-979.652) (-978.442) [-978.252] (-978.420) -- 0:00:47
      242000 -- [-977.587] (-979.508) (-980.077) (-980.618) * (-978.384) (-976.740) [-978.249] (-983.394) -- 0:00:46
      242500 -- (-979.372) (-978.986) (-981.371) [-979.175] * (-980.274) (-982.873) [-977.875] (-979.803) -- 0:00:46
      243000 -- [-981.107] (-978.839) (-982.647) (-979.067) * (-977.338) [-977.492] (-978.156) (-977.976) -- 0:00:46
      243500 -- (-980.132) [-979.976] (-982.233) (-978.714) * (-980.767) (-977.728) [-977.456] (-979.670) -- 0:00:46
      244000 -- (-981.826) (-978.285) (-983.896) [-981.761] * (-981.308) [-980.465] (-977.929) (-978.102) -- 0:00:46
      244500 -- [-982.244] (-978.902) (-981.953) (-980.373) * (-984.595) (-981.113) (-980.650) [-979.649] -- 0:00:46
      245000 -- (-980.469) (-978.589) [-985.944] (-978.808) * (-985.472) (-979.741) (-977.238) [-980.472] -- 0:00:46

      Average standard deviation of split frequencies: 0.020854

      245500 -- (-979.072) [-980.178] (-978.646) (-980.148) * (-980.594) (-978.033) (-977.855) [-979.271] -- 0:00:46
      246000 -- (-978.196) (-982.112) [-980.406] (-978.259) * (-979.390) (-978.612) [-981.042] (-982.049) -- 0:00:45
      246500 -- [-978.734] (-982.935) (-980.784) (-978.897) * (-978.655) [-980.023] (-978.457) (-981.609) -- 0:00:45
      247000 -- (-977.679) (-980.531) [-980.892] (-978.297) * (-978.689) [-979.939] (-978.495) (-983.094) -- 0:00:45
      247500 -- (-977.079) [-977.262] (-980.846) (-983.711) * (-977.430) [-977.746] (-977.182) (-980.842) -- 0:00:45
      248000 -- (-977.850) (-977.331) (-979.385) [-977.842] * (-977.058) [-978.442] (-977.710) (-978.729) -- 0:00:45
      248500 -- (-977.309) (-980.079) (-979.319) [-977.946] * [-978.000] (-977.455) (-977.872) (-981.769) -- 0:00:45
      249000 -- (-978.409) [-977.599] (-978.616) (-978.672) * [-979.508] (-977.819) (-980.086) (-982.908) -- 0:00:45
      249500 -- (-978.742) [-978.997] (-978.987) (-981.742) * (-978.963) (-977.935) [-980.544] (-980.247) -- 0:00:45
      250000 -- (-978.276) [-977.681] (-979.985) (-977.761) * (-980.941) (-977.713) [-979.840] (-979.693) -- 0:00:45

      Average standard deviation of split frequencies: 0.021000

      250500 -- (-979.620) [-979.067] (-978.887) (-979.019) * (-980.367) (-979.723) [-980.239] (-980.421) -- 0:00:47
      251000 -- (-977.257) (-980.295) (-977.759) [-984.102] * [-977.461] (-978.744) (-979.545) (-979.994) -- 0:00:47
      251500 -- (-979.243) (-981.608) (-983.029) [-980.183] * [-979.856] (-982.020) (-979.189) (-978.803) -- 0:00:47
      252000 -- (-983.173) [-977.428] (-981.191) (-979.404) * [-977.321] (-981.038) (-976.969) (-978.731) -- 0:00:47
      252500 -- (-979.694) [-977.428] (-979.460) (-979.306) * [-984.223] (-978.359) (-983.313) (-978.565) -- 0:00:47
      253000 -- (-978.269) [-978.179] (-978.501) (-979.515) * (-976.679) (-980.570) [-977.651] (-978.398) -- 0:00:47
      253500 -- (-979.643) (-979.909) (-978.279) [-980.534] * (-977.417) (-977.907) (-978.879) [-977.595] -- 0:00:47
      254000 -- (-981.024) (-978.780) [-977.012] (-978.502) * [-977.334] (-978.661) (-977.767) (-981.403) -- 0:00:46
      254500 -- (-982.354) [-977.089] (-978.363) (-981.872) * (-976.742) (-979.444) (-978.877) [-978.578] -- 0:00:46
      255000 -- (-979.685) (-977.848) (-984.643) [-981.769] * (-977.066) (-978.777) (-978.013) [-981.881] -- 0:00:46

      Average standard deviation of split frequencies: 0.021483

      255500 -- (-980.357) [-977.638] (-979.799) (-980.122) * (-977.069) [-978.634] (-979.707) (-979.083) -- 0:00:46
      256000 -- (-978.332) [-978.496] (-979.425) (-979.998) * (-977.921) (-977.059) (-979.077) [-977.272] -- 0:00:46
      256500 -- (-980.549) (-977.402) (-979.064) [-979.593] * (-977.769) (-976.942) [-979.723] (-977.785) -- 0:00:46
      257000 -- (-978.298) (-977.396) (-983.342) [-977.501] * (-977.668) (-978.313) (-981.323) [-977.818] -- 0:00:46
      257500 -- (-978.535) (-979.429) [-981.147] (-981.901) * (-978.775) [-979.110] (-978.669) (-976.975) -- 0:00:46
      258000 -- (-978.083) (-979.769) [-977.588] (-982.665) * [-978.238] (-979.747) (-981.046) (-977.668) -- 0:00:46
      258500 -- (-979.067) (-983.281) [-978.454] (-979.956) * [-981.115] (-979.009) (-979.026) (-982.860) -- 0:00:45
      259000 -- [-980.590] (-982.912) (-978.174) (-978.432) * (-985.737) (-980.060) [-978.058] (-979.364) -- 0:00:45
      259500 -- (-982.180) [-981.199] (-980.857) (-979.245) * (-981.722) (-981.004) [-977.964] (-977.402) -- 0:00:45
      260000 -- (-978.347) [-978.416] (-979.117) (-978.664) * (-980.800) (-981.452) (-980.394) [-978.277] -- 0:00:45

      Average standard deviation of split frequencies: 0.020940

      260500 -- (-979.047) (-981.913) (-978.491) [-980.471] * [-980.831] (-979.262) (-980.308) (-980.376) -- 0:00:45
      261000 -- (-980.431) (-981.013) (-978.714) [-978.139] * (-979.142) (-981.275) (-981.241) [-981.275] -- 0:00:45
      261500 -- (-978.175) (-981.516) [-978.840] (-977.847) * [-977.544] (-977.418) (-980.732) (-979.582) -- 0:00:45
      262000 -- (-977.046) (-978.905) [-982.418] (-978.496) * (-978.434) (-979.063) (-979.519) [-978.188] -- 0:00:45
      262500 -- (-977.277) (-979.108) [-979.767] (-979.317) * (-977.203) [-979.884] (-978.914) (-979.933) -- 0:00:44
      263000 -- (-980.254) [-979.156] (-979.183) (-980.654) * (-978.806) (-981.283) (-979.828) [-978.865] -- 0:00:44
      263500 -- (-983.915) (-980.711) (-983.216) [-978.813] * [-980.032] (-977.452) (-978.832) (-977.340) -- 0:00:44
      264000 -- (-980.776) (-979.721) [-979.036] (-978.412) * (-978.661) [-978.735] (-977.660) (-978.830) -- 0:00:44
      264500 -- (-981.011) (-978.596) (-979.774) [-978.215] * [-978.416] (-982.003) (-981.265) (-977.827) -- 0:00:44
      265000 -- [-977.734] (-978.646) (-980.738) (-978.467) * (-978.461) (-981.470) (-977.974) [-979.196] -- 0:00:44

      Average standard deviation of split frequencies: 0.019587

      265500 -- [-977.011] (-980.417) (-981.187) (-978.409) * (-979.007) (-983.451) (-977.844) [-977.970] -- 0:00:44
      266000 -- (-976.992) (-980.482) (-978.064) [-978.526] * (-979.917) (-983.656) [-977.284] (-977.334) -- 0:00:44
      266500 -- (-979.044) (-980.981) [-980.124] (-979.516) * (-977.963) (-980.025) (-980.130) [-977.947] -- 0:00:44
      267000 -- (-978.985) (-978.503) [-980.325] (-977.741) * (-980.302) (-981.404) (-977.106) [-980.167] -- 0:00:46
      267500 -- [-977.255] (-978.485) (-981.433) (-977.745) * [-978.510] (-978.677) (-980.783) (-977.637) -- 0:00:46
      268000 -- (-977.231) [-981.155] (-979.016) (-977.991) * (-978.912) (-978.308) [-977.697] (-977.477) -- 0:00:46
      268500 -- [-977.502] (-981.231) (-978.324) (-979.319) * [-976.807] (-978.532) (-979.924) (-987.608) -- 0:00:46
      269000 -- (-977.711) (-981.104) (-979.839) [-978.531] * (-983.196) (-983.322) (-977.445) [-979.398] -- 0:00:46
      269500 -- [-977.998] (-978.351) (-982.617) (-979.148) * (-983.271) (-980.750) [-978.090] (-982.576) -- 0:00:46
      270000 -- (-979.035) (-977.568) (-978.322) [-977.756] * (-985.597) (-980.239) [-978.185] (-978.003) -- 0:00:45

      Average standard deviation of split frequencies: 0.019250

      270500 -- (-979.144) (-978.016) (-979.333) [-977.955] * (-979.937) [-980.036] (-977.857) (-978.965) -- 0:00:45
      271000 -- (-977.653) (-978.000) [-981.124] (-981.405) * (-983.217) (-978.608) [-977.994] (-978.093) -- 0:00:45
      271500 -- (-981.704) (-978.655) [-979.750] (-980.159) * (-981.129) (-982.314) [-980.728] (-981.768) -- 0:00:45
      272000 -- [-981.122] (-978.260) (-981.290) (-983.495) * [-978.398] (-979.498) (-979.536) (-981.251) -- 0:00:45
      272500 -- (-980.957) (-981.079) [-977.984] (-979.325) * (-979.160) [-979.631] (-977.136) (-980.463) -- 0:00:45
      273000 -- (-978.069) [-978.328] (-977.592) (-981.045) * (-980.080) (-978.145) (-978.001) [-978.758] -- 0:00:45
      273500 -- (-980.789) (-980.641) (-976.926) [-977.977] * (-979.196) (-978.287) [-977.877] (-977.647) -- 0:00:45
      274000 -- (-983.136) (-980.798) (-981.175) [-980.406] * (-977.865) [-978.590] (-985.745) (-978.891) -- 0:00:45
      274500 -- (-980.356) [-978.553] (-979.665) (-978.824) * (-979.095) (-978.296) [-981.167] (-980.052) -- 0:00:44
      275000 -- (-981.185) [-979.571] (-979.383) (-979.670) * (-977.452) (-979.214) [-980.921] (-979.491) -- 0:00:44

      Average standard deviation of split frequencies: 0.020586

      275500 -- (-982.425) [-980.210] (-980.538) (-978.503) * [-978.904] (-979.376) (-980.194) (-979.442) -- 0:00:44
      276000 -- (-981.847) [-980.564] (-980.386) (-976.943) * [-980.262] (-981.142) (-977.919) (-978.797) -- 0:00:44
      276500 -- [-979.569] (-977.993) (-979.607) (-979.063) * (-986.738) (-979.829) (-978.376) [-978.978] -- 0:00:44
      277000 -- (-981.279) (-978.741) (-980.087) [-981.563] * (-985.991) (-978.661) (-978.483) [-978.867] -- 0:00:44
      277500 -- [-979.170] (-979.803) (-981.355) (-984.233) * [-979.453] (-977.409) (-980.073) (-980.083) -- 0:00:44
      278000 -- (-978.673) (-977.827) (-980.376) [-979.624] * (-982.391) (-976.951) (-978.360) [-979.126] -- 0:00:44
      278500 -- (-979.027) (-977.822) (-980.366) [-979.934] * (-980.264) (-977.129) [-978.669] (-979.488) -- 0:00:44
      279000 -- [-978.869] (-981.852) (-979.908) (-982.387) * (-979.164) (-979.676) (-979.792) [-979.208] -- 0:00:43
      279500 -- (-979.853) [-979.020] (-985.199) (-982.154) * [-979.386] (-979.894) (-979.460) (-980.922) -- 0:00:43
      280000 -- (-979.739) [-980.083] (-983.524) (-978.561) * [-978.733] (-978.750) (-978.464) (-981.527) -- 0:00:43

      Average standard deviation of split frequencies: 0.019713

      280500 -- (-980.058) (-980.171) (-977.140) [-977.552] * (-980.948) (-980.270) [-978.844] (-982.421) -- 0:00:43
      281000 -- (-985.524) (-979.936) [-978.687] (-979.371) * [-981.387] (-979.527) (-980.882) (-979.203) -- 0:00:43
      281500 -- (-977.719) [-981.727] (-979.133) (-978.194) * [-979.462] (-978.533) (-982.301) (-977.726) -- 0:00:43
      282000 -- (-979.443) (-977.999) [-979.132] (-977.066) * [-983.552] (-977.444) (-978.179) (-979.467) -- 0:00:43
      282500 -- (-982.511) [-977.537] (-978.266) (-978.333) * [-980.961] (-979.268) (-977.660) (-980.989) -- 0:00:43
      283000 -- (-980.189) (-980.617) (-978.318) [-978.230] * (-979.449) (-979.023) [-977.705] (-977.444) -- 0:00:43
      283500 -- [-980.463] (-980.867) (-978.132) (-980.343) * (-979.018) [-984.118] (-978.383) (-979.882) -- 0:00:45
      284000 -- [-978.563] (-977.180) (-977.804) (-977.693) * (-977.509) [-980.497] (-977.331) (-981.293) -- 0:00:45
      284500 -- (-979.224) (-980.427) [-977.804] (-978.294) * (-977.180) (-980.674) [-977.261] (-981.680) -- 0:00:45
      285000 -- (-977.607) [-983.660] (-981.666) (-979.180) * [-977.081] (-978.281) (-978.080) (-981.803) -- 0:00:45

      Average standard deviation of split frequencies: 0.019953

      285500 -- (-979.233) (-978.358) [-982.168] (-978.874) * (-977.982) [-977.508] (-977.679) (-979.987) -- 0:00:45
      286000 -- (-981.707) [-978.688] (-979.070) (-984.985) * (-977.360) (-982.215) [-977.148] (-980.832) -- 0:00:44
      286500 -- (-981.798) (-977.589) (-978.838) [-978.452] * (-981.034) [-979.894] (-976.935) (-978.966) -- 0:00:44
      287000 -- (-978.494) [-977.692] (-977.091) (-977.395) * (-984.332) (-979.946) (-977.835) [-977.287] -- 0:00:44
      287500 -- (-977.855) [-978.175] (-977.411) (-977.803) * (-983.156) (-982.906) (-977.701) [-977.504] -- 0:00:44
      288000 -- (-978.180) (-979.788) [-979.625] (-978.567) * [-978.212] (-982.143) (-977.824) (-979.947) -- 0:00:44
      288500 -- [-979.789] (-978.320) (-979.362) (-978.161) * [-978.341] (-979.433) (-981.292) (-979.834) -- 0:00:44
      289000 -- (-977.371) (-978.124) (-980.226) [-978.173] * [-979.400] (-983.256) (-979.603) (-979.679) -- 0:00:44
      289500 -- (-980.374) (-977.487) (-981.682) [-977.984] * (-978.212) (-978.379) (-978.965) [-981.935] -- 0:00:44
      290000 -- (-981.511) [-981.029] (-979.789) (-978.019) * (-977.621) (-977.186) (-978.686) [-981.835] -- 0:00:44

      Average standard deviation of split frequencies: 0.020002

      290500 -- (-983.336) (-980.150) (-979.502) [-978.892] * (-980.259) [-978.430] (-978.686) (-981.341) -- 0:00:43
      291000 -- (-980.607) (-979.235) [-977.887] (-980.289) * (-982.044) (-977.196) [-980.067] (-981.229) -- 0:00:43
      291500 -- [-977.294] (-979.751) (-977.461) (-980.821) * (-982.537) (-977.257) (-978.883) [-979.744] -- 0:00:43
      292000 -- (-979.615) [-978.195] (-977.924) (-979.559) * [-979.621] (-977.340) (-978.149) (-978.771) -- 0:00:43
      292500 -- [-977.040] (-977.690) (-978.218) (-985.471) * (-980.180) (-979.752) (-978.448) [-980.623] -- 0:00:43
      293000 -- (-977.920) [-977.723] (-978.405) (-978.511) * [-978.939] (-979.705) (-980.435) (-981.044) -- 0:00:43
      293500 -- (-978.931) (-979.109) (-979.732) [-978.994] * [-977.870] (-983.308) (-978.955) (-979.590) -- 0:00:43
      294000 -- (-979.665) (-978.313) (-981.895) [-977.634] * (-977.786) (-978.251) [-977.536] (-977.898) -- 0:00:43
      294500 -- [-977.487] (-977.234) (-981.446) (-977.547) * (-978.273) [-980.100] (-980.273) (-979.944) -- 0:00:43
      295000 -- (-978.323) (-977.993) (-977.492) [-980.247] * [-980.734] (-979.496) (-977.039) (-981.936) -- 0:00:43

      Average standard deviation of split frequencies: 0.019614

      295500 -- (-981.900) [-982.202] (-977.834) (-982.080) * (-978.713) (-978.937) (-979.603) [-985.003] -- 0:00:42
      296000 -- (-980.787) (-979.666) [-978.366] (-978.812) * (-978.110) [-978.546] (-977.640) (-979.563) -- 0:00:42
      296500 -- (-977.137) (-981.882) (-978.341) [-977.270] * [-977.564] (-977.955) (-977.375) (-979.158) -- 0:00:42
      297000 -- (-978.883) (-978.138) (-981.625) [-979.044] * (-979.177) [-977.818] (-980.245) (-977.977) -- 0:00:42
      297500 -- [-979.582] (-977.669) (-979.792) (-980.093) * (-978.555) [-977.622] (-979.796) (-976.837) -- 0:00:42
      298000 -- [-977.985] (-980.529) (-980.678) (-980.624) * (-978.410) (-978.240) [-979.112] (-981.137) -- 0:00:42
      298500 -- (-980.157) (-979.634) [-977.390] (-982.189) * [-978.891] (-978.874) (-981.221) (-977.947) -- 0:00:42
      299000 -- (-977.439) (-981.433) [-979.943] (-980.676) * [-981.916] (-978.432) (-978.267) (-978.216) -- 0:00:42
      299500 -- (-979.685) (-977.310) [-979.122] (-979.535) * (-978.712) (-980.048) [-980.448] (-982.808) -- 0:00:42
      300000 -- [-982.021] (-978.269) (-981.441) (-976.880) * (-978.411) (-980.320) [-980.567] (-981.015) -- 0:00:44

      Average standard deviation of split frequencies: 0.019337

      300500 -- (-982.595) (-977.245) [-978.383] (-976.842) * [-981.295] (-980.297) (-981.422) (-979.859) -- 0:00:44
      301000 -- (-979.843) (-977.151) (-981.905) [-988.809] * (-981.047) [-978.119] (-981.446) (-983.416) -- 0:00:44
      301500 -- (-979.184) (-977.678) (-979.459) [-978.202] * (-979.736) [-979.642] (-980.718) (-983.375) -- 0:00:44
      302000 -- [-978.936] (-977.924) (-980.862) (-978.631) * (-979.975) (-979.258) [-977.990] (-982.785) -- 0:00:43
      302500 -- (-984.363) (-978.735) [-978.279] (-983.428) * [-979.385] (-980.486) (-979.200) (-980.668) -- 0:00:43
      303000 -- (-978.189) (-978.081) (-978.263) [-983.536] * (-988.769) [-979.370] (-977.883) (-979.147) -- 0:00:43
      303500 -- (-980.621) (-978.022) [-977.590] (-978.115) * [-977.434] (-977.635) (-977.971) (-982.389) -- 0:00:43
      304000 -- (-979.097) (-978.317) [-980.672] (-979.408) * [-978.899] (-978.490) (-979.415) (-981.837) -- 0:00:43
      304500 -- [-978.694] (-979.408) (-980.081) (-979.601) * [-980.745] (-979.732) (-977.113) (-978.022) -- 0:00:43
      305000 -- (-981.800) [-981.090] (-981.407) (-978.300) * (-979.714) [-980.506] (-977.029) (-978.919) -- 0:00:43

      Average standard deviation of split frequencies: 0.018649

      305500 -- (-979.737) (-978.945) [-978.487] (-978.301) * [-977.512] (-979.434) (-977.566) (-977.591) -- 0:00:43
      306000 -- (-981.911) (-979.074) (-978.352) [-981.915] * (-981.332) (-980.337) [-978.928] (-980.160) -- 0:00:43
      306500 -- (-978.586) (-977.542) (-977.894) [-983.154] * (-983.270) [-980.215] (-980.146) (-978.235) -- 0:00:42
      307000 -- (-977.505) (-983.544) (-977.885) [-981.751] * [-978.101] (-977.484) (-981.839) (-981.189) -- 0:00:42
      307500 -- (-977.221) (-978.556) (-977.549) [-980.479] * [-978.849] (-977.989) (-982.773) (-979.485) -- 0:00:42
      308000 -- (-978.279) [-977.636] (-977.492) (-983.625) * (-977.977) [-978.126] (-979.039) (-979.487) -- 0:00:42
      308500 -- (-977.997) (-980.501) [-979.286] (-979.735) * (-980.555) [-976.877] (-980.152) (-979.210) -- 0:00:42
      309000 -- (-978.008) (-978.044) (-977.722) [-979.347] * (-978.193) (-977.735) (-981.222) [-978.653] -- 0:00:42
      309500 -- (-978.044) (-978.721) (-979.719) [-979.717] * (-979.718) (-977.671) (-977.117) [-978.783] -- 0:00:42
      310000 -- (-977.238) (-979.897) [-979.012] (-979.211) * (-978.596) (-979.127) [-978.418] (-981.383) -- 0:00:42

      Average standard deviation of split frequencies: 0.018848

      310500 -- (-976.984) (-977.800) (-983.980) [-982.109] * (-979.016) [-977.629] (-979.845) (-978.882) -- 0:00:42
      311000 -- (-978.912) (-977.937) (-980.877) [-984.123] * (-978.334) [-978.259] (-978.442) (-978.182) -- 0:00:42
      311500 -- (-981.188) (-979.821) (-984.412) [-980.554] * [-978.035] (-979.177) (-978.554) (-980.751) -- 0:00:41
      312000 -- (-979.204) (-982.914) [-982.491] (-979.015) * [-977.630] (-978.856) (-980.904) (-980.529) -- 0:00:41
      312500 -- (-978.854) (-983.533) (-978.300) [-981.299] * (-976.748) (-978.883) (-981.236) [-979.306] -- 0:00:41
      313000 -- (-978.931) [-980.704] (-979.334) (-979.578) * [-976.982] (-984.489) (-978.794) (-979.250) -- 0:00:41
      313500 -- (-978.110) (-981.442) (-977.601) [-979.812] * [-977.681] (-981.548) (-980.466) (-979.226) -- 0:00:41
      314000 -- [-977.656] (-980.852) (-979.847) (-980.633) * (-981.123) (-982.252) (-982.522) [-981.148] -- 0:00:41
      314500 -- [-977.597] (-978.985) (-980.194) (-979.274) * [-980.237] (-982.044) (-977.122) (-981.679) -- 0:00:41
      315000 -- (-977.733) (-978.337) (-977.262) [-978.514] * (-978.523) (-983.209) (-977.638) [-979.893] -- 0:00:41

      Average standard deviation of split frequencies: 0.017666

      315500 -- (-978.521) (-977.748) [-977.270] (-976.753) * (-980.510) (-979.989) (-982.085) [-977.536] -- 0:00:41
      316000 -- (-978.601) (-978.712) (-978.167) [-977.009] * (-979.072) (-977.788) (-978.969) [-977.721] -- 0:00:43
      316500 -- (-977.858) (-983.587) [-978.475] (-978.138) * (-980.992) (-978.781) (-980.020) [-977.332] -- 0:00:43
      317000 -- (-985.656) (-979.787) [-977.795] (-979.180) * [-980.542] (-982.051) (-979.239) (-979.765) -- 0:00:43
      317500 -- [-978.727] (-982.257) (-979.430) (-981.245) * (-980.613) (-979.375) [-978.011] (-979.004) -- 0:00:42
      318000 -- [-981.316] (-984.398) (-980.252) (-980.246) * (-982.029) (-981.425) (-978.457) [-979.236] -- 0:00:42
      318500 -- (-984.763) (-982.983) [-978.555] (-980.881) * [-983.551] (-982.363) (-980.680) (-980.264) -- 0:00:42
      319000 -- (-983.308) (-981.003) (-978.137) [-981.053] * (-980.046) (-980.216) (-982.774) [-980.754] -- 0:00:42
      319500 -- (-981.037) (-981.502) (-978.122) [-980.874] * [-978.358] (-980.289) (-978.570) (-978.901) -- 0:00:42
      320000 -- (-982.885) (-980.241) (-977.846) [-983.340] * (-978.975) (-980.507) [-977.249] (-979.065) -- 0:00:42

      Average standard deviation of split frequencies: 0.018028

      320500 -- (-979.785) [-977.424] (-978.774) (-983.282) * (-977.667) [-978.153] (-978.753) (-978.070) -- 0:00:42
      321000 -- (-978.930) (-978.446) [-982.470] (-978.270) * (-976.779) (-977.968) (-978.652) [-977.397] -- 0:00:42
      321500 -- (-977.503) [-978.599] (-978.171) (-977.974) * (-978.426) (-981.387) (-978.752) [-977.500] -- 0:00:42
      322000 -- (-978.423) [-979.789] (-981.772) (-978.745) * (-983.414) (-981.368) [-980.576] (-979.953) -- 0:00:42
      322500 -- (-978.498) (-980.207) (-977.644) [-979.958] * (-977.899) (-981.723) (-979.233) [-977.837] -- 0:00:42
      323000 -- (-978.787) (-982.053) (-980.097) [-981.913] * (-979.020) (-977.184) (-979.480) [-981.053] -- 0:00:41
      323500 -- [-980.061] (-978.263) (-977.974) (-977.496) * (-977.729) (-977.572) (-978.674) [-979.064] -- 0:00:41
      324000 -- (-979.276) (-977.156) [-977.508] (-979.352) * [-978.213] (-978.556) (-978.263) (-977.815) -- 0:00:41
      324500 -- (-979.422) [-977.733] (-983.466) (-977.379) * (-981.051) (-977.608) (-977.903) [-978.670] -- 0:00:41
      325000 -- (-982.992) [-981.596] (-980.528) (-977.798) * (-981.737) (-979.437) [-978.791] (-978.326) -- 0:00:41

      Average standard deviation of split frequencies: 0.016439

      325500 -- (-978.986) [-979.178] (-978.387) (-977.244) * (-979.445) (-982.903) (-985.167) [-979.756] -- 0:00:41
      326000 -- (-979.113) [-979.175] (-981.477) (-977.087) * (-979.599) (-981.488) [-977.461] (-980.370) -- 0:00:41
      326500 -- (-976.889) (-981.306) [-978.596] (-976.949) * (-979.137) (-979.559) [-979.863] (-980.238) -- 0:00:41
      327000 -- (-977.150) (-981.705) (-977.138) [-978.002] * [-978.732] (-979.793) (-977.697) (-977.742) -- 0:00:41
      327500 -- (-977.636) (-989.009) (-977.482) [-978.428] * (-977.343) (-979.174) (-978.362) [-976.722] -- 0:00:41
      328000 -- [-980.657] (-978.933) (-977.287) (-978.204) * [-980.935] (-978.088) (-978.187) (-977.460) -- 0:00:40
      328500 -- (-982.078) (-979.212) [-978.066] (-981.394) * (-979.942) (-980.296) [-978.730] (-978.458) -- 0:00:40
      329000 -- [-980.764] (-978.998) (-979.679) (-978.981) * (-980.703) [-978.269] (-978.567) (-977.863) -- 0:00:40
      329500 -- [-978.439] (-978.603) (-979.960) (-980.040) * [-979.446] (-977.803) (-977.692) (-979.703) -- 0:00:40
      330000 -- (-978.491) (-977.579) (-977.164) [-983.795] * (-977.533) [-980.524] (-978.551) (-978.131) -- 0:00:40

      Average standard deviation of split frequencies: 0.017266

      330500 -- (-977.175) [-977.302] (-977.674) (-977.256) * [-978.651] (-978.876) (-979.875) (-979.250) -- 0:00:40
      331000 -- [-977.795] (-978.330) (-979.625) (-979.370) * (-983.012) [-982.652] (-981.193) (-979.325) -- 0:00:40
      331500 -- (-978.059) (-977.298) [-978.858] (-981.126) * (-977.760) (-980.744) (-977.930) [-978.412] -- 0:00:40
      332000 -- (-979.061) (-977.625) (-978.715) [-978.919] * [-976.851] (-978.844) (-980.145) (-981.456) -- 0:00:40
      332500 -- (-981.165) [-978.440] (-985.293) (-979.308) * [-978.260] (-977.445) (-978.043) (-978.428) -- 0:00:42
      333000 -- (-981.655) (-979.059) [-976.869] (-978.908) * [-978.218] (-977.671) (-977.805) (-980.557) -- 0:00:42
      333500 -- (-978.903) (-983.359) [-976.864] (-978.706) * [-978.137] (-978.611) (-978.471) (-979.097) -- 0:00:41
      334000 -- (-977.500) (-981.999) (-977.475) [-978.811] * (-980.690) [-979.746] (-978.118) (-977.976) -- 0:00:41
      334500 -- (-980.245) (-980.405) (-978.422) [-977.147] * (-977.353) (-982.147) (-977.436) [-982.542] -- 0:00:41
      335000 -- (-979.978) (-977.253) [-977.865] (-979.173) * (-978.272) (-979.617) (-977.130) [-978.441] -- 0:00:41

      Average standard deviation of split frequencies: 0.016680

      335500 -- [-978.889] (-977.339) (-979.668) (-979.152) * (-978.388) (-978.942) [-977.464] (-978.506) -- 0:00:41
      336000 -- (-980.321) (-977.536) (-976.970) [-978.591] * (-980.416) [-977.439] (-977.494) (-977.204) -- 0:00:41
      336500 -- (-978.727) [-979.807] (-978.361) (-978.598) * (-979.897) (-980.791) [-977.264] (-977.198) -- 0:00:41
      337000 -- [-978.218] (-977.389) (-981.864) (-977.374) * [-978.537] (-983.460) (-977.264) (-977.747) -- 0:00:41
      337500 -- (-977.801) (-978.081) [-977.277] (-978.865) * (-978.595) (-977.958) (-977.011) [-977.327] -- 0:00:41
      338000 -- (-978.176) (-981.856) [-978.620] (-978.510) * (-979.809) (-978.569) [-981.697] (-978.771) -- 0:00:41
      338500 -- (-981.535) [-982.256] (-980.350) (-980.442) * (-979.950) (-980.035) (-977.933) [-978.322] -- 0:00:41
      339000 -- (-980.696) (-979.297) [-980.113] (-979.099) * (-981.788) (-978.952) (-979.570) [-980.452] -- 0:00:40
      339500 -- (-979.943) (-980.721) (-978.448) [-977.100] * (-979.784) (-977.709) [-979.432] (-977.638) -- 0:00:40
      340000 -- [-979.666] (-979.370) (-980.310) (-977.846) * (-978.669) (-979.443) (-978.923) [-977.880] -- 0:00:40

      Average standard deviation of split frequencies: 0.016442

      340500 -- (-979.898) [-978.967] (-980.753) (-980.218) * (-977.759) [-978.249] (-986.015) (-981.417) -- 0:00:40
      341000 -- (-979.926) [-979.401] (-980.446) (-978.067) * (-978.044) [-978.729] (-978.770) (-979.047) -- 0:00:40
      341500 -- (-979.435) (-983.266) (-977.781) [-977.990] * (-979.218) (-977.300) (-977.695) [-977.588] -- 0:00:40
      342000 -- (-983.991) (-980.033) [-980.569] (-979.869) * (-978.996) (-982.334) (-977.720) [-981.159] -- 0:00:40
      342500 -- (-978.213) [-978.661] (-978.193) (-976.955) * (-979.750) (-978.497) [-978.589] (-979.724) -- 0:00:40
      343000 -- (-978.951) (-978.772) [-979.506] (-977.633) * (-980.388) [-978.508] (-978.495) (-978.601) -- 0:00:40
      343500 -- [-979.240] (-977.630) (-979.094) (-977.679) * (-982.863) (-978.588) (-979.365) [-981.003] -- 0:00:40
      344000 -- (-978.188) (-978.071) [-977.510] (-979.177) * (-983.427) [-983.583] (-979.260) (-979.024) -- 0:00:40
      344500 -- [-980.115] (-984.308) (-977.705) (-977.238) * (-977.748) [-978.423] (-979.417) (-981.297) -- 0:00:39
      345000 -- [-979.391] (-981.062) (-979.061) (-977.879) * [-977.876] (-981.088) (-981.772) (-979.389) -- 0:00:39

      Average standard deviation of split frequencies: 0.015868

      345500 -- (-977.856) [-978.476] (-978.596) (-977.482) * (-978.770) [-980.421] (-980.264) (-978.845) -- 0:00:39
      346000 -- (-977.218) (-982.350) [-978.736] (-977.621) * (-978.259) (-979.100) (-977.915) [-978.764] -- 0:00:39
      346500 -- (-976.934) (-980.686) [-978.437] (-979.029) * (-978.824) (-977.085) [-977.631] (-978.539) -- 0:00:39
      347000 -- (-977.674) (-979.193) [-979.424] (-979.647) * (-983.560) (-978.813) (-977.564) [-978.018] -- 0:00:39
      347500 -- (-985.129) (-979.949) (-980.366) [-980.042] * (-982.959) [-977.292] (-981.138) (-980.235) -- 0:00:39
      348000 -- (-982.995) (-980.548) [-977.664] (-978.328) * (-980.637) (-979.556) [-981.086] (-978.195) -- 0:00:39
      348500 -- [-979.314] (-977.423) (-978.500) (-980.905) * (-979.234) (-977.683) (-980.998) [-977.470] -- 0:00:39
      349000 -- (-985.061) (-977.037) (-978.446) [-979.585] * (-979.024) [-978.716] (-983.964) (-977.921) -- 0:00:41
      349500 -- (-978.148) (-977.530) (-977.177) [-979.852] * [-979.001] (-978.775) (-982.520) (-977.556) -- 0:00:40
      350000 -- (-978.146) (-979.245) [-977.629] (-981.358) * (-978.593) (-978.146) (-978.863) [-977.033] -- 0:00:40

      Average standard deviation of split frequencies: 0.016729

      350500 -- (-977.022) (-978.910) [-977.657] (-980.145) * [-978.467] (-978.608) (-978.698) (-977.829) -- 0:00:40
      351000 -- (-980.011) (-979.738) [-978.348] (-977.783) * (-977.155) (-979.842) (-980.961) [-980.231] -- 0:00:40
      351500 -- (-982.324) [-983.699] (-979.627) (-979.088) * (-979.275) [-980.459] (-978.256) (-977.944) -- 0:00:40
      352000 -- (-981.396) (-978.747) [-979.613] (-979.502) * (-980.298) (-988.636) (-979.522) [-979.022] -- 0:00:40
      352500 -- (-978.633) [-979.656] (-982.241) (-977.850) * (-981.359) (-978.397) (-978.977) [-978.584] -- 0:00:40
      353000 -- (-979.029) [-984.834] (-981.661) (-978.390) * (-979.221) (-981.967) [-977.750] (-979.647) -- 0:00:40
      353500 -- [-976.893] (-982.762) (-980.089) (-980.826) * (-980.600) (-978.475) (-979.948) [-980.617] -- 0:00:40
      354000 -- (-982.904) (-982.673) [-981.149] (-978.132) * [-977.880] (-981.088) (-977.628) (-980.414) -- 0:00:40
      354500 -- [-979.490] (-978.474) (-981.535) (-977.406) * [-979.261] (-978.154) (-980.960) (-981.852) -- 0:00:40
      355000 -- (-977.535) (-977.762) (-982.777) [-978.495] * (-981.719) (-977.908) [-978.907] (-979.372) -- 0:00:39

      Average standard deviation of split frequencies: 0.016405

      355500 -- (-978.871) [-978.382] (-978.252) (-978.066) * (-980.209) (-979.446) (-979.215) [-980.709] -- 0:00:39
      356000 -- (-978.310) (-979.454) [-978.461] (-977.550) * [-978.507] (-979.433) (-980.775) (-978.790) -- 0:00:39
      356500 -- (-979.607) [-980.740] (-980.505) (-978.099) * (-978.000) (-978.017) (-980.712) [-979.340] -- 0:00:39
      357000 -- [-977.030] (-980.814) (-979.323) (-983.552) * (-981.302) (-978.765) (-980.766) [-977.823] -- 0:00:39
      357500 -- (-977.903) (-979.012) [-978.361] (-979.204) * (-977.055) [-978.629] (-979.270) (-981.549) -- 0:00:39
      358000 -- (-977.316) (-979.939) (-977.139) [-979.503] * [-977.787] (-978.976) (-979.047) (-980.075) -- 0:00:39
      358500 -- (-978.167) (-977.315) [-979.592] (-982.164) * (-978.466) (-986.347) [-979.631] (-977.433) -- 0:00:39
      359000 -- (-977.059) (-976.914) (-977.115) [-978.334] * (-977.771) (-985.134) [-977.612] (-979.626) -- 0:00:39
      359500 -- [-977.601] (-985.141) (-977.213) (-982.725) * (-979.408) [-977.473] (-978.838) (-979.660) -- 0:00:39
      360000 -- [-979.409] (-977.957) (-978.307) (-979.523) * (-978.870) [-976.885] (-977.888) (-980.393) -- 0:00:39

      Average standard deviation of split frequencies: 0.016300

      360500 -- [-983.058] (-978.928) (-977.569) (-984.130) * [-980.115] (-976.894) (-980.638) (-977.718) -- 0:00:39
      361000 -- (-982.326) [-979.215] (-978.171) (-982.678) * (-979.620) (-977.947) [-979.747] (-978.827) -- 0:00:38
      361500 -- (-981.976) (-983.638) (-980.393) [-982.146] * (-978.202) [-977.730] (-979.390) (-980.189) -- 0:00:38
      362000 -- (-980.146) (-983.446) [-979.821] (-979.649) * (-982.030) [-978.708] (-980.431) (-978.272) -- 0:00:38
      362500 -- (-980.510) (-977.046) (-980.989) [-978.776] * (-980.836) (-977.368) [-979.689] (-981.031) -- 0:00:38
      363000 -- (-981.592) (-978.887) (-977.783) [-979.090] * (-983.009) (-978.287) (-978.688) [-978.392] -- 0:00:38
      363500 -- (-980.586) [-978.073] (-978.386) (-979.759) * (-981.101) (-979.968) [-978.611] (-978.504) -- 0:00:38
      364000 -- (-977.218) [-979.880] (-980.279) (-980.506) * [-979.676] (-978.518) (-978.700) (-979.633) -- 0:00:38
      364500 -- (-978.506) (-978.549) [-980.760] (-979.020) * [-979.931] (-982.130) (-980.198) (-980.082) -- 0:00:38
      365000 -- [-978.677] (-981.237) (-985.617) (-978.319) * (-977.933) [-986.601] (-980.612) (-980.270) -- 0:00:38

      Average standard deviation of split frequencies: 0.015759

      365500 -- (-985.361) (-979.134) (-982.983) [-977.958] * (-978.243) (-980.962) (-985.915) [-978.010] -- 0:00:39
      366000 -- (-982.127) (-980.501) (-979.632) [-978.210] * (-978.751) (-979.147) (-984.258) [-979.928] -- 0:00:39
      366500 -- (-980.818) (-977.979) (-979.469) [-981.992] * (-983.345) (-981.445) [-979.692] (-983.061) -- 0:00:39
      367000 -- (-982.641) (-977.495) [-978.408] (-980.025) * (-981.816) (-981.064) (-979.124) [-980.651] -- 0:00:39
      367500 -- (-980.462) (-979.173) [-977.866] (-980.717) * (-977.999) (-982.307) (-979.298) [-977.473] -- 0:00:39
      368000 -- [-980.197] (-977.116) (-977.055) (-982.483) * (-978.310) [-979.561] (-978.638) (-977.747) -- 0:00:39
      368500 -- [-982.484] (-979.204) (-980.974) (-984.761) * (-979.210) [-980.413] (-978.605) (-979.912) -- 0:00:39
      369000 -- (-979.844) (-979.641) (-981.435) [-982.244] * (-978.793) (-979.491) (-977.379) [-979.003] -- 0:00:39
      369500 -- (-981.504) (-977.775) [-977.950] (-978.089) * (-978.690) [-979.413] (-979.090) (-977.333) -- 0:00:39
      370000 -- [-980.010] (-983.424) (-980.327) (-978.118) * (-977.951) (-980.348) [-977.100] (-981.636) -- 0:00:39

      Average standard deviation of split frequencies: 0.015261

      370500 -- (-979.394) (-980.500) (-980.364) [-978.179] * [-979.954] (-981.917) (-977.571) (-979.904) -- 0:00:39
      371000 -- (-984.765) (-980.500) (-977.913) [-978.016] * (-979.658) (-978.340) [-978.926] (-979.612) -- 0:00:38
      371500 -- (-981.859) [-980.456] (-981.378) (-978.294) * (-979.224) (-980.919) (-977.737) [-977.949] -- 0:00:38
      372000 -- (-982.977) [-977.124] (-979.049) (-978.176) * [-979.395] (-979.110) (-979.085) (-979.029) -- 0:00:38
      372500 -- [-981.159] (-978.198) (-978.655) (-979.246) * (-981.750) [-978.840] (-979.268) (-978.642) -- 0:00:38
      373000 -- (-984.538) [-979.330] (-978.174) (-979.860) * (-982.713) [-980.570] (-977.057) (-977.900) -- 0:00:38
      373500 -- (-985.168) (-977.956) [-976.968] (-980.478) * (-979.687) (-979.589) (-983.053) [-979.351] -- 0:00:38
      374000 -- (-980.796) [-978.395] (-976.968) (-982.301) * [-976.937] (-980.137) (-978.029) (-980.669) -- 0:00:38
      374500 -- (-979.904) (-978.720) (-978.399) [-982.611] * (-979.136) (-977.799) (-978.308) [-977.671] -- 0:00:38
      375000 -- (-981.972) (-977.800) [-977.062] (-978.681) * (-983.475) [-977.204] (-978.547) (-978.422) -- 0:00:38

      Average standard deviation of split frequencies: 0.015811

      375500 -- [-978.854] (-981.416) (-980.277) (-978.850) * (-978.076) [-978.764] (-982.189) (-979.580) -- 0:00:38
      376000 -- (-979.116) (-978.971) [-980.886] (-981.096) * (-979.719) [-980.301] (-978.346) (-976.892) -- 0:00:38
      376500 -- (-980.108) (-979.893) [-979.704] (-980.467) * [-979.350] (-978.425) (-978.382) (-983.957) -- 0:00:38
      377000 -- (-977.822) [-980.756] (-979.885) (-978.020) * (-979.740) (-979.498) [-980.265] (-979.199) -- 0:00:38
      377500 -- (-978.998) (-980.017) (-980.103) [-979.528] * (-977.020) (-978.765) (-979.458) [-980.097] -- 0:00:37
      378000 -- (-980.720) [-979.019] (-982.519) (-980.074) * (-979.465) [-976.827] (-980.413) (-980.516) -- 0:00:37
      378500 -- (-979.870) [-978.505] (-978.033) (-979.342) * [-978.360] (-977.749) (-983.039) (-979.806) -- 0:00:37
      379000 -- (-984.846) (-981.670) [-976.728] (-980.615) * (-978.766) (-978.694) (-978.597) [-981.308] -- 0:00:37
      379500 -- (-979.523) (-981.039) [-976.918] (-978.273) * [-977.219] (-985.679) (-982.902) (-980.536) -- 0:00:37
      380000 -- (-979.345) (-980.470) [-976.936] (-978.450) * (-978.711) (-981.889) (-980.392) [-977.625] -- 0:00:37

      Average standard deviation of split frequencies: 0.014379

      380500 -- (-978.910) (-983.419) [-978.868] (-979.170) * (-980.282) (-981.295) (-979.981) [-977.377] -- 0:00:37
      381000 -- (-979.363) [-978.815] (-977.779) (-977.454) * [-978.486] (-981.024) (-979.705) (-986.452) -- 0:00:37
      381500 -- (-977.517) (-977.248) [-984.092] (-978.613) * (-978.224) (-978.119) [-978.777] (-982.528) -- 0:00:37
      382000 -- [-980.092] (-977.932) (-977.926) (-977.708) * (-977.667) (-980.321) [-977.300] (-978.495) -- 0:00:38
      382500 -- (-978.890) [-980.007] (-980.774) (-979.055) * (-977.671) [-979.520] (-979.078) (-979.076) -- 0:00:38
      383000 -- (-979.590) (-978.876) [-982.709] (-978.235) * (-980.783) (-980.482) (-979.086) [-978.740] -- 0:00:38
      383500 -- (-978.675) (-984.262) [-979.644] (-978.476) * (-983.745) (-978.333) (-978.400) [-978.667] -- 0:00:38
      384000 -- (-978.124) (-981.314) (-976.860) [-977.819] * [-980.683] (-979.739) (-979.038) (-978.720) -- 0:00:38
      384500 -- (-977.579) (-978.305) (-978.499) [-979.130] * (-981.715) (-979.172) (-980.541) [-978.874] -- 0:00:38
      385000 -- (-977.189) (-978.549) [-978.574] (-978.117) * (-982.267) (-980.359) (-977.915) [-982.287] -- 0:00:38

      Average standard deviation of split frequencies: 0.013637

      385500 -- (-978.556) (-981.097) [-979.756] (-978.170) * (-985.030) [-977.500] (-977.224) (-983.668) -- 0:00:38
      386000 -- (-977.378) (-981.355) (-979.506) [-978.142] * (-979.491) [-979.245] (-980.970) (-983.246) -- 0:00:38
      386500 -- (-983.391) (-980.179) [-980.058] (-985.579) * [-978.133] (-981.676) (-978.863) (-983.510) -- 0:00:38
      387000 -- (-981.702) (-980.193) [-979.376] (-985.209) * [-977.431] (-980.717) (-980.937) (-981.871) -- 0:00:38
      387500 -- (-981.445) (-978.927) [-977.678] (-977.308) * (-978.074) (-981.604) (-985.464) [-978.683] -- 0:00:37
      388000 -- (-978.816) (-976.948) [-977.964] (-979.335) * [-978.787] (-982.935) (-978.642) (-977.153) -- 0:00:37
      388500 -- (-979.841) [-978.443] (-979.447) (-978.155) * [-978.409] (-982.898) (-977.053) (-977.756) -- 0:00:37
      389000 -- [-979.787] (-980.492) (-979.352) (-978.929) * (-981.132) [-977.605] (-978.854) (-977.604) -- 0:00:37
      389500 -- (-979.666) (-979.065) (-979.308) [-979.685] * (-979.266) (-980.066) [-980.902] (-977.141) -- 0:00:37
      390000 -- (-979.320) (-981.453) [-977.485] (-976.971) * (-979.986) [-977.543] (-977.523) (-977.457) -- 0:00:37

      Average standard deviation of split frequencies: 0.013877

      390500 -- (-978.373) [-982.666] (-977.984) (-977.161) * (-979.479) (-982.503) (-977.310) [-977.042] -- 0:00:37
      391000 -- (-977.707) (-981.291) [-977.959] (-978.277) * (-982.616) [-978.429] (-978.584) (-977.672) -- 0:00:37
      391500 -- (-977.807) [-978.582] (-978.318) (-977.893) * [-981.515] (-983.407) (-978.064) (-977.827) -- 0:00:37
      392000 -- (-978.739) (-977.514) (-980.786) [-978.085] * (-978.928) [-980.602] (-982.307) (-977.517) -- 0:00:37
      392500 -- (-978.810) (-980.244) (-982.128) [-978.766] * (-979.167) (-980.915) (-980.692) [-977.737] -- 0:00:37
      393000 -- (-979.268) [-977.330] (-978.989) (-977.776) * [-978.566] (-982.737) (-982.572) (-980.829) -- 0:00:37
      393500 -- [-978.155] (-978.951) (-978.618) (-977.734) * [-978.549] (-983.624) (-980.126) (-978.471) -- 0:00:36
      394000 -- [-978.476] (-978.262) (-977.347) (-977.507) * (-979.113) [-977.265] (-979.531) (-978.167) -- 0:00:36
      394500 -- (-979.165) (-978.951) [-978.141] (-977.788) * (-978.167) (-979.103) [-979.902] (-980.394) -- 0:00:36
      395000 -- (-979.132) [-979.387] (-978.686) (-978.989) * (-977.728) [-979.103] (-978.907) (-978.479) -- 0:00:36

      Average standard deviation of split frequencies: 0.013095

      395500 -- (-988.021) [-978.380] (-979.040) (-978.841) * [-979.290] (-976.782) (-976.985) (-978.609) -- 0:00:36
      396000 -- [-987.521] (-979.114) (-978.920) (-978.021) * (-979.209) (-980.652) [-978.134] (-982.923) -- 0:00:36
      396500 -- (-978.374) [-977.892] (-981.089) (-982.997) * (-981.190) (-978.645) (-978.563) [-979.360] -- 0:00:36
      397000 -- (-979.278) (-984.217) [-978.516] (-984.355) * (-980.654) [-979.074] (-977.426) (-977.977) -- 0:00:36
      397500 -- (-979.359) (-978.233) [-978.342] (-977.501) * [-980.946] (-980.109) (-977.466) (-983.170) -- 0:00:36
      398000 -- [-978.895] (-978.294) (-981.396) (-978.743) * (-980.714) [-979.105] (-980.180) (-980.553) -- 0:00:36
      398500 -- (-979.070) (-979.747) (-982.364) [-978.908] * (-981.593) (-977.321) (-980.750) [-977.333] -- 0:00:37
      399000 -- [-979.182] (-981.568) (-978.165) (-979.627) * (-979.941) (-977.389) (-982.990) [-978.373] -- 0:00:37
      399500 -- (-981.639) (-980.909) [-979.411] (-979.794) * (-984.869) [-978.491] (-982.388) (-977.743) -- 0:00:37
      400000 -- (-981.263) (-978.399) [-980.981] (-980.281) * (-978.825) (-977.883) [-977.348] (-981.088) -- 0:00:37

      Average standard deviation of split frequencies: 0.013357

      400500 -- (-982.216) [-978.566] (-987.525) (-980.063) * (-979.094) [-978.916] (-978.495) (-982.892) -- 0:00:37
      401000 -- (-978.449) [-978.680] (-984.932) (-980.144) * (-979.403) (-979.794) (-977.315) [-981.503] -- 0:00:37
      401500 -- (-979.791) [-979.554] (-980.555) (-977.472) * (-979.078) (-980.314) (-978.100) [-978.578] -- 0:00:37
      402000 -- (-978.414) [-978.702] (-978.888) (-981.033) * [-978.940] (-978.816) (-977.524) (-977.635) -- 0:00:37
      402500 -- [-977.587] (-981.603) (-980.621) (-978.086) * (-978.279) (-979.859) [-979.313] (-981.137) -- 0:00:37
      403000 -- [-978.432] (-979.622) (-977.061) (-991.590) * [-978.100] (-980.988) (-979.901) (-981.613) -- 0:00:37
      403500 -- (-979.459) (-979.002) (-977.907) [-978.754] * (-981.584) (-982.737) [-981.074] (-981.993) -- 0:00:36
      404000 -- [-982.308] (-978.293) (-977.016) (-980.407) * [-978.273] (-978.333) (-978.906) (-979.799) -- 0:00:36
      404500 -- (-978.541) [-979.582] (-977.491) (-979.639) * [-978.284] (-977.689) (-978.443) (-977.046) -- 0:00:36
      405000 -- (-978.799) (-977.544) [-978.476] (-986.191) * [-978.149] (-979.750) (-979.698) (-978.370) -- 0:00:36

      Average standard deviation of split frequencies: 0.012191

      405500 -- (-980.007) (-978.197) (-977.668) [-978.940] * (-980.015) (-980.541) [-977.533] (-978.239) -- 0:00:36
      406000 -- (-981.128) [-978.790] (-977.028) (-978.404) * [-978.734] (-980.947) (-978.808) (-980.149) -- 0:00:36
      406500 -- (-978.382) [-980.697] (-981.723) (-977.187) * (-979.673) (-981.277) [-978.100] (-980.116) -- 0:00:36
      407000 -- (-977.179) (-982.106) [-980.421] (-980.526) * (-981.317) [-977.393] (-978.018) (-981.089) -- 0:00:36
      407500 -- (-978.161) (-979.541) (-981.384) [-978.585] * (-980.226) (-977.708) [-977.929] (-983.835) -- 0:00:36
      408000 -- [-979.445] (-982.319) (-981.240) (-979.649) * (-978.751) (-983.249) [-978.749] (-977.618) -- 0:00:36
      408500 -- [-980.757] (-982.865) (-979.794) (-980.217) * (-979.850) (-977.006) [-978.226] (-977.578) -- 0:00:36
      409000 -- (-978.044) (-981.770) [-978.172] (-978.422) * (-976.865) (-977.537) [-977.479] (-978.039) -- 0:00:36
      409500 -- [-978.962] (-980.690) (-977.279) (-978.274) * (-979.802) [-978.395] (-978.380) (-977.151) -- 0:00:36
      410000 -- [-978.222] (-979.097) (-980.934) (-977.218) * [-978.120] (-980.728) (-978.387) (-977.275) -- 0:00:35

      Average standard deviation of split frequencies: 0.012244

      410500 -- (-979.548) (-980.970) (-981.068) [-977.643] * [-978.364] (-978.923) (-978.134) (-977.554) -- 0:00:35
      411000 -- (-980.267) (-979.282) [-978.289] (-978.055) * (-980.904) (-981.330) [-978.609] (-977.893) -- 0:00:35
      411500 -- (-980.117) (-977.307) (-981.388) [-979.375] * [-979.576] (-979.163) (-979.608) (-977.772) -- 0:00:35
      412000 -- [-979.742] (-980.104) (-978.304) (-978.431) * (-978.227) (-978.129) (-977.132) [-981.834] -- 0:00:35
      412500 -- (-981.698) [-979.286] (-980.486) (-982.543) * (-978.907) (-979.325) (-977.930) [-977.999] -- 0:00:35
      413000 -- [-978.858] (-979.958) (-979.325) (-979.933) * (-981.348) [-980.795] (-979.192) (-978.864) -- 0:00:35
      413500 -- (-979.927) [-985.683] (-979.461) (-978.083) * (-977.549) (-979.377) (-979.454) [-977.574] -- 0:00:35
      414000 -- (-979.131) (-982.041) (-981.532) [-981.349] * (-978.177) [-978.142] (-979.575) (-978.537) -- 0:00:35
      414500 -- (-977.958) (-979.131) (-982.196) [-979.309] * (-978.296) [-978.761] (-978.195) (-980.320) -- 0:00:35
      415000 -- (-978.139) (-978.823) (-981.686) [-978.688] * (-979.961) (-978.436) [-978.437] (-980.836) -- 0:00:36

      Average standard deviation of split frequencies: 0.011835

      415500 -- [-979.979] (-981.297) (-977.999) (-977.135) * [-977.510] (-979.273) (-981.375) (-982.046) -- 0:00:36
      416000 -- [-978.606] (-980.944) (-977.088) (-981.093) * [-977.557] (-978.656) (-979.416) (-980.974) -- 0:00:36
      416500 -- [-979.262] (-982.039) (-982.795) (-980.433) * (-978.286) (-978.732) (-979.347) [-983.369] -- 0:00:36
      417000 -- [-979.426] (-979.145) (-984.276) (-978.953) * (-978.434) (-977.494) (-984.316) [-978.360] -- 0:00:36
      417500 -- (-978.372) [-978.114] (-977.051) (-979.614) * [-978.672] (-977.668) (-976.875) (-978.071) -- 0:00:36
      418000 -- (-978.424) [-977.084] (-976.818) (-980.589) * (-980.192) [-979.882] (-980.687) (-978.156) -- 0:00:36
      418500 -- [-977.524] (-977.430) (-976.857) (-981.842) * (-983.105) (-980.222) [-979.019] (-979.520) -- 0:00:36
      419000 -- (-978.122) (-979.776) [-978.897] (-978.933) * [-983.913] (-983.380) (-978.553) (-977.690) -- 0:00:36
      419500 -- (-980.170) (-978.512) (-986.680) [-978.787] * (-979.371) (-981.313) [-983.880] (-977.313) -- 0:00:35
      420000 -- (-983.251) [-980.673] (-980.656) (-978.512) * (-979.467) (-979.055) [-979.691] (-979.885) -- 0:00:35

      Average standard deviation of split frequencies: 0.011393

      420500 -- (-977.622) (-978.513) [-978.157] (-982.267) * [-978.990] (-980.099) (-977.357) (-978.529) -- 0:00:35
      421000 -- (-980.205) (-978.556) [-977.972] (-978.273) * (-979.637) (-980.484) [-977.906] (-978.897) -- 0:00:35
      421500 -- (-979.011) (-979.870) [-978.295] (-978.448) * (-978.240) [-978.321] (-979.025) (-977.957) -- 0:00:35
      422000 -- (-981.009) (-986.052) (-978.993) [-977.905] * (-978.838) [-982.119] (-979.481) (-977.691) -- 0:00:35
      422500 -- (-978.651) (-977.842) (-976.876) [-978.048] * [-979.169] (-980.817) (-980.820) (-978.171) -- 0:00:35
      423000 -- (-977.319) (-981.342) (-978.515) [-979.288] * (-979.977) (-979.129) (-980.866) [-980.909] -- 0:00:35
      423500 -- (-979.030) (-980.270) (-979.655) [-981.706] * (-981.120) (-981.830) (-979.720) [-981.784] -- 0:00:35
      424000 -- (-977.610) (-977.474) (-977.807) [-978.935] * (-983.357) [-978.456] (-977.761) (-980.117) -- 0:00:35
      424500 -- (-979.791) (-978.167) (-977.307) [-978.735] * (-979.565) [-978.117] (-985.371) (-977.382) -- 0:00:35
      425000 -- (-977.070) (-980.638) (-977.417) [-978.992] * (-978.118) [-977.015] (-982.281) (-977.555) -- 0:00:35

      Average standard deviation of split frequencies: 0.011127

      425500 -- (-976.974) [-981.795] (-977.658) (-978.669) * (-978.732) (-981.916) [-979.810] (-978.938) -- 0:00:35
      426000 -- (-978.221) (-978.137) (-977.860) [-979.640] * (-979.390) [-981.222] (-979.279) (-980.529) -- 0:00:35
      426500 -- (-979.603) (-977.911) (-979.576) [-977.918] * (-977.196) (-984.253) (-978.079) [-981.247] -- 0:00:34
      427000 -- [-980.896] (-977.630) (-979.496) (-980.879) * (-978.193) (-978.147) (-979.129) [-980.501] -- 0:00:34
      427500 -- [-982.192] (-979.017) (-982.932) (-978.987) * (-979.522) [-977.813] (-980.496) (-977.434) -- 0:00:34
      428000 -- [-978.891] (-978.858) (-982.358) (-980.404) * (-981.078) (-978.441) [-979.778] (-977.817) -- 0:00:34
      428500 -- (-977.913) [-981.337] (-976.911) (-979.911) * (-980.516) [-978.675] (-981.491) (-983.617) -- 0:00:34
      429000 -- (-979.593) (-979.488) (-980.600) [-978.922] * (-980.976) [-979.632] (-981.398) (-982.147) -- 0:00:34
      429500 -- (-978.761) (-981.921) [-979.828] (-977.496) * (-980.120) [-977.991] (-983.095) (-979.589) -- 0:00:34
      430000 -- (-986.670) (-981.346) (-980.886) [-977.498] * (-980.344) (-978.953) [-978.476] (-980.061) -- 0:00:34

      Average standard deviation of split frequencies: 0.011493

      430500 -- (-978.341) (-980.552) (-980.011) [-982.538] * (-980.181) [-978.162] (-977.904) (-982.238) -- 0:00:34
      431000 -- [-980.718] (-981.042) (-979.010) (-978.138) * (-977.041) (-977.769) (-978.253) [-979.176] -- 0:00:34
      431500 -- (-981.906) (-979.334) (-982.035) [-980.578] * [-977.444] (-982.359) (-980.163) (-980.452) -- 0:00:35
      432000 -- [-977.750] (-977.849) (-985.079) (-978.384) * (-977.420) (-979.157) (-983.824) [-981.601] -- 0:00:35
      432500 -- (-980.243) [-978.446] (-980.159) (-978.397) * (-979.612) (-978.016) (-979.037) [-980.606] -- 0:00:35
      433000 -- (-980.035) (-980.128) (-979.694) [-982.625] * [-979.995] (-977.384) (-977.131) (-981.604) -- 0:00:35
      433500 -- (-979.097) [-979.562] (-979.093) (-978.945) * (-977.888) [-980.306] (-977.769) (-982.151) -- 0:00:35
      434000 -- (-980.988) (-977.230) (-983.364) [-978.682] * [-977.331] (-980.296) (-981.652) (-979.733) -- 0:00:35
      434500 -- [-981.410] (-977.608) (-978.837) (-980.900) * (-977.232) [-978.323] (-982.298) (-980.226) -- 0:00:35
      435000 -- [-981.683] (-978.634) (-977.731) (-980.523) * [-980.266] (-977.561) (-979.627) (-978.656) -- 0:00:35

      Average standard deviation of split frequencies: 0.011473

      435500 -- (-979.289) (-976.977) [-981.853] (-980.401) * (-986.068) (-980.834) (-978.552) [-978.449] -- 0:00:34
      436000 -- (-979.308) (-979.967) [-977.417] (-979.574) * (-977.795) (-981.552) (-978.960) [-977.794] -- 0:00:34
      436500 -- (-978.209) (-980.613) [-982.005] (-978.144) * [-977.835] (-979.526) (-977.713) (-978.868) -- 0:00:34
      437000 -- (-980.144) (-979.970) [-981.786] (-977.508) * (-980.002) (-982.119) (-981.449) [-978.229] -- 0:00:34
      437500 -- (-978.674) (-977.304) (-981.315) [-978.804] * [-977.831] (-980.701) (-980.049) (-977.994) -- 0:00:34
      438000 -- (-979.623) [-979.812] (-979.772) (-977.623) * [-976.972] (-981.358) (-978.423) (-980.615) -- 0:00:34
      438500 -- (-980.230) (-979.647) (-977.844) [-977.623] * [-976.918] (-980.660) (-978.469) (-977.428) -- 0:00:34
      439000 -- (-979.765) (-978.925) (-979.980) [-979.149] * (-977.586) (-978.398) (-978.407) [-977.120] -- 0:00:34
      439500 -- (-978.782) (-977.746) (-983.186) [-980.393] * [-978.713] (-978.173) (-979.542) (-977.779) -- 0:00:34
      440000 -- (-977.735) (-979.393) (-981.239) [-980.647] * [-978.814] (-977.491) (-979.582) (-977.064) -- 0:00:34

      Average standard deviation of split frequencies: 0.011292

      440500 -- (-978.605) (-979.647) [-981.962] (-978.655) * (-980.746) (-978.229) (-984.126) [-977.749] -- 0:00:34
      441000 -- (-977.435) [-978.150] (-978.279) (-977.357) * (-979.764) (-978.559) [-979.644] (-978.239) -- 0:00:34
      441500 -- (-979.045) [-982.686] (-980.092) (-981.346) * [-978.748] (-978.940) (-978.943) (-977.043) -- 0:00:34
      442000 -- [-979.983] (-981.877) (-981.717) (-984.249) * [-977.978] (-979.208) (-979.084) (-977.699) -- 0:00:34
      442500 -- (-978.039) (-979.034) (-981.445) [-977.939] * (-981.464) [-977.744] (-979.000) (-980.732) -- 0:00:34
      443000 -- (-980.374) (-978.951) (-979.833) [-978.598] * (-982.224) (-978.304) [-980.730] (-981.765) -- 0:00:33
      443500 -- (-978.880) [-977.552] (-982.840) (-977.568) * (-982.157) [-978.653] (-981.310) (-983.704) -- 0:00:33
      444000 -- (-979.618) (-980.168) [-978.877] (-977.137) * (-980.089) [-977.926] (-980.579) (-981.454) -- 0:00:33
      444500 -- (-978.759) (-981.519) (-979.655) [-977.504] * (-979.875) [-978.088] (-979.963) (-980.189) -- 0:00:33
      445000 -- [-978.554] (-979.526) (-981.619) (-978.376) * [-978.670] (-979.609) (-980.252) (-977.898) -- 0:00:33

      Average standard deviation of split frequencies: 0.010863

      445500 -- (-980.707) (-978.328) (-980.716) [-981.261] * (-980.328) [-976.903] (-978.104) (-978.123) -- 0:00:33
      446000 -- [-980.126] (-978.781) (-980.035) (-979.776) * (-980.310) [-978.860] (-977.534) (-979.798) -- 0:00:33
      446500 -- (-979.237) (-980.175) (-980.363) [-977.516] * (-978.023) [-978.729] (-977.289) (-978.321) -- 0:00:33
      447000 -- [-978.267] (-980.152) (-987.847) (-977.601) * (-978.031) (-980.030) (-978.512) [-978.888] -- 0:00:33
      447500 -- (-978.768) [-981.161] (-980.044) (-978.090) * [-979.390] (-979.762) (-982.453) (-980.463) -- 0:00:33
      448000 -- (-979.829) (-979.191) [-978.620] (-981.374) * (-981.367) [-980.667] (-981.534) (-976.966) -- 0:00:34
      448500 -- (-984.370) (-980.099) [-979.048] (-978.971) * (-977.705) (-981.637) [-980.112] (-976.966) -- 0:00:34
      449000 -- (-986.388) (-979.951) [-977.427] (-978.181) * [-977.387] (-979.653) (-980.264) (-977.984) -- 0:00:34
      449500 -- [-977.898] (-979.809) (-978.956) (-977.916) * [-977.226] (-980.385) (-981.344) (-977.531) -- 0:00:34
      450000 -- (-977.384) (-978.767) [-979.133] (-977.984) * (-977.446) [-978.507] (-982.406) (-977.972) -- 0:00:34

      Average standard deviation of split frequencies: 0.010693

      450500 -- (-983.012) (-978.562) [-979.100] (-977.610) * [-978.371] (-985.697) (-977.010) (-982.033) -- 0:00:34
      451000 -- (-977.691) (-981.882) [-977.907] (-978.739) * [-980.252] (-979.000) (-979.525) (-977.998) -- 0:00:34
      451500 -- (-982.310) (-981.041) [-976.910] (-978.651) * (-980.871) (-980.581) [-978.387] (-978.184) -- 0:00:34
      452000 -- (-978.180) (-979.744) (-981.436) [-978.743] * (-981.515) (-977.680) [-983.265] (-977.893) -- 0:00:33
      452500 -- (-978.488) (-983.784) (-980.457) [-981.187] * (-978.824) [-977.392] (-977.635) (-977.893) -- 0:00:33
      453000 -- (-980.407) (-979.761) (-979.343) [-977.035] * (-977.619) [-980.981] (-977.987) (-979.290) -- 0:00:33
      453500 -- (-977.907) [-978.761] (-977.518) (-979.393) * (-978.919) (-979.300) [-978.214] (-978.286) -- 0:00:33
      454000 -- (-979.951) [-977.241] (-977.513) (-978.375) * [-977.980] (-976.959) (-977.596) (-979.117) -- 0:00:33
      454500 -- (-978.905) (-977.109) [-977.486] (-983.143) * (-978.710) (-981.246) (-984.118) [-978.505] -- 0:00:33
      455000 -- (-984.745) [-978.985] (-978.600) (-978.045) * (-979.610) (-981.962) (-979.759) [-977.617] -- 0:00:33

      Average standard deviation of split frequencies: 0.009821

      455500 -- (-989.622) (-981.240) [-983.052] (-980.517) * (-978.545) (-982.029) (-980.261) [-978.458] -- 0:00:33
      456000 -- (-983.432) [-978.846] (-980.926) (-980.861) * [-978.507] (-979.346) (-978.066) (-978.736) -- 0:00:33
      456500 -- (-979.173) (-978.807) (-979.025) [-977.210] * (-978.237) [-978.185] (-977.099) (-979.324) -- 0:00:33
      457000 -- (-978.849) (-985.438) [-979.477] (-976.943) * (-977.760) (-977.959) (-979.894) [-978.212] -- 0:00:33
      457500 -- [-978.233] (-985.361) (-977.838) (-978.679) * [-980.836] (-980.898) (-978.909) (-981.422) -- 0:00:33
      458000 -- (-978.077) (-981.361) [-978.519] (-981.448) * [-979.519] (-978.014) (-980.771) (-978.886) -- 0:00:33
      458500 -- (-979.878) (-979.040) (-978.666) [-976.823] * (-980.635) (-978.565) [-980.892] (-982.688) -- 0:00:33
      459000 -- (-980.234) (-978.973) (-980.152) [-977.587] * [-979.737] (-977.813) (-978.812) (-979.117) -- 0:00:33
      459500 -- (-982.837) (-977.992) (-980.202) [-977.741] * (-977.437) [-977.259] (-978.739) (-982.679) -- 0:00:32
      460000 -- [-979.355] (-979.981) (-977.052) (-977.592) * (-979.400) [-977.020] (-980.063) (-977.870) -- 0:00:32

      Average standard deviation of split frequencies: 0.009551

      460500 -- (-983.238) [-978.124] (-978.129) (-978.494) * (-981.533) [-982.190] (-978.391) (-979.374) -- 0:00:32
      461000 -- [-978.838] (-983.461) (-978.407) (-978.785) * (-979.128) [-980.775] (-978.475) (-979.905) -- 0:00:32
      461500 -- (-979.069) (-982.132) (-978.697) [-978.046] * (-980.854) (-982.879) (-978.075) [-980.095] -- 0:00:32
      462000 -- (-979.718) (-980.182) [-977.852] (-977.256) * [-978.651] (-979.515) (-978.685) (-978.018) -- 0:00:32
      462500 -- (-978.316) [-981.088] (-977.955) (-981.149) * (-979.477) (-978.021) (-978.127) [-978.617] -- 0:00:32
      463000 -- (-977.082) (-978.206) [-977.903] (-980.085) * [-978.449] (-977.994) (-977.196) (-978.304) -- 0:00:32
      463500 -- (-978.183) (-977.125) [-979.379] (-982.565) * [-978.065] (-979.460) (-976.829) (-980.401) -- 0:00:32
      464000 -- (-979.827) [-977.800] (-984.065) (-979.369) * (-978.662) (-979.003) [-977.565] (-978.802) -- 0:00:32
      464500 -- [-978.979] (-978.127) (-987.257) (-978.887) * (-982.466) [-980.091] (-978.531) (-977.347) -- 0:00:33
      465000 -- (-978.666) [-978.769] (-978.664) (-977.419) * (-980.720) (-978.898) [-980.239] (-978.925) -- 0:00:33

      Average standard deviation of split frequencies: 0.009329

      465500 -- (-983.158) (-977.636) (-977.391) [-978.368] * [-979.505] (-980.359) (-977.677) (-979.576) -- 0:00:33
      466000 -- (-984.042) [-977.676] (-977.283) (-977.798) * (-982.507) [-980.545] (-979.784) (-979.491) -- 0:00:33
      466500 -- (-983.472) (-978.774) [-981.044] (-981.487) * (-980.725) [-977.887] (-979.387) (-979.419) -- 0:00:33
      467000 -- [-978.600] (-978.218) (-981.770) (-982.233) * (-979.689) [-979.098] (-979.067) (-979.636) -- 0:00:33
      467500 -- (-978.812) (-981.205) (-978.425) [-979.089] * (-977.929) (-977.439) (-978.960) [-979.452] -- 0:00:33
      468000 -- [-979.026] (-979.230) (-979.252) (-979.455) * (-977.118) (-979.530) [-984.213] (-978.404) -- 0:00:32
      468500 -- (-979.141) [-978.969] (-980.202) (-980.201) * [-978.101] (-979.100) (-979.768) (-978.930) -- 0:00:32
      469000 -- (-980.533) (-978.905) [-977.110] (-981.810) * (-979.820) (-978.514) (-977.947) [-976.848] -- 0:00:32
      469500 -- (-978.217) [-978.507] (-982.904) (-978.112) * (-977.664) (-977.297) (-978.411) [-977.392] -- 0:00:32
      470000 -- (-978.200) (-982.072) (-978.104) [-982.108] * (-978.403) (-978.545) (-978.855) [-979.465] -- 0:00:32

      Average standard deviation of split frequencies: 0.008903

      470500 -- (-977.843) (-980.365) [-977.222] (-983.585) * (-981.259) (-983.208) [-979.401] (-983.714) -- 0:00:32
      471000 -- (-979.631) (-980.282) [-977.176] (-981.362) * (-978.754) (-979.427) [-978.984] (-978.515) -- 0:00:32
      471500 -- [-979.843] (-980.920) (-977.535) (-985.432) * (-984.179) (-982.700) [-979.220] (-977.782) -- 0:00:32
      472000 -- (-980.331) [-978.001] (-980.115) (-979.583) * (-980.521) (-981.649) (-977.528) [-977.265] -- 0:00:32
      472500 -- (-980.584) (-978.485) (-980.554) [-978.658] * (-979.065) (-982.052) [-977.576] (-982.168) -- 0:00:32
      473000 -- [-978.678] (-978.822) (-980.559) (-978.496) * (-978.602) (-979.189) [-980.229] (-978.363) -- 0:00:32
      473500 -- (-980.696) [-978.153] (-979.047) (-981.306) * (-981.911) (-983.065) [-978.482] (-977.960) -- 0:00:32
      474000 -- (-979.745) [-984.358] (-982.769) (-979.114) * (-980.051) (-980.010) [-978.663] (-978.464) -- 0:00:32
      474500 -- (-979.019) (-980.680) (-980.722) [-978.425] * (-979.901) [-978.144] (-981.629) (-979.207) -- 0:00:32
      475000 -- (-979.717) (-978.146) (-978.837) [-981.107] * (-982.104) (-977.952) (-979.638) [-982.270] -- 0:00:32

      Average standard deviation of split frequencies: 0.008505

      475500 -- (-982.071) [-980.399] (-979.305) (-978.757) * [-979.465] (-978.595) (-984.293) (-981.013) -- 0:00:31
      476000 -- (-982.011) (-981.176) (-978.687) [-979.321] * (-980.150) [-983.671] (-978.488) (-981.742) -- 0:00:31
      476500 -- (-980.209) (-986.344) (-978.922) [-977.223] * (-980.176) (-980.506) [-980.149] (-976.918) -- 0:00:31
      477000 -- (-981.360) [-982.562] (-980.262) (-976.991) * (-981.332) (-980.234) [-978.794] (-977.621) -- 0:00:31
      477500 -- (-979.821) (-977.117) [-979.820] (-977.574) * (-979.291) (-978.860) [-977.347] (-977.283) -- 0:00:31
      478000 -- (-979.407) [-978.126] (-980.037) (-977.493) * (-978.821) [-980.436] (-977.699) (-984.950) -- 0:00:31
      478500 -- (-979.322) [-977.346] (-981.417) (-978.418) * (-977.959) (-985.493) (-979.100) [-978.258] -- 0:00:31
      479000 -- (-979.943) [-978.285] (-979.057) (-981.065) * (-976.901) (-978.931) (-987.117) [-979.371] -- 0:00:31
      479500 -- (-978.701) (-979.200) (-979.410) [-978.345] * (-977.669) (-977.695) (-983.635) [-977.769] -- 0:00:31
      480000 -- (-979.873) (-979.441) (-979.027) [-979.856] * (-977.324) [-980.989] (-981.367) (-980.200) -- 0:00:31

      Average standard deviation of split frequencies: 0.008134

      480500 -- (-979.797) (-980.172) [-978.170] (-977.598) * (-981.315) (-980.188) (-980.343) [-978.137] -- 0:00:32
      481000 -- (-979.091) (-977.464) [-979.310] (-976.970) * (-982.817) (-980.856) [-980.646] (-978.417) -- 0:00:32
      481500 -- (-979.910) [-977.897] (-978.973) (-977.780) * [-981.102] (-979.991) (-979.477) (-980.397) -- 0:00:32
      482000 -- [-978.384] (-979.327) (-981.735) (-979.382) * (-978.976) (-983.512) [-981.330] (-979.969) -- 0:00:32
      482500 -- (-978.474) (-979.615) [-979.807] (-979.943) * (-979.425) (-980.146) (-983.422) [-977.006] -- 0:00:32
      483000 -- (-977.746) (-981.749) [-977.511] (-978.503) * [-980.458] (-992.374) (-981.557) (-980.482) -- 0:00:32
      483500 -- (-978.160) (-980.356) [-977.877] (-979.297) * (-980.737) [-987.661] (-978.835) (-980.639) -- 0:00:32
      484000 -- (-978.748) (-984.309) [-978.087] (-980.617) * (-981.139) (-984.223) (-978.772) [-977.340] -- 0:00:31
      484500 -- (-984.395) (-980.807) [-979.104] (-980.180) * (-981.656) (-978.697) [-977.705] (-977.281) -- 0:00:31
      485000 -- (-978.871) [-980.613] (-977.739) (-976.978) * (-978.016) (-983.311) (-979.247) [-977.126] -- 0:00:31

      Average standard deviation of split frequencies: 0.008137

      485500 -- (-977.824) (-983.093) [-977.916] (-979.642) * (-977.744) (-980.280) [-978.055] (-979.309) -- 0:00:31
      486000 -- (-982.747) [-979.979] (-980.088) (-983.082) * (-977.986) [-979.579] (-979.334) (-979.107) -- 0:00:31
      486500 -- (-981.315) (-980.349) [-979.642] (-977.139) * [-977.944] (-976.998) (-978.470) (-979.312) -- 0:00:31
      487000 -- (-977.072) [-982.274] (-980.121) (-980.658) * (-980.430) (-978.743) (-979.728) [-979.038] -- 0:00:31
      487500 -- [-980.576] (-981.444) (-985.766) (-980.072) * (-979.085) [-978.081] (-981.935) (-985.391) -- 0:00:31
      488000 -- (-977.122) (-980.671) (-979.394) [-977.955] * (-978.088) [-978.030] (-982.192) (-981.553) -- 0:00:31
      488500 -- [-977.007] (-979.309) (-978.181) (-979.613) * (-981.180) [-978.607] (-978.301) (-979.345) -- 0:00:31
      489000 -- (-976.967) (-979.044) (-979.405) [-978.046] * (-981.115) (-977.958) (-981.364) [-979.401] -- 0:00:31
      489500 -- (-979.374) (-979.233) (-979.001) [-977.459] * (-980.136) [-980.264] (-983.380) (-980.000) -- 0:00:31
      490000 -- (-980.863) (-984.833) (-979.240) [-979.421] * (-978.066) (-979.124) [-980.964] (-982.778) -- 0:00:31

      Average standard deviation of split frequencies: 0.008166

      490500 -- (-979.304) [-986.160] (-978.713) (-977.951) * (-980.329) (-979.489) [-980.331] (-984.023) -- 0:00:31
      491000 -- (-977.133) (-979.928) [-978.087] (-977.200) * (-978.481) [-981.035] (-981.444) (-978.455) -- 0:00:31
      491500 -- (-977.133) [-978.866] (-979.034) (-977.976) * (-978.638) (-978.899) [-978.493] (-980.214) -- 0:00:31
      492000 -- (-977.133) (-978.637) [-979.696] (-978.060) * (-977.841) [-978.175] (-979.729) (-979.113) -- 0:00:30
      492500 -- [-977.133] (-978.148) (-980.777) (-978.687) * [-979.039] (-977.762) (-977.461) (-978.307) -- 0:00:30
      493000 -- (-980.178) (-978.587) [-979.566] (-980.754) * (-978.901) (-980.056) [-977.878] (-978.484) -- 0:00:30
      493500 -- (-978.547) [-978.749] (-977.499) (-979.597) * [-978.043] (-977.661) (-979.328) (-981.308) -- 0:00:30
      494000 -- (-978.123) [-978.219] (-979.754) (-979.221) * (-977.715) (-979.728) (-980.528) [-981.477] -- 0:00:30
      494500 -- (-978.563) (-977.427) [-979.412] (-982.710) * (-977.189) (-981.467) [-977.357] (-979.142) -- 0:00:30
      495000 -- (-980.857) (-978.699) (-983.495) [-979.577] * (-977.395) (-977.361) [-979.170] (-981.213) -- 0:00:30

      Average standard deviation of split frequencies: 0.008945

      495500 -- (-981.113) (-980.751) [-978.908] (-981.139) * (-977.534) [-978.150] (-977.342) (-980.150) -- 0:00:30
      496000 -- (-978.815) (-980.690) [-979.060] (-980.057) * (-979.145) (-977.396) [-978.901] (-984.291) -- 0:00:30
      496500 -- (-979.128) (-977.507) [-978.940] (-978.014) * [-980.419] (-979.143) (-979.960) (-977.768) -- 0:00:30
      497000 -- (-978.462) [-977.112] (-978.744) (-979.484) * (-978.897) [-979.880] (-980.171) (-979.291) -- 0:00:31
      497500 -- (-980.461) (-979.312) (-982.403) [-978.099] * [-978.976] (-980.563) (-981.921) (-981.537) -- 0:00:31
      498000 -- [-980.018] (-982.511) (-983.275) (-978.670) * (-980.581) [-982.472] (-978.673) (-982.382) -- 0:00:31
      498500 -- (-986.145) (-977.851) (-977.786) [-978.198] * (-980.318) (-982.509) (-979.112) [-979.528] -- 0:00:31
      499000 -- (-985.414) (-977.351) [-978.009] (-979.575) * [-979.147] (-978.785) (-983.638) (-979.124) -- 0:00:31
      499500 -- (-986.564) (-978.338) [-977.000] (-986.812) * (-980.302) (-980.181) [-980.438] (-978.148) -- 0:00:31
      500000 -- (-979.006) (-978.200) [-977.995] (-978.159) * [-978.914] (-980.701) (-980.947) (-980.090) -- 0:00:31

      Average standard deviation of split frequencies: 0.009028

      500500 -- (-979.360) (-980.861) [-977.819] (-978.338) * (-979.309) [-978.125] (-979.919) (-979.428) -- 0:00:30
      501000 -- (-980.336) [-979.220] (-979.828) (-978.158) * (-977.923) [-980.316] (-983.117) (-979.510) -- 0:00:30
      501500 -- (-983.268) (-978.368) [-977.858] (-979.153) * (-978.814) (-979.601) [-978.559] (-979.203) -- 0:00:30
      502000 -- (-979.329) (-980.297) (-978.007) [-979.056] * (-978.218) (-980.242) [-978.079] (-977.816) -- 0:00:30
      502500 -- [-979.545] (-980.334) (-978.003) (-979.307) * (-980.899) (-982.596) [-982.739] (-978.486) -- 0:00:30
      503000 -- (-979.779) (-976.898) [-977.267] (-979.305) * (-978.963) (-980.613) [-981.904] (-980.124) -- 0:00:30
      503500 -- [-978.416] (-977.256) (-979.650) (-983.525) * (-978.334) [-978.386] (-985.651) (-978.382) -- 0:00:30
      504000 -- [-978.439] (-978.372) (-980.676) (-985.181) * [-977.891] (-978.839) (-978.970) (-979.910) -- 0:00:30
      504500 -- (-983.902) (-979.061) [-981.362] (-979.376) * (-980.716) (-978.250) [-980.329] (-981.483) -- 0:00:30
      505000 -- [-977.277] (-979.261) (-979.996) (-978.149) * (-983.497) [-977.720] (-984.153) (-982.896) -- 0:00:30

      Average standard deviation of split frequencies: 0.008878

      505500 -- (-977.277) (-982.381) (-983.794) [-979.722] * (-979.861) (-978.006) [-982.595] (-979.025) -- 0:00:30
      506000 -- (-978.353) (-984.639) (-980.394) [-977.763] * (-979.351) (-980.933) (-978.512) [-978.975] -- 0:00:30
      506500 -- (-981.661) (-978.555) (-979.299) [-979.178] * (-979.226) (-978.498) [-977.220] (-981.991) -- 0:00:30
      507000 -- (-979.886) (-979.562) [-978.915] (-978.295) * (-980.318) (-981.571) [-981.095] (-982.851) -- 0:00:30
      507500 -- (-979.903) (-980.616) [-978.399] (-980.021) * [-977.082] (-979.404) (-981.164) (-982.926) -- 0:00:30
      508000 -- [-979.290] (-979.261) (-978.264) (-981.149) * (-979.444) [-978.254] (-982.572) (-978.165) -- 0:00:30
      508500 -- (-982.537) (-980.451) [-978.847] (-978.324) * (-978.068) (-978.766) [-980.057] (-981.144) -- 0:00:29
      509000 -- [-977.768] (-981.041) (-978.323) (-980.374) * [-978.797] (-978.786) (-982.004) (-979.928) -- 0:00:29
      509500 -- (-979.157) [-979.616] (-978.193) (-979.137) * (-978.068) [-978.041] (-981.293) (-979.839) -- 0:00:29
      510000 -- (-979.545) (-979.008) (-977.619) [-979.556] * (-977.863) [-978.383] (-983.067) (-978.364) -- 0:00:29

      Average standard deviation of split frequencies: 0.008797

      510500 -- (-984.350) [-979.463] (-984.088) (-978.986) * (-979.826) (-978.788) (-979.012) [-978.470] -- 0:00:29
      511000 -- [-980.110] (-979.544) (-984.808) (-978.445) * (-978.928) (-983.574) [-981.189] (-977.227) -- 0:00:29
      511500 -- [-978.668] (-979.355) (-983.456) (-980.806) * (-978.762) (-980.343) [-978.182] (-977.405) -- 0:00:29
      512000 -- (-979.127) [-980.116] (-979.262) (-979.612) * (-979.065) [-977.318] (-977.297) (-981.473) -- 0:00:29
      512500 -- (-978.438) (-978.750) [-981.093] (-985.617) * (-979.383) [-977.543] (-978.162) (-977.780) -- 0:00:29
      513000 -- (-979.101) (-981.930) (-979.194) [-980.174] * (-979.529) (-982.838) (-977.491) [-977.779] -- 0:00:29
      513500 -- (-977.453) (-982.112) [-979.194] (-979.640) * [-977.249] (-980.381) (-982.798) (-978.194) -- 0:00:30
      514000 -- [-977.646] (-978.665) (-977.571) (-982.294) * (-978.056) (-982.161) (-980.594) [-980.760] -- 0:00:30
      514500 -- (-978.501) (-977.930) [-978.339] (-980.817) * (-977.265) (-978.771) (-981.879) [-977.457] -- 0:00:30
      515000 -- [-977.946] (-977.664) (-982.568) (-987.233) * (-978.100) (-977.963) (-979.974) [-978.101] -- 0:00:30

      Average standard deviation of split frequencies: 0.008491

      515500 -- (-978.154) (-979.346) [-981.014] (-981.719) * [-977.461] (-978.667) (-981.603) (-979.542) -- 0:00:30
      516000 -- (-980.895) (-985.632) (-981.851) [-980.087] * [-978.954] (-980.399) (-979.982) (-980.713) -- 0:00:30
      516500 -- [-977.870] (-986.931) (-981.972) (-978.597) * (-978.109) (-979.011) (-977.241) [-980.193] -- 0:00:29
      517000 -- (-977.937) (-982.142) [-978.139] (-980.948) * [-978.771] (-979.975) (-978.354) (-984.322) -- 0:00:29
      517500 -- [-978.879] (-978.908) (-979.231) (-979.951) * (-979.145) (-986.719) [-980.037] (-979.997) -- 0:00:29
      518000 -- (-979.062) (-978.282) (-979.486) [-979.013] * (-982.892) (-979.671) [-980.457] (-980.971) -- 0:00:29
      518500 -- [-978.211] (-979.560) (-979.117) (-977.759) * (-984.434) (-980.050) [-977.740] (-980.815) -- 0:00:29
      519000 -- [-980.838] (-978.123) (-980.362) (-979.887) * [-979.195] (-978.436) (-979.262) (-979.970) -- 0:00:29
      519500 -- (-979.572) (-977.792) [-979.083] (-982.038) * (-978.864) (-978.775) [-979.167] (-981.214) -- 0:00:29
      520000 -- (-978.000) [-977.661] (-976.876) (-985.593) * (-984.871) (-979.019) [-978.101] (-978.177) -- 0:00:29

      Average standard deviation of split frequencies: 0.007979

      520500 -- (-985.042) (-978.060) (-981.607) [-979.375] * [-981.480] (-978.510) (-979.767) (-978.649) -- 0:00:29
      521000 -- (-986.714) [-981.113] (-978.768) (-978.036) * [-980.869] (-979.886) (-978.654) (-978.219) -- 0:00:29
      521500 -- (-981.043) (-982.509) [-979.807] (-981.412) * [-981.848] (-980.867) (-979.131) (-978.541) -- 0:00:29
      522000 -- (-979.564) (-978.833) [-979.769] (-977.123) * (-977.785) (-978.552) [-979.358] (-977.866) -- 0:00:29
      522500 -- (-979.196) (-979.313) (-981.132) [-976.878] * (-981.540) (-979.033) (-982.147) [-977.427] -- 0:00:29
      523000 -- (-979.154) (-978.640) [-977.329] (-977.696) * (-980.057) (-978.865) (-979.056) [-977.233] -- 0:00:29
      523500 -- [-979.282] (-977.874) (-979.083) (-981.778) * [-981.553] (-979.072) (-978.531) (-978.125) -- 0:00:29
      524000 -- (-979.261) (-978.186) (-979.514) [-979.385] * (-979.337) [-978.283] (-977.690) (-980.996) -- 0:00:29
      524500 -- (-979.617) (-980.097) (-978.258) [-979.987] * (-978.005) (-979.020) (-979.831) [-978.972] -- 0:00:29
      525000 -- (-978.999) [-978.890] (-980.066) (-982.614) * (-978.803) [-977.759] (-978.730) (-980.132) -- 0:00:28

      Average standard deviation of split frequencies: 0.008013

      525500 -- (-979.556) (-979.985) [-981.120] (-985.356) * (-983.971) (-978.853) [-978.451] (-978.432) -- 0:00:28
      526000 -- (-983.143) [-979.361] (-980.827) (-980.992) * [-978.603] (-978.157) (-978.574) (-979.116) -- 0:00:28
      526500 -- (-981.821) [-977.465] (-979.194) (-983.914) * (-979.547) [-977.470] (-977.138) (-978.670) -- 0:00:28
      527000 -- [-978.199] (-978.446) (-979.196) (-978.559) * (-981.846) (-982.322) (-977.496) [-978.636] -- 0:00:28
      527500 -- (-978.427) (-977.316) [-981.303] (-979.077) * (-977.146) (-977.457) (-977.297) [-982.388] -- 0:00:28
      528000 -- (-978.046) (-977.767) (-980.939) [-979.823] * (-977.092) [-978.956] (-978.658) (-978.941) -- 0:00:28
      528500 -- (-977.601) (-980.808) (-979.514) [-980.074] * (-978.393) [-982.629] (-977.521) (-978.703) -- 0:00:28
      529000 -- (-977.665) (-977.178) [-985.279] (-980.300) * (-977.763) (-978.180) [-978.189] (-978.769) -- 0:00:28
      529500 -- [-980.056] (-979.124) (-979.333) (-978.190) * (-980.301) (-979.427) (-981.716) [-979.913] -- 0:00:28
      530000 -- (-979.808) (-982.539) [-980.786] (-979.080) * [-978.974] (-979.256) (-981.600) (-977.686) -- 0:00:29

      Average standard deviation of split frequencies: 0.008256

      530500 -- (-978.976) [-978.290] (-981.446) (-977.107) * [-978.640] (-979.848) (-984.383) (-979.881) -- 0:00:29
      531000 -- (-978.079) (-977.749) (-980.209) [-979.753] * (-979.490) [-977.884] (-980.032) (-978.781) -- 0:00:29
      531500 -- [-978.750] (-976.978) (-981.370) (-977.497) * (-977.218) [-979.590] (-977.503) (-980.957) -- 0:00:29
      532000 -- (-978.484) [-976.963] (-979.212) (-977.314) * [-977.971] (-979.247) (-980.834) (-978.370) -- 0:00:29
      532500 -- (-976.939) (-977.768) (-982.639) [-976.964] * (-978.075) (-982.383) (-977.838) [-978.037] -- 0:00:28
      533000 -- (-977.086) (-977.770) (-977.734) [-978.189] * (-978.920) (-983.115) (-977.464) [-980.099] -- 0:00:28
      533500 -- (-978.960) [-978.500] (-978.085) (-978.666) * [-977.965] (-978.725) (-979.386) (-981.868) -- 0:00:28
      534000 -- [-977.966] (-979.427) (-977.336) (-978.046) * (-977.500) (-978.391) (-979.105) [-979.993] -- 0:00:28
      534500 -- (-979.177) (-977.277) [-978.545] (-981.828) * (-977.046) (-980.387) [-980.737] (-979.338) -- 0:00:28
      535000 -- (-977.776) (-978.342) [-977.757] (-978.549) * (-978.038) [-980.365] (-980.681) (-978.510) -- 0:00:28

      Average standard deviation of split frequencies: 0.008484

      535500 -- [-976.930] (-978.272) (-978.557) (-977.778) * (-981.980) (-980.244) (-982.328) [-980.379] -- 0:00:28
      536000 -- (-978.516) (-977.727) (-979.902) [-977.358] * [-977.668] (-977.093) (-981.549) (-984.007) -- 0:00:28
      536500 -- [-978.617] (-979.482) (-979.329) (-977.469) * (-977.834) [-981.572] (-978.730) (-978.308) -- 0:00:28
      537000 -- (-977.659) [-978.509] (-981.637) (-978.195) * [-978.338] (-977.319) (-979.153) (-979.566) -- 0:00:28
      537500 -- (-985.106) (-982.676) (-979.456) [-978.077] * (-977.626) (-978.377) (-980.428) [-978.354] -- 0:00:28
      538000 -- [-979.829] (-980.355) (-978.703) (-978.338) * (-979.140) (-980.601) (-981.092) [-977.532] -- 0:00:28
      538500 -- (-980.436) (-982.892) (-978.245) [-978.469] * (-978.244) (-981.218) (-979.417) [-977.427] -- 0:00:28
      539000 -- [-980.953] (-984.969) (-977.453) (-979.227) * [-982.559] (-977.546) (-977.987) (-977.035) -- 0:00:28
      539500 -- (-979.432) (-981.482) (-977.357) [-979.408] * (-980.256) [-977.760] (-981.289) (-978.741) -- 0:00:28
      540000 -- [-978.032] (-979.110) (-978.093) (-979.151) * (-978.602) (-980.488) (-980.227) [-978.389] -- 0:00:28

      Average standard deviation of split frequencies: 0.008514

      540500 -- [-978.900] (-987.039) (-982.100) (-978.722) * (-978.494) (-979.580) (-979.824) [-978.174] -- 0:00:28
      541000 -- [-978.833] (-979.030) (-977.925) (-978.723) * (-978.578) [-977.753] (-980.354) (-983.095) -- 0:00:27
      541500 -- (-978.886) [-980.124] (-979.619) (-977.591) * (-978.472) (-979.532) [-978.032] (-983.279) -- 0:00:27
      542000 -- (-979.546) (-978.844) (-980.153) [-980.000] * (-978.944) (-978.456) (-978.484) [-980.869] -- 0:00:27
      542500 -- [-981.033] (-979.742) (-979.058) (-983.132) * (-982.281) [-979.816] (-981.381) (-981.455) -- 0:00:27
      543000 -- [-982.180] (-977.377) (-978.458) (-978.177) * (-982.416) (-978.588) [-979.300] (-978.760) -- 0:00:27
      543500 -- (-978.768) [-978.733] (-979.053) (-979.654) * (-978.409) (-978.088) (-983.527) [-976.882] -- 0:00:27
      544000 -- (-981.049) [-978.166] (-978.160) (-977.787) * (-982.460) (-977.150) (-978.268) [-976.957] -- 0:00:27
      544500 -- (-978.646) (-982.327) (-978.159) [-981.290] * (-983.885) [-977.934] (-980.357) (-978.950) -- 0:00:27
      545000 -- (-978.939) [-980.523] (-980.362) (-979.758) * (-985.253) (-977.911) [-978.525] (-981.892) -- 0:00:27

      Average standard deviation of split frequencies: 0.007872

      545500 -- (-977.395) [-978.122] (-980.246) (-979.261) * (-978.752) [-978.393] (-980.496) (-979.129) -- 0:00:27
      546000 -- (-978.075) (-981.155) [-979.772] (-980.426) * (-979.441) (-977.796) (-978.866) [-977.747] -- 0:00:27
      546500 -- [-977.601] (-980.335) (-978.877) (-979.317) * (-978.681) (-978.477) (-978.037) [-978.396] -- 0:00:28
      547000 -- [-978.387] (-978.597) (-978.264) (-977.756) * (-979.901) (-977.730) (-979.903) [-978.561] -- 0:00:28
      547500 -- (-979.827) (-977.304) (-979.821) [-981.338] * (-978.410) (-977.429) [-980.588] (-978.896) -- 0:00:28
      548000 -- (-978.769) [-978.820] (-979.327) (-980.250) * (-977.441) (-979.717) (-982.943) [-977.770] -- 0:00:28
      548500 -- (-979.622) (-977.750) [-978.489] (-979.202) * (-979.171) [-978.654] (-978.574) (-981.861) -- 0:00:27
      549000 -- (-984.441) [-978.884] (-977.496) (-977.839) * [-978.214] (-980.562) (-978.830) (-977.974) -- 0:00:27
      549500 -- (-980.295) (-978.197) (-977.487) [-978.474] * (-979.320) [-980.460] (-978.717) (-978.628) -- 0:00:27
      550000 -- (-982.587) (-979.972) [-978.167] (-980.243) * (-979.520) (-979.588) [-979.442] (-977.232) -- 0:00:27

      Average standard deviation of split frequencies: 0.008007

      550500 -- (-977.778) (-979.669) (-979.271) [-977.758] * (-978.856) (-980.553) (-980.172) [-978.785] -- 0:00:27
      551000 -- (-978.245) (-979.490) (-979.827) [-979.922] * (-977.898) (-981.863) [-979.729] (-978.677) -- 0:00:27
      551500 -- (-979.776) (-979.342) (-979.017) [-980.347] * (-977.813) (-977.664) (-979.268) [-977.615] -- 0:00:27
      552000 -- (-979.649) (-978.530) (-979.400) [-977.676] * (-979.273) [-977.496] (-977.882) (-979.385) -- 0:00:27
      552500 -- [-980.083] (-981.917) (-981.019) (-980.351) * (-978.599) (-982.886) [-978.347] (-978.869) -- 0:00:27
      553000 -- (-978.127) [-977.717] (-979.494) (-980.132) * (-979.034) (-980.481) (-978.138) [-977.970] -- 0:00:27
      553500 -- (-980.884) (-980.113) (-978.563) [-977.541] * (-978.899) (-977.864) [-977.788] (-986.042) -- 0:00:27
      554000 -- (-983.042) (-977.347) [-978.575] (-976.945) * (-978.778) (-980.145) [-977.022] (-980.830) -- 0:00:27
      554500 -- [-982.071] (-978.756) (-981.703) (-976.991) * (-978.116) [-979.444] (-978.811) (-979.502) -- 0:00:27
      555000 -- (-978.756) (-978.631) (-982.621) [-976.983] * (-978.591) (-981.963) [-977.589] (-979.212) -- 0:00:27

      Average standard deviation of split frequencies: 0.007331

      555500 -- (-978.376) (-979.447) [-977.563] (-979.184) * [-977.694] (-982.613) (-978.689) (-980.356) -- 0:00:27
      556000 -- (-978.799) (-978.007) (-977.873) [-983.806] * (-984.129) (-984.756) (-980.313) [-979.598] -- 0:00:27
      556500 -- [-977.523] (-977.643) (-978.092) (-978.469) * (-987.472) (-979.821) (-979.642) [-980.296] -- 0:00:27
      557000 -- (-977.071) (-977.045) (-977.980) [-981.950] * (-979.819) [-977.478] (-977.590) (-977.979) -- 0:00:27
      557500 -- (-978.241) [-981.802] (-978.768) (-981.459) * [-977.737] (-980.707) (-980.737) (-978.329) -- 0:00:26
      558000 -- (-978.363) (-978.809) [-978.502] (-979.777) * [-978.389] (-979.096) (-979.918) (-979.186) -- 0:00:26
      558500 -- (-979.985) (-977.155) [-982.307] (-978.485) * (-979.806) (-979.546) (-978.149) [-979.331] -- 0:00:26
      559000 -- (-978.343) [-976.909] (-982.077) (-980.297) * (-979.102) (-981.882) (-978.426) [-979.216] -- 0:00:26
      559500 -- (-980.954) (-982.501) [-979.906] (-980.648) * (-978.942) (-978.721) [-978.930] (-978.114) -- 0:00:26
      560000 -- (-978.914) (-982.422) (-977.829) [-979.782] * (-978.808) [-979.208] (-979.657) (-979.983) -- 0:00:26

      Average standard deviation of split frequencies: 0.007913

      560500 -- (-980.469) [-980.429] (-978.388) (-981.367) * [-978.528] (-980.309) (-982.511) (-982.287) -- 0:00:26
      561000 -- (-978.797) [-978.447] (-977.689) (-980.041) * (-978.582) (-980.495) (-981.794) [-977.145] -- 0:00:26
      561500 -- (-979.099) (-981.919) (-983.261) [-979.060] * (-978.477) (-980.979) [-980.591] (-977.555) -- 0:00:26
      562000 -- (-979.671) (-982.984) (-983.240) [-977.583] * (-980.424) (-983.106) [-978.774] (-977.444) -- 0:00:26
      562500 -- (-979.223) (-977.201) (-984.292) [-978.734] * (-979.739) [-978.775] (-977.815) (-977.686) -- 0:00:26
      563000 -- [-978.259] (-977.633) (-981.054) (-979.848) * (-977.174) [-981.430] (-979.781) (-978.833) -- 0:00:27
      563500 -- (-978.521) (-978.893) [-977.794] (-983.354) * (-979.908) (-982.323) [-981.166] (-978.609) -- 0:00:27
      564000 -- (-982.281) (-977.527) (-978.143) [-984.304] * (-981.951) (-979.685) (-980.225) [-977.670] -- 0:00:27
      564500 -- (-981.050) [-980.721] (-981.849) (-982.652) * [-979.328] (-982.481) (-980.911) (-977.033) -- 0:00:27
      565000 -- (-980.283) (-977.403) (-976.966) [-983.206] * [-977.578] (-980.176) (-979.201) (-980.731) -- 0:00:26

      Average standard deviation of split frequencies: 0.008231

      565500 -- (-979.374) (-977.768) [-976.931] (-979.995) * (-978.970) (-981.309) [-978.365] (-978.630) -- 0:00:26
      566000 -- (-980.243) [-977.888] (-977.503) (-977.337) * (-978.812) (-980.877) (-980.391) [-978.128] -- 0:00:26
      566500 -- [-977.847] (-980.823) (-983.948) (-978.130) * [-978.726] (-977.861) (-982.590) (-977.585) -- 0:00:26
      567000 -- (-978.796) (-981.594) [-981.857] (-979.208) * (-980.210) [-978.378] (-982.347) (-980.360) -- 0:00:26
      567500 -- (-977.936) (-980.303) (-978.366) [-979.612] * [-979.588] (-978.316) (-977.528) (-978.055) -- 0:00:26
      568000 -- (-978.508) [-979.673] (-985.258) (-977.615) * (-984.912) [-978.996] (-978.936) (-978.133) -- 0:00:26
      568500 -- [-977.402] (-978.355) (-979.056) (-978.442) * (-978.534) [-980.434] (-981.354) (-978.177) -- 0:00:26
      569000 -- [-978.543] (-979.856) (-978.360) (-978.150) * [-978.161] (-978.583) (-977.164) (-977.797) -- 0:00:26
      569500 -- (-977.162) (-977.425) [-977.000] (-980.734) * (-979.643) [-980.841] (-979.088) (-979.235) -- 0:00:26
      570000 -- (-979.468) (-980.090) [-977.077] (-978.467) * (-979.737) [-978.460] (-980.061) (-982.215) -- 0:00:26

      Average standard deviation of split frequencies: 0.008504

      570500 -- (-980.272) [-978.210] (-977.653) (-977.913) * (-980.803) [-979.008] (-979.445) (-984.818) -- 0:00:26
      571000 -- (-981.091) (-979.115) [-981.317] (-979.459) * (-980.421) [-980.283] (-978.387) (-980.705) -- 0:00:26
      571500 -- (-978.051) (-978.028) (-983.039) [-981.536] * [-978.208] (-981.480) (-978.366) (-979.158) -- 0:00:26
      572000 -- (-978.394) [-978.173] (-980.039) (-977.882) * (-983.509) (-979.275) [-977.827] (-977.806) -- 0:00:26
      572500 -- [-978.281] (-978.660) (-982.065) (-980.016) * [-979.639] (-977.259) (-982.221) (-978.701) -- 0:00:26
      573000 -- (-982.379) (-979.030) [-979.432] (-978.681) * (-977.818) (-980.565) [-982.612] (-979.554) -- 0:00:26
      573500 -- (-978.884) [-979.054] (-980.424) (-981.142) * [-980.608] (-977.310) (-983.988) (-979.160) -- 0:00:26
      574000 -- [-981.103] (-980.184) (-978.379) (-980.204) * (-981.636) (-981.321) (-977.474) [-978.139] -- 0:00:25
      574500 -- [-981.525] (-980.022) (-980.959) (-979.108) * (-979.709) (-980.535) (-978.450) [-977.214] -- 0:00:25
      575000 -- (-983.606) [-977.978] (-977.494) (-979.070) * (-979.597) (-980.266) [-979.519] (-978.675) -- 0:00:25

      Average standard deviation of split frequencies: 0.008184

      575500 -- (-982.697) [-977.288] (-977.625) (-977.777) * (-980.357) [-977.446] (-978.582) (-978.659) -- 0:00:25
      576000 -- (-977.733) (-977.416) [-977.869] (-977.151) * (-981.438) (-977.306) [-980.442] (-978.245) -- 0:00:25
      576500 -- (-983.894) [-979.086] (-978.265) (-977.010) * (-978.291) (-977.046) [-979.732] (-978.600) -- 0:00:25
      577000 -- (-978.558) (-978.343) (-978.894) [-978.753] * (-978.322) (-978.140) (-979.793) [-977.964] -- 0:00:25
      577500 -- (-977.073) [-977.588] (-978.298) (-978.057) * (-977.389) (-977.893) [-980.746] (-978.342) -- 0:00:25
      578000 -- (-980.376) [-978.121] (-977.885) (-979.565) * (-979.191) (-979.665) (-981.225) [-978.053] -- 0:00:25
      578500 -- [-978.530] (-979.319) (-977.959) (-982.544) * (-980.593) [-979.452] (-983.997) (-978.053) -- 0:00:25
      579000 -- (-977.946) (-978.300) (-981.700) [-977.467] * (-978.224) (-980.034) [-983.184] (-985.559) -- 0:00:25
      579500 -- (-979.611) [-981.412] (-982.887) (-977.814) * (-982.887) [-979.147] (-980.480) (-981.914) -- 0:00:26
      580000 -- (-980.502) [-983.867] (-979.300) (-977.814) * (-981.028) (-981.750) (-980.514) [-981.582] -- 0:00:26

      Average standard deviation of split frequencies: 0.008309

      580500 -- [-979.393] (-977.877) (-978.591) (-977.465) * [-978.394] (-979.534) (-980.650) (-980.052) -- 0:00:26
      581000 -- [-978.642] (-981.283) (-983.295) (-977.660) * [-977.415] (-980.112) (-980.493) (-978.350) -- 0:00:25
      581500 -- (-978.431) [-979.470] (-983.668) (-979.861) * (-979.813) (-977.944) (-977.127) [-978.700] -- 0:00:25
      582000 -- (-977.944) [-979.709] (-980.156) (-980.849) * (-979.395) [-977.527] (-976.817) (-980.584) -- 0:00:25
      582500 -- (-983.608) (-979.069) (-979.413) [-977.595] * (-978.069) (-977.784) [-978.821] (-977.790) -- 0:00:25
      583000 -- (-978.731) [-981.965] (-979.070) (-978.021) * [-978.079] (-978.164) (-978.800) (-981.254) -- 0:00:25
      583500 -- (-984.891) (-979.121) [-981.976] (-978.625) * (-979.785) (-979.582) [-978.378] (-980.504) -- 0:00:25
      584000 -- (-980.371) (-977.351) [-979.020] (-977.984) * (-978.871) (-977.249) (-981.894) [-977.329] -- 0:00:25
      584500 -- (-979.536) (-981.102) [-978.415] (-985.551) * (-978.400) (-979.569) [-978.796] (-978.203) -- 0:00:25
      585000 -- (-977.720) (-977.931) [-978.106] (-983.841) * (-977.816) (-980.350) (-983.173) [-979.448] -- 0:00:25

      Average standard deviation of split frequencies: 0.008660

      585500 -- (-978.527) (-980.382) (-979.502) [-979.783] * (-978.482) (-980.856) (-986.369) [-978.267] -- 0:00:25
      586000 -- [-979.586] (-977.429) (-977.958) (-978.048) * (-977.577) (-980.684) [-980.766] (-978.750) -- 0:00:25
      586500 -- (-979.555) (-978.601) [-979.191] (-980.569) * (-978.542) (-978.326) (-979.020) [-979.344] -- 0:00:25
      587000 -- (-981.943) [-980.176] (-979.210) (-981.730) * (-980.384) (-977.828) [-977.811] (-978.967) -- 0:00:25
      587500 -- (-980.103) (-979.869) (-978.780) [-979.332] * (-982.727) [-982.152] (-977.734) (-977.128) -- 0:00:25
      588000 -- (-979.925) (-984.992) [-978.345] (-979.749) * [-979.997] (-977.654) (-984.919) (-978.985) -- 0:00:25
      588500 -- (-979.990) (-981.346) (-981.609) [-981.491] * (-979.793) (-980.811) (-981.725) [-978.771] -- 0:00:25
      589000 -- (-980.197) [-978.968] (-979.050) (-979.639) * [-981.960] (-977.936) (-978.348) (-979.185) -- 0:00:25
      589500 -- (-978.742) (-978.582) (-977.302) [-979.348] * (-980.728) (-980.597) [-979.485] (-978.533) -- 0:00:25
      590000 -- (-977.721) (-979.392) (-979.662) [-977.724] * (-977.221) [-978.246] (-979.726) (-977.490) -- 0:00:25

      Average standard deviation of split frequencies: 0.008310

      590500 -- (-977.315) (-982.550) (-978.869) [-977.627] * (-979.901) (-980.220) (-980.290) [-979.488] -- 0:00:24
      591000 -- (-978.284) (-989.963) (-979.254) [-978.028] * (-978.218) [-982.711] (-982.535) (-978.884) -- 0:00:24
      591500 -- (-977.201) (-983.251) [-977.677] (-981.110) * [-979.501] (-981.241) (-977.976) (-980.312) -- 0:00:24
      592000 -- (-980.494) (-979.636) [-977.225] (-980.179) * (-978.701) [-979.260] (-979.105) (-980.098) -- 0:00:24
      592500 -- (-978.577) [-977.986] (-977.170) (-981.332) * (-977.233) (-982.131) (-979.911) [-983.171] -- 0:00:24
      593000 -- (-982.865) [-978.749] (-981.676) (-981.666) * (-977.511) (-978.407) (-982.048) [-979.925] -- 0:00:24
      593500 -- (-979.218) (-979.779) [-981.418] (-981.069) * (-979.776) (-977.571) [-977.571] (-978.410) -- 0:00:24
      594000 -- (-978.982) (-980.022) [-979.014] (-977.206) * (-979.205) (-978.646) (-978.312) [-978.520] -- 0:00:24
      594500 -- [-978.075] (-981.197) (-979.020) (-977.213) * [-978.305] (-978.475) (-978.312) (-980.871) -- 0:00:24
      595000 -- (-978.197) (-981.163) (-979.937) [-978.763] * (-978.007) (-977.087) [-979.371] (-981.225) -- 0:00:24

      Average standard deviation of split frequencies: 0.008375

      595500 -- (-979.577) [-980.385] (-978.055) (-978.293) * [-980.022] (-977.096) (-980.156) (-980.283) -- 0:00:24
      596000 -- (-979.509) [-979.329] (-978.095) (-979.313) * (-983.227) (-979.883) (-980.738) [-977.652] -- 0:00:25
      596500 -- (-979.288) (-979.242) (-980.742) [-978.496] * (-977.812) [-977.230] (-979.337) (-979.345) -- 0:00:25
      597000 -- [-979.968] (-978.894) (-979.099) (-979.371) * (-978.091) (-977.314) [-982.005] (-978.278) -- 0:00:24
      597500 -- (-978.670) [-976.742] (-978.031) (-977.316) * (-979.520) (-978.242) (-979.914) [-977.715] -- 0:00:24
      598000 -- (-979.345) (-978.776) (-979.108) [-978.805] * (-980.037) [-979.262] (-979.610) (-978.519) -- 0:00:24
      598500 -- (-978.294) [-977.698] (-977.881) (-977.938) * (-977.921) (-980.096) (-977.076) [-977.265] -- 0:00:24
      599000 -- (-979.708) [-978.555] (-977.785) (-978.648) * (-978.942) [-977.208] (-977.865) (-978.081) -- 0:00:24
      599500 -- (-977.839) (-977.674) [-979.726] (-980.231) * (-977.849) (-978.439) (-979.194) [-977.241] -- 0:00:24
      600000 -- [-980.357] (-982.091) (-977.590) (-981.348) * (-979.659) [-977.036] (-977.704) (-979.312) -- 0:00:24

      Average standard deviation of split frequencies: 0.008402

      600500 -- (-978.364) [-978.922] (-978.325) (-977.531) * (-982.067) (-977.913) [-978.092] (-981.101) -- 0:00:24
      601000 -- [-977.066] (-978.479) (-978.424) (-977.431) * (-979.663) [-978.252] (-982.637) (-979.924) -- 0:00:24
      601500 -- (-978.264) (-981.287) [-978.104] (-981.232) * (-979.588) (-979.861) (-978.571) [-979.912] -- 0:00:24
      602000 -- (-981.110) [-977.926] (-978.585) (-979.324) * (-979.106) [-979.629] (-977.597) (-979.046) -- 0:00:24
      602500 -- (-983.269) (-978.341) [-978.786] (-979.409) * (-978.693) (-979.135) (-979.384) [-977.954] -- 0:00:24
      603000 -- (-979.290) (-980.716) [-981.229] (-979.235) * (-980.228) [-977.611] (-985.082) (-977.842) -- 0:00:24
      603500 -- [-979.541] (-978.583) (-979.757) (-979.642) * (-981.035) [-979.294] (-983.847) (-980.321) -- 0:00:24
      604000 -- (-979.615) (-982.781) (-981.841) [-976.873] * [-978.769] (-982.405) (-982.685) (-978.641) -- 0:00:24
      604500 -- (-980.853) [-978.077] (-988.174) (-981.239) * [-977.575] (-978.833) (-978.508) (-978.132) -- 0:00:24
      605000 -- (-980.259) (-978.755) (-977.602) [-978.863] * [-980.570] (-978.095) (-978.583) (-976.922) -- 0:00:24

      Average standard deviation of split frequencies: 0.008282

      605500 -- (-983.256) [-978.288] (-979.511) (-979.758) * (-980.581) (-979.028) [-977.738] (-979.313) -- 0:00:24
      606000 -- (-981.225) (-979.119) [-978.886] (-981.002) * [-980.738] (-978.700) (-984.021) (-980.174) -- 0:00:24
      606500 -- (-977.538) [-977.707] (-976.924) (-980.678) * (-980.525) (-977.748) (-981.232) [-981.954] -- 0:00:24
      607000 -- (-978.451) [-977.652] (-978.223) (-980.914) * (-985.584) (-978.062) (-983.589) [-978.496] -- 0:00:23
      607500 -- (-978.836) (-978.647) (-978.107) [-977.291] * (-979.487) [-981.085] (-985.384) (-978.584) -- 0:00:23
      608000 -- (-985.385) [-979.329] (-977.745) (-977.538) * (-979.576) (-978.610) (-979.453) [-979.893] -- 0:00:23
      608500 -- (-979.625) (-977.485) [-978.775] (-979.327) * (-978.220) (-982.433) (-980.164) [-979.584] -- 0:00:23
      609000 -- (-978.441) (-979.543) (-981.559) [-980.278] * (-979.065) (-982.010) [-977.367] (-980.937) -- 0:00:23
      609500 -- (-980.016) [-977.250] (-980.244) (-977.691) * (-976.806) (-979.651) (-977.145) [-977.454] -- 0:00:23
      610000 -- (-984.991) [-977.859] (-982.070) (-978.404) * (-978.106) (-978.105) [-978.769] (-980.153) -- 0:00:23

      Average standard deviation of split frequencies: 0.008401

      610500 -- (-978.835) (-979.766) [-980.877] (-980.269) * (-978.666) (-978.581) [-979.344] (-982.267) -- 0:00:23
      611000 -- (-978.645) [-978.593] (-978.641) (-978.588) * [-978.244] (-981.345) (-982.302) (-976.910) -- 0:00:23
      611500 -- [-979.794] (-979.126) (-978.155) (-981.547) * (-980.028) (-980.213) (-981.459) [-977.665] -- 0:00:23
      612000 -- (-981.474) [-978.076] (-978.506) (-978.028) * [-979.152] (-979.694) (-979.336) (-979.402) -- 0:00:24
      612500 -- (-982.584) [-978.877] (-978.437) (-978.463) * [-977.112] (-978.203) (-977.149) (-979.333) -- 0:00:24
      613000 -- (-979.097) [-978.384] (-979.162) (-977.537) * (-977.061) (-977.842) (-978.625) [-979.394] -- 0:00:23
      613500 -- (-979.218) [-978.112] (-978.117) (-977.111) * [-977.313] (-977.273) (-977.763) (-978.780) -- 0:00:23
      614000 -- [-978.583] (-978.222) (-977.646) (-978.406) * (-979.601) (-978.313) (-976.923) [-977.677] -- 0:00:23
      614500 -- (-979.875) (-978.729) (-978.726) [-979.384] * (-977.401) (-980.328) (-976.855) [-977.782] -- 0:00:23
      615000 -- (-977.675) (-977.778) [-978.599] (-979.121) * (-978.738) (-979.772) (-980.702) [-977.188] -- 0:00:23

      Average standard deviation of split frequencies: 0.008328

      615500 -- (-979.514) (-977.612) [-978.655] (-979.872) * (-980.406) (-977.042) [-978.935] (-979.364) -- 0:00:23
      616000 -- (-980.852) (-977.069) (-981.488) [-978.689] * (-977.904) [-977.530] (-981.672) (-979.411) -- 0:00:23
      616500 -- [-978.678] (-977.025) (-981.660) (-978.376) * (-977.643) (-977.432) (-978.605) [-981.595] -- 0:00:23
      617000 -- (-977.244) [-976.780] (-981.572) (-978.840) * (-980.090) (-981.732) (-978.014) [-978.330] -- 0:00:23
      617500 -- (-977.807) (-978.746) (-982.474) [-979.493] * (-980.227) [-981.275] (-980.691) (-979.749) -- 0:00:23
      618000 -- [-977.953] (-981.696) (-977.799) (-980.343) * (-977.650) (-979.135) [-982.702] (-978.654) -- 0:00:23
      618500 -- (-979.888) (-981.138) (-979.985) [-977.458] * (-979.813) (-979.380) (-980.322) [-978.919] -- 0:00:23
      619000 -- (-977.816) (-977.765) [-980.057] (-977.450) * (-980.947) [-978.690] (-983.368) (-981.518) -- 0:00:23
      619500 -- (-978.496) (-979.135) [-978.842] (-978.560) * (-979.226) (-977.684) (-980.240) [-977.768] -- 0:00:23
      620000 -- (-977.876) [-977.919] (-979.500) (-978.269) * (-978.503) (-978.908) (-979.607) [-978.769] -- 0:00:23

      Average standard deviation of split frequencies: 0.008221

      620500 -- (-979.198) (-982.140) (-977.099) [-977.232] * (-980.589) (-978.710) (-979.365) [-979.655] -- 0:00:23
      621000 -- [-979.154] (-980.139) (-976.903) (-978.431) * (-982.161) [-977.639] (-977.084) (-978.628) -- 0:00:23
      621500 -- [-978.825] (-977.924) (-981.040) (-979.653) * (-980.192) (-977.787) [-978.784] (-978.005) -- 0:00:23
      622000 -- (-978.284) (-979.942) (-983.220) [-979.142] * (-982.219) [-979.975] (-977.797) (-977.381) -- 0:00:23
      622500 -- (-977.363) (-987.334) [-979.502] (-978.872) * [-978.138] (-981.369) (-978.179) (-978.602) -- 0:00:23
      623000 -- (-978.865) [-979.921] (-979.925) (-982.160) * [-979.171] (-977.565) (-979.067) (-979.487) -- 0:00:22
      623500 -- (-981.369) (-978.113) [-981.274] (-982.439) * [-977.424] (-979.886) (-978.300) (-978.133) -- 0:00:22
      624000 -- [-978.066] (-978.334) (-980.717) (-980.147) * (-979.737) (-978.291) (-979.184) [-977.618] -- 0:00:22
      624500 -- [-980.488] (-977.967) (-978.111) (-980.010) * (-980.282) (-978.789) (-978.676) [-977.279] -- 0:00:22
      625000 -- (-978.893) [-978.528] (-977.877) (-980.917) * (-980.082) (-977.825) [-980.424] (-981.967) -- 0:00:22

      Average standard deviation of split frequencies: 0.008239

      625500 -- (-980.628) [-978.247] (-977.796) (-977.200) * (-978.858) (-980.226) (-980.621) [-978.491] -- 0:00:22
      626000 -- [-978.125] (-980.499) (-979.425) (-978.761) * (-979.995) (-978.564) (-980.866) [-978.962] -- 0:00:22
      626500 -- [-977.493] (-978.027) (-978.249) (-976.744) * [-977.911] (-982.010) (-980.108) (-978.502) -- 0:00:22
      627000 -- [-980.403] (-977.659) (-980.437) (-978.032) * (-978.091) (-978.394) [-978.193] (-978.624) -- 0:00:22
      627500 -- [-981.138] (-984.303) (-984.368) (-984.811) * [-978.189] (-981.764) (-978.647) (-979.615) -- 0:00:22
      628000 -- (-985.535) (-983.413) (-980.293) [-978.524] * (-978.699) (-983.147) [-977.453] (-979.827) -- 0:00:22
      628500 -- [-982.119] (-979.472) (-980.941) (-979.976) * (-978.314) (-977.359) [-978.115] (-977.876) -- 0:00:22
      629000 -- (-981.003) (-980.997) [-980.778] (-981.032) * (-979.512) (-980.014) [-976.948] (-979.640) -- 0:00:23
      629500 -- [-977.616] (-981.898) (-980.185) (-978.434) * (-982.729) [-984.204] (-977.616) (-978.156) -- 0:00:22
      630000 -- (-977.972) [-978.495] (-978.234) (-978.408) * (-981.631) [-981.147] (-983.495) (-977.858) -- 0:00:22

      Average standard deviation of split frequencies: 0.008662

      630500 -- (-979.852) [-979.916] (-978.215) (-983.417) * [-980.233] (-977.929) (-979.425) (-977.120) -- 0:00:22
      631000 -- (-980.567) [-978.378] (-978.090) (-979.752) * (-981.273) (-978.747) (-982.774) [-976.865] -- 0:00:22
      631500 -- (-977.952) [-982.833] (-977.119) (-981.020) * (-979.249) [-978.993] (-983.870) (-980.043) -- 0:00:22
      632000 -- (-978.817) [-979.607] (-978.338) (-977.945) * (-977.995) (-980.999) (-978.093) [-980.199] -- 0:00:22
      632500 -- (-978.415) (-977.434) (-977.743) [-978.776] * (-977.856) (-983.000) (-981.374) [-977.750] -- 0:00:22
      633000 -- (-978.182) (-977.582) (-977.481) [-978.859] * (-977.760) [-981.860] (-980.325) (-978.517) -- 0:00:22
      633500 -- [-979.400] (-977.595) (-978.015) (-979.524) * [-977.665] (-981.486) (-978.404) (-979.221) -- 0:00:22
      634000 -- (-977.817) (-980.353) (-981.825) [-977.935] * (-981.585) (-980.136) (-978.414) [-978.435] -- 0:00:22
      634500 -- (-977.863) [-979.410] (-978.806) (-979.370) * (-977.484) (-981.399) [-980.262] (-981.614) -- 0:00:22
      635000 -- [-978.567] (-977.780) (-978.824) (-978.629) * (-977.160) (-981.710) (-978.810) [-982.223] -- 0:00:22

      Average standard deviation of split frequencies: 0.008153

      635500 -- [-981.476] (-978.209) (-978.512) (-981.932) * (-977.567) [-978.875] (-976.912) (-983.044) -- 0:00:22
      636000 -- (-978.906) [-979.474] (-977.667) (-978.668) * (-979.029) [-979.435] (-979.878) (-977.663) -- 0:00:22
      636500 -- (-982.385) (-981.394) [-977.754] (-981.536) * [-979.403] (-981.046) (-979.750) (-978.901) -- 0:00:22
      637000 -- (-977.929) [-979.800] (-978.888) (-981.930) * (-979.960) [-977.239] (-978.073) (-978.583) -- 0:00:22
      637500 -- (-977.434) (-977.948) (-983.313) [-979.712] * [-980.915] (-976.981) (-977.391) (-982.385) -- 0:00:22
      638000 -- (-977.934) (-978.985) (-978.987) [-981.581] * (-978.905) (-979.879) [-980.011] (-977.878) -- 0:00:22
      638500 -- (-978.280) (-978.720) (-979.040) [-980.847] * (-977.875) (-979.621) [-981.371] (-978.866) -- 0:00:22
      639000 -- (-977.649) (-981.306) [-979.110] (-978.538) * [-977.431] (-977.308) (-978.142) (-978.154) -- 0:00:22
      639500 -- (-978.430) [-980.625] (-979.388) (-987.956) * (-978.643) (-980.279) [-980.215] (-986.376) -- 0:00:21
      640000 -- [-978.081] (-979.860) (-981.843) (-981.303) * (-978.412) (-979.389) (-978.395) [-982.165] -- 0:00:21

      Average standard deviation of split frequencies: 0.008397

      640500 -- (-977.625) (-978.938) (-986.422) [-978.642] * (-978.491) [-979.456] (-978.588) (-980.025) -- 0:00:21
      641000 -- [-977.078] (-976.764) (-978.386) (-978.728) * (-978.290) (-982.779) (-978.382) [-985.036] -- 0:00:21
      641500 -- (-979.056) (-983.778) (-983.722) [-977.206] * (-980.282) (-980.322) (-981.356) [-980.588] -- 0:00:21
      642000 -- (-979.814) [-979.097] (-982.634) (-977.394) * (-981.252) (-977.414) [-977.126] (-979.463) -- 0:00:21
      642500 -- (-983.759) [-978.838] (-979.115) (-979.035) * (-980.105) [-976.822] (-979.395) (-980.582) -- 0:00:21
      643000 -- (-979.054) (-981.090) [-979.640] (-977.251) * [-979.895] (-979.912) (-979.697) (-981.139) -- 0:00:21
      643500 -- [-978.719] (-981.489) (-978.998) (-978.079) * [-980.645] (-981.576) (-979.144) (-977.557) -- 0:00:21
      644000 -- (-977.651) (-982.185) [-979.139] (-977.079) * (-981.540) [-978.491] (-978.982) (-977.552) -- 0:00:21
      644500 -- (-979.778) (-979.741) [-981.979] (-979.514) * (-980.220) (-980.573) [-980.233] (-977.330) -- 0:00:21
      645000 -- (-981.241) (-977.824) [-981.321] (-977.309) * (-980.207) (-979.730) (-978.510) [-980.920] -- 0:00:22

      Average standard deviation of split frequencies: 0.008255

      645500 -- [-978.749] (-983.926) (-981.714) (-978.280) * (-978.617) (-980.416) (-978.585) [-979.186] -- 0:00:21
      646000 -- [-981.717] (-978.210) (-982.469) (-981.228) * (-981.612) (-980.426) (-978.753) [-978.655] -- 0:00:21
      646500 -- (-979.519) [-977.360] (-980.469) (-980.992) * [-980.850] (-983.885) (-980.305) (-981.302) -- 0:00:21
      647000 -- (-978.451) (-978.866) (-982.647) [-978.544] * (-984.254) (-978.863) [-978.244] (-982.299) -- 0:00:21
      647500 -- [-978.216] (-979.806) (-980.227) (-977.327) * [-979.694] (-978.334) (-978.975) (-978.229) -- 0:00:21
      648000 -- (-978.210) (-977.886) (-978.660) [-978.733] * (-980.138) (-977.822) [-977.422] (-977.600) -- 0:00:21
      648500 -- (-977.596) [-978.139] (-981.790) (-978.247) * (-979.468) (-978.094) [-981.112] (-981.021) -- 0:00:21
      649000 -- (-978.369) (-979.934) [-979.474] (-978.835) * (-978.363) (-982.162) [-977.171] (-977.296) -- 0:00:21
      649500 -- (-980.305) (-979.809) [-977.636] (-979.466) * [-979.550] (-986.102) (-977.065) (-981.503) -- 0:00:21
      650000 -- (-979.282) (-977.233) [-980.625] (-978.123) * [-979.212] (-980.058) (-978.571) (-980.780) -- 0:00:21

      Average standard deviation of split frequencies: 0.007562

      650500 -- (-979.682) (-977.217) [-977.954] (-977.999) * (-981.231) (-979.730) (-981.473) [-980.272] -- 0:00:21
      651000 -- (-978.422) [-978.543] (-977.708) (-984.537) * (-979.578) (-978.114) [-979.389] (-979.216) -- 0:00:21
      651500 -- (-979.604) [-980.720] (-977.431) (-979.367) * (-980.308) (-977.421) [-978.069] (-978.545) -- 0:00:21
      652000 -- (-979.357) (-977.727) (-977.407) [-978.985] * (-980.275) (-977.456) [-977.302] (-979.334) -- 0:00:21
      652500 -- (-979.277) (-980.629) (-979.446) [-978.112] * (-977.825) (-979.228) [-978.655] (-977.933) -- 0:00:21
      653000 -- (-979.578) (-980.243) [-978.743] (-979.199) * (-978.266) (-979.547) [-979.113] (-979.375) -- 0:00:21
      653500 -- (-978.249) (-984.367) [-983.545] (-977.442) * [-981.385] (-978.705) (-978.622) (-977.033) -- 0:00:21
      654000 -- [-981.033] (-983.725) (-982.808) (-978.159) * (-979.485) (-978.913) [-978.495] (-978.196) -- 0:00:21
      654500 -- (-979.291) (-987.029) (-980.006) [-977.783] * (-981.705) [-978.773] (-980.878) (-977.607) -- 0:00:21
      655000 -- [-981.415] (-980.353) (-981.728) (-979.451) * (-980.222) (-978.574) [-978.281] (-979.197) -- 0:00:21

      Average standard deviation of split frequencies: 0.007411

      655500 -- [-978.406] (-981.379) (-979.476) (-979.715) * [-978.006] (-982.396) (-980.886) (-977.526) -- 0:00:21
      656000 -- (-978.832) (-978.449) [-980.961] (-978.666) * (-978.119) (-983.861) [-977.835] (-977.685) -- 0:00:20
      656500 -- (-978.999) (-984.466) (-978.433) [-979.224] * (-980.276) (-977.753) (-978.754) [-977.829] -- 0:00:20
      657000 -- (-978.567) (-980.792) [-978.259] (-979.383) * [-980.820] (-977.807) (-979.408) (-978.481) -- 0:00:20
      657500 -- (-978.570) (-980.163) [-979.544] (-977.530) * (-977.146) (-981.868) [-978.431] (-980.333) -- 0:00:20
      658000 -- (-979.891) (-980.111) (-979.286) [-978.779] * (-977.703) (-980.019) [-978.029] (-980.890) -- 0:00:20
      658500 -- (-979.478) (-981.506) [-978.148] (-978.285) * (-978.948) (-979.291) [-977.172] (-977.275) -- 0:00:20
      659000 -- (-980.765) [-980.846] (-979.531) (-979.469) * [-979.707] (-981.776) (-977.358) (-978.332) -- 0:00:20
      659500 -- (-978.169) [-979.675] (-977.924) (-988.921) * [-979.776] (-979.693) (-979.630) (-978.257) -- 0:00:20
      660000 -- (-978.851) (-979.603) (-980.270) [-981.880] * (-979.452) (-978.741) [-978.949] (-982.286) -- 0:00:20

      Average standard deviation of split frequencies: 0.007983

      660500 -- (-980.726) [-978.902] (-979.201) (-979.469) * [-981.074] (-980.715) (-978.256) (-982.163) -- 0:00:20
      661000 -- (-978.724) [-978.648] (-978.831) (-983.440) * [-978.489] (-978.108) (-978.802) (-978.357) -- 0:00:20
      661500 -- (-978.826) (-979.838) (-977.969) [-982.845] * (-979.158) [-980.386] (-978.103) (-978.610) -- 0:00:20
      662000 -- [-979.397] (-980.059) (-977.859) (-977.539) * [-982.099] (-980.547) (-979.351) (-984.592) -- 0:00:20
      662500 -- (-979.880) (-978.164) (-978.200) [-978.715] * (-981.837) (-978.220) (-977.214) [-982.580] -- 0:00:20
      663000 -- (-980.373) [-978.801] (-979.483) (-982.896) * (-980.861) (-978.656) (-980.770) [-978.016] -- 0:00:20
      663500 -- (-985.195) [-978.197] (-977.155) (-980.733) * (-980.677) (-979.633) [-980.053] (-977.566) -- 0:00:20
      664000 -- (-981.545) [-982.651] (-977.301) (-980.387) * (-978.409) (-980.450) (-979.168) [-977.567] -- 0:00:20
      664500 -- (-981.326) (-984.873) (-977.250) [-980.351] * [-979.040] (-977.824) (-981.970) (-977.527) -- 0:00:20
      665000 -- (-979.963) [-978.397] (-977.417) (-980.917) * (-979.981) [-979.037] (-977.548) (-979.255) -- 0:00:20

      Average standard deviation of split frequencies: 0.007828

      665500 -- (-978.036) [-979.175] (-978.288) (-978.470) * (-981.380) (-978.186) [-977.593] (-979.610) -- 0:00:20
      666000 -- [-977.857] (-981.453) (-981.785) (-979.971) * [-981.312] (-977.843) (-980.655) (-979.734) -- 0:00:20
      666500 -- [-977.503] (-978.510) (-977.448) (-980.023) * (-977.721) (-978.486) [-979.584] (-977.936) -- 0:00:20
      667000 -- (-980.895) [-978.838] (-978.306) (-979.118) * (-977.437) (-980.170) [-977.756] (-977.534) -- 0:00:20
      667500 -- (-977.843) (-978.395) [-980.358] (-977.495) * (-981.531) [-977.352] (-983.354) (-977.385) -- 0:00:20
      668000 -- (-981.523) (-977.848) (-987.025) [-978.829] * (-978.880) (-978.038) [-978.082] (-977.621) -- 0:00:20
      668500 -- (-979.625) [-980.211] (-978.503) (-978.036) * (-980.017) (-978.231) (-978.641) [-979.574] -- 0:00:20
      669000 -- (-980.033) (-979.255) (-981.692) [-978.664] * (-979.240) (-979.062) [-977.982] (-979.026) -- 0:00:20
      669500 -- [-980.873] (-978.589) (-978.762) (-980.812) * (-981.598) (-981.057) [-980.865] (-979.955) -- 0:00:20
      670000 -- (-979.580) (-977.950) (-980.812) [-980.749] * [-979.404] (-980.154) (-980.131) (-981.282) -- 0:00:20

      Average standard deviation of split frequencies: 0.007908

      670500 -- [-979.701] (-984.761) (-978.954) (-981.517) * (-982.299) (-977.497) (-981.532) [-979.677] -- 0:00:20
      671000 -- (-978.721) (-980.602) (-981.786) [-980.877] * [-977.208] (-978.243) (-980.185) (-977.902) -- 0:00:20
      671500 -- (-978.929) (-978.485) (-980.685) [-981.815] * [-977.103] (-981.433) (-979.501) (-978.041) -- 0:00:20
      672000 -- (-979.062) (-977.711) [-985.334] (-981.223) * [-978.625] (-978.607) (-978.437) (-979.429) -- 0:00:20
      672500 -- (-979.524) (-977.974) [-978.958] (-978.831) * (-987.400) (-978.688) [-977.783] (-979.253) -- 0:00:19
      673000 -- (-979.658) (-978.712) (-977.560) [-978.307] * (-981.093) (-978.240) (-978.605) [-980.290] -- 0:00:19
      673500 -- (-978.551) (-979.798) (-983.709) [-977.254] * (-983.506) [-978.481] (-978.174) (-979.375) -- 0:00:19
      674000 -- [-980.555] (-981.774) (-983.020) (-978.376) * (-976.864) [-977.396] (-978.870) (-978.226) -- 0:00:19
      674500 -- (-980.467) (-979.047) [-977.157] (-980.084) * (-977.906) [-977.381] (-980.762) (-978.372) -- 0:00:19
      675000 -- (-978.449) (-980.163) (-981.281) [-978.112] * [-977.863] (-977.974) (-984.778) (-979.324) -- 0:00:19

      Average standard deviation of split frequencies: 0.008532

      675500 -- (-979.291) [-977.799] (-977.886) (-978.126) * (-979.291) (-977.494) (-984.243) [-984.717] -- 0:00:19
      676000 -- (-981.038) [-978.457] (-978.714) (-979.269) * [-978.825] (-977.954) (-984.254) (-977.264) -- 0:00:19
      676500 -- [-980.757] (-978.695) (-978.851) (-978.456) * (-979.372) (-980.983) (-979.639) [-980.163] -- 0:00:19
      677000 -- (-979.769) [-979.665] (-978.489) (-979.082) * [-979.335] (-979.054) (-979.864) (-977.638) -- 0:00:19
      677500 -- (-979.369) (-980.585) (-980.006) [-977.415] * (-979.916) (-978.260) (-979.385) [-976.879] -- 0:00:19
      678000 -- [-980.411] (-979.226) (-979.625) (-981.446) * [-976.717] (-979.576) (-978.413) (-977.642) -- 0:00:19
      678500 -- (-981.186) (-980.086) (-979.587) [-980.035] * (-976.899) (-979.522) (-977.891) [-978.790] -- 0:00:19
      679000 -- (-977.853) (-977.161) [-978.275] (-979.617) * (-977.460) (-978.832) [-979.319] (-979.518) -- 0:00:19
      679500 -- (-977.735) (-977.633) (-981.816) [-979.376] * [-976.773] (-980.886) (-979.023) (-979.348) -- 0:00:19
      680000 -- (-979.698) (-979.856) [-979.802] (-981.236) * (-978.841) [-979.623] (-977.809) (-982.489) -- 0:00:19

      Average standard deviation of split frequencies: 0.008527

      680500 -- (-978.191) (-978.526) [-981.476] (-979.391) * (-979.290) (-980.489) [-977.808] (-980.802) -- 0:00:19
      681000 -- [-977.368] (-977.771) (-980.811) (-979.219) * (-979.118) (-981.750) [-977.570] (-983.010) -- 0:00:19
      681500 -- (-979.721) (-977.306) (-979.358) [-977.778] * (-978.815) [-979.277] (-978.995) (-979.479) -- 0:00:19