--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:20:26 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/sodC/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -978.37 -982.21
2 -978.32 -981.88
--------------------------------------
TOTAL -978.34 -982.06
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.883088 0.088960 0.332389 1.450201 0.850294 1266.61 1310.46 1.000
r(A<->C){all} 0.165139 0.019800 0.000070 0.450294 0.127356 145.06 148.87 1.001
r(A<->G){all} 0.162869 0.019262 0.000104 0.444349 0.128510 187.16 260.24 1.000
r(A<->T){all} 0.166939 0.021235 0.000006 0.468323 0.124780 142.27 193.55 1.003
r(C<->G){all} 0.176239 0.022359 0.000019 0.481182 0.135307 210.88 230.67 1.006
r(C<->T){all} 0.168691 0.019481 0.000037 0.452433 0.132259 232.97 257.73 1.000
r(G<->T){all} 0.160124 0.019889 0.000086 0.451582 0.122541 270.32 275.16 1.000
pi(A){all} 0.205712 0.000222 0.175887 0.234366 0.205620 1328.57 1357.39 1.000
pi(C){all} 0.328606 0.000299 0.295388 0.361722 0.328137 1183.03 1275.15 1.000
pi(G){all} 0.287117 0.000276 0.252763 0.317856 0.287100 1265.03 1314.02 1.000
pi(T){all} 0.178565 0.000195 0.149597 0.204997 0.178471 1130.25 1219.72 1.001
alpha{1,2} 0.419459 0.227917 0.000122 1.395508 0.240716 1264.03 1272.21 1.000
alpha{3} 0.449759 0.224121 0.000254 1.400428 0.295382 973.32 994.98 1.000
pinvar{all} 0.997805 0.000007 0.992905 0.999999 0.998662 1344.74 1349.05 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -945.448788
Model 2: PositiveSelection -945.448816
Model 0: one-ratio -945.448834
Model 7: beta -945.448788
Model 8: beta&w>1 -945.448788
Model 0 vs 1 9.1999999995096E-5
Model 2 vs 1 5.599999985861359E-5
Model 8 vs 7 0.0
>C1
MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
>C2
MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
>C3
MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
>C4
MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
>C5
MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
>C6
MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=240
C1 MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
C2 MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
C3 MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
C4 MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
C5 MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
C6 MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
**************************************************
C1 TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
C2 TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
C3 TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
C4 TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
C5 TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
C6 TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
**************************************************
C1 ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
C2 ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
C3 ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
C4 ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
C5 ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
C6 ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
**************************************************
C1 TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
C2 TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
C3 TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
C4 TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
C5 TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
C6 TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
**************************************************
C1 FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
C2 FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
C3 FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
C4 FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
C5 FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
C6 FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
****************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7200]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [7200]--->[7200]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.481 Mb, Max= 30.780 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
C2 MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
C3 MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
C4 MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
C5 MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
C6 MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
**************************************************
C1 TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
C2 TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
C3 TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
C4 TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
C5 TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
C6 TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
**************************************************
C1 ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
C2 ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
C3 ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
C4 ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
C5 ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
C6 ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
**************************************************
C1 TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
C2 TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
C3 TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
C4 TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
C5 TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
C6 TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
**************************************************
C1 FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
C2 FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
C3 FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
C4 FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
C5 FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
C6 FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
****************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC
C2 ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC
C3 ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC
C4 ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC
C5 ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC
C6 ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC
**************************************************
C1 GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA
C2 GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA
C3 GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA
C4 GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA
C5 GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA
C6 GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA
**************************************************
C1 TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG
C2 TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG
C3 TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG
C4 TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG
C5 TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG
C6 TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG
**************************************************
C1 ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT
C2 ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT
C3 ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT
C4 ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT
C5 ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT
C6 ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT
**************************************************
C1 GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG
C2 GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG
C3 GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG
C4 GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG
C5 GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG
C6 GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG
**************************************************
C1 TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC
C2 TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC
C3 TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC
C4 TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC
C5 TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC
C6 TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC
**************************************************
C1 GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT
C2 GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT
C3 GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT
C4 GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT
C5 GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT
C6 GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT
**************************************************
C1 TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG
C2 TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG
C3 TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG
C4 TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG
C5 TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG
C6 TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG
**************************************************
C1 CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC
C2 CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC
C3 CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC
C4 CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC
C5 CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC
C6 CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC
**************************************************
C1 ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA
C2 ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA
C3 ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA
C4 ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA
C5 ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA
C6 ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA
**************************************************
C1 CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC
C2 CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC
C3 CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC
C4 CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC
C5 CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC
C6 CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC
**************************************************
C1 TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC
C2 TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC
C3 TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC
C4 TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC
C5 TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC
C6 TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC
**************************************************
C1 TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG
C2 TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG
C3 TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG
C4 TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG
C5 TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG
C6 TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG
**************************************************
C1 TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT
C2 TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT
C3 TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT
C4 TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT
C5 TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT
C6 TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT
**************************************************
C1 GCGGTGTCATCGGCGCCGAC
C2 GCGGTGTCATCGGCGCCGAC
C3 GCGGTGTCATCGGCGCCGAC
C4 GCGGTGTCATCGGCGCCGAC
C5 GCGGTGTCATCGGCGCCGAC
C6 GCGGTGTCATCGGCGCCGAC
********************
>C1
ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC
GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA
TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG
ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT
GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG
TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC
GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT
TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG
CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC
ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA
CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC
TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC
TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG
TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT
GCGGTGTCATCGGCGCCGAC
>C2
ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC
GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA
TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG
ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT
GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG
TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC
GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT
TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG
CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC
ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA
CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC
TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC
TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG
TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT
GCGGTGTCATCGGCGCCGAC
>C3
ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC
GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA
TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG
ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT
GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG
TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC
GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT
TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG
CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC
ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA
CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC
TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC
TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG
TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT
GCGGTGTCATCGGCGCCGAC
>C4
ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC
GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA
TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG
ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT
GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG
TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC
GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT
TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG
CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC
ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA
CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC
TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC
TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG
TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT
GCGGTGTCATCGGCGCCGAC
>C5
ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC
GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA
TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG
ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT
GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG
TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC
GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT
TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG
CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC
ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA
CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC
TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC
TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG
TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT
GCGGTGTCATCGGCGCCGAC
>C6
ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC
GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA
TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG
ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT
GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG
TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC
GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT
TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG
CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC
ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA
CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC
TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC
TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG
TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT
GCGGTGTCATCGGCGCCGAC
>C1
MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
>C2
MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
>C3
MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
>C4
MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
>C5
MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
>C6
MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 720 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579789146
Setting output file names to "/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 887554597
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0962090388
Seed = 811946194
Swapseed = 1579789146
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1611.394522 -- -24.965149
Chain 2 -- -1611.394522 -- -24.965149
Chain 3 -- -1611.394522 -- -24.965149
Chain 4 -- -1611.394276 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1611.394276 -- -24.965149
Chain 2 -- -1611.394430 -- -24.965149
Chain 3 -- -1611.394522 -- -24.965149
Chain 4 -- -1611.394430 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1611.395] (-1611.395) (-1611.395) (-1611.394) * [-1611.394] (-1611.394) (-1611.395) (-1611.394)
500 -- (-997.798) (-997.125) (-995.067) [-995.318] * (-986.077) [-1001.544] (-995.274) (-998.195) -- 0:00:00
1000 -- (-989.373) (-990.115) [-984.438] (-986.218) * [-988.233] (-997.441) (-991.428) (-992.398) -- 0:00:00
1500 -- (-982.518) (-992.732) [-990.023] (-993.298) * (-982.968) (-982.363) [-986.965] (-991.379) -- 0:00:00
2000 -- (-989.192) (-990.866) [-991.189] (-988.405) * [-984.736] (-988.320) (-991.395) (-990.963) -- 0:00:00
2500 -- (-987.753) [-985.158] (-992.186) (-986.567) * (-987.848) [-987.488] (-988.740) (-993.044) -- 0:00:00
3000 -- (-985.121) (-990.390) (-985.343) [-989.807] * (-986.159) [-991.207] (-983.732) (-988.085) -- 0:00:00
3500 -- [-988.645] (-994.446) (-988.019) (-987.743) * (-993.734) (-993.242) [-985.517] (-993.648) -- 0:00:00
4000 -- [-988.020] (-990.307) (-989.042) (-989.829) * (-984.248) (-988.597) [-984.338] (-990.388) -- 0:00:00
4500 -- (-989.274) (-985.519) [-992.290] (-983.664) * (-987.949) (-994.408) (-982.510) [-983.194] -- 0:00:00
5000 -- (-987.962) [-981.224] (-989.521) (-984.307) * (-992.606) [-988.888] (-983.701) (-989.303) -- 0:00:00
Average standard deviation of split frequencies: 0.081983
5500 -- [-997.414] (-986.950) (-983.355) (-994.556) * (-984.966) [-985.731] (-988.640) (-990.419) -- 0:00:00
6000 -- (-985.788) (-989.308) [-983.714] (-991.471) * (-985.641) (-992.096) (-983.884) [-989.812] -- 0:00:00
6500 -- [-985.541] (-991.652) (-992.467) (-984.973) * (-994.106) [-987.864] (-989.232) (-989.484) -- 0:00:00
7000 -- (-988.967) (-993.582) [-988.116] (-985.644) * (-990.554) (-988.244) [-987.784] (-984.994) -- 0:00:00
7500 -- (-991.259) (-994.237) [-987.676] (-994.123) * [-987.717] (-986.705) (-988.045) (-993.443) -- 0:00:00
8000 -- (-986.669) (-986.783) [-992.263] (-992.859) * (-989.090) [-986.162] (-995.852) (-986.734) -- 0:00:00
8500 -- [-990.171] (-989.122) (-992.000) (-991.918) * [-986.345] (-992.343) (-990.077) (-986.781) -- 0:00:00
9000 -- (-986.594) (-989.662) (-987.897) [-984.124] * [-990.668] (-988.796) (-984.869) (-998.554) -- 0:00:00
9500 -- (-991.378) (-985.410) [-985.453] (-984.980) * (-989.715) (-994.438) [-987.903] (-987.574) -- 0:00:00
10000 -- (-986.825) (-999.703) [-986.839] (-987.424) * (-991.813) [-986.362] (-987.862) (-987.866) -- 0:01:39
Average standard deviation of split frequencies: 0.061872
10500 -- (-987.771) (-990.962) (-983.011) [-987.360] * (-987.828) (-989.354) [-991.309] (-984.683) -- 0:01:34
11000 -- (-986.294) (-986.624) (-986.067) [-983.121] * [-983.133] (-983.953) (-997.019) (-986.883) -- 0:01:29
11500 -- (-985.086) [-986.314] (-992.063) (-994.669) * [-981.961] (-988.535) (-988.502) (-990.459) -- 0:01:25
12000 -- (-990.144) (-986.922) [-987.832] (-986.755) * (-987.993) (-989.695) [-981.827] (-987.496) -- 0:01:22
12500 -- (-994.713) [-984.399] (-995.116) (-981.295) * (-986.654) (-985.586) [-984.654] (-985.373) -- 0:01:19
13000 -- (-986.309) [-989.819] (-987.296) (-989.208) * (-994.170) (-986.422) (-998.560) [-991.559] -- 0:01:15
13500 -- (-987.537) (-989.676) [-985.652] (-991.005) * (-989.510) [-984.516] (-986.262) (-984.905) -- 0:01:13
14000 -- (-986.330) (-986.070) [-983.131] (-991.441) * (-989.685) (-996.874) [-996.730] (-990.238) -- 0:01:10
14500 -- (-987.587) (-990.262) (-988.599) [-987.573] * (-984.108) [-987.774] (-986.345) (-994.138) -- 0:01:07
15000 -- (-993.977) [-989.350] (-989.384) (-982.878) * (-991.001) (-991.239) [-984.178] (-993.390) -- 0:01:05
Average standard deviation of split frequencies: 0.064538
15500 -- (-985.172) [-987.207] (-985.423) (-986.215) * (-990.166) [-986.998] (-983.680) (-994.602) -- 0:01:03
16000 -- (-986.030) (-985.044) (-985.573) [-990.549] * [-987.711] (-991.211) (-992.689) (-990.082) -- 0:01:01
16500 -- (-990.214) (-985.983) [-986.218] (-986.883) * (-989.820) [-994.512] (-990.405) (-991.576) -- 0:00:59
17000 -- [-986.783] (-989.752) (-990.756) (-988.227) * (-987.577) [-984.033] (-989.415) (-989.567) -- 0:00:57
17500 -- [-989.410] (-990.691) (-993.673) (-990.650) * (-989.243) (-990.992) (-985.191) [-994.223] -- 0:00:56
18000 -- [-983.776] (-987.236) (-990.989) (-981.764) * [-985.023] (-993.745) (-987.519) (-1001.739) -- 0:00:54
18500 -- (-995.896) (-992.724) [-983.168] (-987.720) * [-979.865] (-990.561) (-986.947) (-990.004) -- 0:00:53
19000 -- [-990.514] (-992.279) (-997.097) (-998.446) * (-988.213) [-988.268] (-990.450) (-997.256) -- 0:00:51
19500 -- (-993.467) (-992.021) [-989.414] (-987.248) * (-988.436) [-993.932] (-1004.883) (-990.661) -- 0:00:50
20000 -- (-990.224) [-987.845] (-989.469) (-988.796) * (-987.216) [-987.580] (-989.348) (-988.363) -- 0:00:49
Average standard deviation of split frequencies: 0.046820
20500 -- [-983.212] (-979.282) (-993.187) (-988.474) * (-987.783) (-987.601) [-988.849] (-995.443) -- 0:00:47
21000 -- [-985.073] (-988.069) (-986.482) (-993.408) * (-988.516) (-986.886) (-991.990) [-991.284] -- 0:00:46
21500 -- (-990.828) [-991.176] (-989.572) (-987.208) * [-985.517] (-995.614) (-1004.271) (-985.214) -- 0:00:45
22000 -- (-983.746) (-981.393) (-988.710) [-982.837] * [-986.218] (-988.036) (-987.200) (-993.914) -- 0:00:44
22500 -- (-985.815) (-990.190) (-989.902) [-990.212] * [-988.666] (-991.391) (-992.663) (-983.480) -- 0:00:43
23000 -- (-993.612) (-985.060) [-986.086] (-988.911) * (-988.184) [-992.066] (-982.385) (-987.732) -- 0:00:42
23500 -- [-986.057] (-989.015) (-991.229) (-990.794) * [-992.362] (-983.903) (-982.861) (-989.079) -- 0:00:41
24000 -- [-992.512] (-988.028) (-993.152) (-989.801) * (-992.898) (-985.096) (-981.651) [-994.066] -- 0:00:40
24500 -- (-991.394) (-989.105) [-992.788] (-984.538) * [-991.004] (-990.950) (-980.737) (-985.978) -- 0:00:39
25000 -- [-983.330] (-988.738) (-989.234) (-993.647) * (-989.546) (-983.433) (-978.438) [-989.407] -- 0:00:39
Average standard deviation of split frequencies: 0.044032
25500 -- (-983.932) (-988.360) [-987.009] (-992.687) * (-985.192) (-990.334) (-980.454) [-988.353] -- 0:01:16
26000 -- (-993.682) (-984.705) (-995.833) [-989.217] * (-989.076) (-991.959) (-978.570) [-984.412] -- 0:01:14
26500 -- [-988.682] (-982.015) (-992.855) (-978.558) * (-990.432) [-983.236] (-978.234) (-985.990) -- 0:01:13
27000 -- (-991.139) (-989.248) (-983.327) [-980.288] * (-989.505) (-997.750) [-978.071] (-990.946) -- 0:01:12
27500 -- (-992.134) (-993.628) (-985.645) [-977.551] * (-1007.667) [-984.889] (-980.459) (-989.705) -- 0:01:10
28000 -- (-984.982) (-985.905) [-995.528] (-979.313) * (-994.857) (-980.289) (-979.655) [-984.395] -- 0:01:09
28500 -- (-992.305) (-990.346) [-986.355] (-981.786) * [-978.814] (-982.148) (-980.665) (-1001.177) -- 0:01:08
29000 -- (-992.571) (-991.683) (-988.117) [-983.695] * (-983.658) (-980.366) (-980.425) [-989.897] -- 0:01:06
29500 -- (-983.991) [-991.236] (-987.445) (-979.811) * (-980.363) [-984.318] (-980.496) (-990.497) -- 0:01:05
30000 -- [-985.045] (-992.025) (-982.911) (-979.287) * [-977.954] (-983.768) (-979.296) (-994.427) -- 0:01:04
Average standard deviation of split frequencies: 0.047734
30500 -- (-984.480) (-990.450) [-987.897] (-978.776) * [-978.100] (-978.466) (-980.209) (-987.533) -- 0:01:03
31000 -- (-987.348) [-982.192] (-996.295) (-979.173) * (-980.071) (-980.087) [-979.023] (-987.983) -- 0:01:02
31500 -- (-993.468) (-987.098) (-983.571) [-977.331] * [-979.860] (-982.217) (-980.724) (-987.376) -- 0:01:01
32000 -- (-992.679) [-984.958] (-986.276) (-977.671) * (-985.447) (-979.490) [-980.643] (-989.537) -- 0:01:00
32500 -- (-986.887) [-991.903] (-985.224) (-979.074) * (-986.787) [-980.124] (-983.363) (-987.790) -- 0:00:59
33000 -- [-983.125] (-989.777) (-991.914) (-977.556) * [-981.865] (-981.567) (-983.739) (-988.548) -- 0:00:58
33500 -- [-991.067] (-991.139) (-987.315) (-978.514) * (-979.085) (-979.569) (-979.641) [-986.804] -- 0:00:57
34000 -- (-986.677) [-983.403] (-988.366) (-978.823) * (-977.451) (-980.991) (-980.818) [-986.863] -- 0:00:56
34500 -- (-984.458) (-989.742) (-987.162) [-977.204] * [-978.120] (-977.246) (-980.858) (-991.439) -- 0:00:55
35000 -- [-988.852] (-992.988) (-995.016) (-977.758) * [-978.583] (-979.446) (-978.561) (-986.414) -- 0:00:55
Average standard deviation of split frequencies: 0.035542
35500 -- [-987.097] (-980.102) (-993.024) (-978.761) * (-979.833) (-979.995) (-982.180) [-989.590] -- 0:00:54
36000 -- [-984.798] (-987.093) (-989.738) (-978.925) * (-979.012) (-977.609) [-977.941] (-985.941) -- 0:00:53
36500 -- (-986.951) [-980.459] (-992.318) (-984.412) * (-979.805) [-977.283] (-977.980) (-987.140) -- 0:00:52
37000 -- (-987.422) (-978.427) [-988.291] (-977.965) * (-978.293) (-978.463) [-978.782] (-991.437) -- 0:00:52
37500 -- [-985.173] (-978.801) (-985.781) (-977.636) * (-981.683) (-977.259) (-977.050) [-985.240] -- 0:00:51
38000 -- (-987.254) (-979.866) (-988.739) [-979.729] * (-980.438) (-978.308) (-978.993) [-984.478] -- 0:00:50
38500 -- (-985.093) [-982.999] (-991.967) (-977.233) * (-978.791) (-979.825) [-980.271] (-991.645) -- 0:00:49
39000 -- (-989.466) (-981.131) (-991.901) [-977.610] * [-979.582] (-979.227) (-978.904) (-987.073) -- 0:00:49
39500 -- [-992.534] (-979.497) (-989.194) (-977.737) * (-978.703) (-978.725) [-976.789] (-997.416) -- 0:00:48
40000 -- (-988.592) [-979.363] (-983.181) (-980.631) * (-978.893) (-978.270) [-980.416] (-993.125) -- 0:00:48
Average standard deviation of split frequencies: 0.029285
40500 -- (-984.027) [-977.736] (-981.429) (-978.681) * (-982.085) (-979.905) [-981.485] (-989.121) -- 0:01:11
41000 -- (-983.746) [-977.326] (-979.568) (-979.271) * (-977.506) (-977.936) [-980.627] (-985.978) -- 0:01:10
41500 -- [-985.647] (-977.454) (-981.983) (-981.009) * [-977.388] (-977.769) (-977.403) (-996.910) -- 0:01:09
42000 -- (-984.646) (-977.609) [-979.870] (-984.038) * (-977.753) [-976.835] (-976.686) (-998.305) -- 0:01:08
42500 -- (-987.674) (-979.049) (-978.849) [-981.672] * (-979.822) (-978.007) (-981.479) [-988.338] -- 0:01:07
43000 -- (-987.813) (-977.741) (-978.867) [-979.457] * (-978.959) [-981.279] (-981.771) (-981.646) -- 0:01:06
43500 -- (-982.061) [-978.482] (-977.995) (-978.714) * [-978.838] (-981.193) (-987.239) (-981.615) -- 0:01:05
44000 -- (-986.997) (-982.012) (-980.547) [-979.024] * (-979.029) [-981.626] (-985.609) (-981.410) -- 0:01:05
44500 -- (-986.909) (-981.311) (-980.037) [-978.325] * (-977.010) (-983.741) [-978.914] (-979.855) -- 0:01:04
45000 -- [-981.625] (-977.319) (-979.441) (-977.327) * (-978.922) (-979.557) (-978.123) [-980.261] -- 0:01:03
Average standard deviation of split frequencies: 0.025620
45500 -- (-988.910) (-981.241) [-979.138] (-977.480) * (-980.116) [-978.428] (-979.637) (-978.765) -- 0:01:02
46000 -- [-986.880] (-977.738) (-978.451) (-978.649) * (-977.882) (-980.426) (-979.134) [-978.096] -- 0:01:02
46500 -- [-984.147] (-979.119) (-978.552) (-979.820) * (-978.193) (-980.788) [-979.057] (-983.711) -- 0:01:01
47000 -- [-990.590] (-977.148) (-979.708) (-978.484) * (-977.020) (-979.766) (-980.234) [-979.314] -- 0:01:00
47500 -- [-987.065] (-977.789) (-980.895) (-980.347) * (-978.894) (-980.964) (-978.398) [-981.912] -- 0:01:00
48000 -- (-987.311) [-980.512] (-983.659) (-979.746) * (-978.155) (-979.110) [-977.850] (-978.207) -- 0:00:59
48500 -- [-986.071] (-984.920) (-979.792) (-979.493) * (-979.267) [-979.551] (-977.729) (-977.559) -- 0:00:58
49000 -- [-986.558] (-979.228) (-981.984) (-979.851) * (-979.923) (-982.099) (-978.775) [-978.946] -- 0:00:58
49500 -- [-986.283] (-978.404) (-980.850) (-980.414) * (-978.867) [-980.191] (-980.747) (-978.844) -- 0:00:57
50000 -- [-988.990] (-980.236) (-983.054) (-979.413) * [-978.903] (-977.996) (-977.499) (-979.205) -- 0:00:57
Average standard deviation of split frequencies: 0.028721
50500 -- [-990.486] (-981.826) (-983.415) (-978.490) * (-978.957) [-982.471] (-977.980) (-979.618) -- 0:00:56
51000 -- [-988.254] (-979.211) (-979.927) (-978.222) * (-978.006) [-980.597] (-980.511) (-979.193) -- 0:00:55
51500 -- (-988.126) (-977.422) (-977.444) [-977.150] * (-979.768) [-977.301] (-980.711) (-977.295) -- 0:00:55
52000 -- (-991.714) (-978.217) (-979.906) [-978.939] * (-978.379) (-978.983) (-977.374) [-976.769] -- 0:00:54
52500 -- (-990.455) (-977.463) [-978.504] (-979.340) * (-979.424) (-980.845) (-978.617) [-979.644] -- 0:00:54
53000 -- (-990.136) [-977.507] (-980.931) (-976.832) * (-977.235) (-978.329) (-978.735) [-976.943] -- 0:00:53
53500 -- [-992.368] (-977.407) (-979.960) (-977.202) * [-979.169] (-977.787) (-978.764) (-978.381) -- 0:00:53
54000 -- (-992.171) (-979.331) (-978.628) [-978.064] * (-979.275) (-978.615) (-979.553) [-979.211] -- 0:00:52
54500 -- (-986.172) (-981.046) [-977.974] (-978.305) * [-982.136] (-979.200) (-978.539) (-980.489) -- 0:00:52
55000 -- (-990.309) (-980.591) (-977.519) [-979.005] * [-982.756] (-981.340) (-981.615) (-978.386) -- 0:00:51
Average standard deviation of split frequencies: 0.024489
55500 -- (-985.465) (-977.814) [-977.314] (-978.284) * (-982.908) [-978.158] (-980.355) (-980.567) -- 0:01:08
56000 -- (-989.621) (-977.328) [-976.950] (-979.362) * (-980.075) (-978.467) [-979.999] (-978.075) -- 0:01:07
56500 -- (-990.359) (-977.293) [-980.206] (-980.915) * (-978.041) (-978.857) (-981.551) [-978.422] -- 0:01:06
57000 -- (-991.237) [-980.675] (-978.214) (-981.514) * (-981.341) [-980.146] (-979.398) (-978.685) -- 0:01:06
57500 -- (-998.698) (-978.652) (-980.484) [-981.379] * [-979.815] (-981.873) (-981.549) (-977.485) -- 0:01:05
58000 -- [-993.828] (-977.350) (-977.835) (-980.165) * (-978.895) (-979.595) (-980.307) [-978.232] -- 0:01:04
58500 -- [-984.771] (-977.426) (-978.502) (-980.848) * [-979.704] (-980.004) (-979.423) (-978.085) -- 0:01:04
59000 -- (-988.292) (-979.308) [-977.516] (-979.095) * (-980.575) (-982.877) [-979.873] (-979.967) -- 0:01:03
59500 -- (-986.985) [-977.475] (-977.860) (-981.687) * [-979.980] (-984.975) (-979.270) (-979.927) -- 0:01:03
60000 -- (-984.506) (-977.792) [-978.007] (-985.459) * (-983.630) [-981.379] (-980.398) (-980.249) -- 0:01:02
Average standard deviation of split frequencies: 0.025642
60500 -- (-987.097) [-977.118] (-982.092) (-983.142) * (-977.709) (-979.395) (-980.291) [-979.780] -- 0:01:02
61000 -- [-984.093] (-978.864) (-980.474) (-978.591) * (-980.249) [-978.502] (-981.294) (-979.335) -- 0:01:01
61500 -- (-987.267) (-983.750) [-979.041] (-977.628) * (-981.290) [-984.995] (-977.384) (-980.378) -- 0:01:01
62000 -- [-991.764] (-983.180) (-978.739) (-978.261) * [-978.768] (-984.611) (-977.680) (-979.494) -- 0:01:00
62500 -- [-983.301] (-982.020) (-978.002) (-978.235) * (-981.572) (-977.182) (-977.765) [-978.881] -- 0:01:00
63000 -- (-986.647) (-977.968) [-980.376] (-979.360) * [-982.145] (-980.730) (-978.870) (-981.630) -- 0:00:59
63500 -- (-998.009) [-979.827] (-979.322) (-980.966) * (-979.441) (-980.151) [-982.322] (-980.956) -- 0:00:58
64000 -- (-987.897) (-978.775) [-978.637] (-979.905) * (-978.498) (-978.906) (-983.043) [-980.626] -- 0:00:58
64500 -- (-987.954) (-980.034) (-978.404) [-978.248] * [-978.857] (-977.825) (-979.769) (-979.369) -- 0:00:58
65000 -- (-987.590) [-983.692] (-977.344) (-977.638) * (-977.564) [-979.747] (-978.374) (-978.623) -- 0:00:57
Average standard deviation of split frequencies: 0.026086
65500 -- [-987.167] (-980.603) (-977.043) (-977.854) * [-978.015] (-981.663) (-978.464) (-979.440) -- 0:00:57
66000 -- [-986.891] (-988.434) (-977.960) (-977.961) * (-979.048) [-978.306] (-980.797) (-980.950) -- 0:00:56
66500 -- [-986.020] (-981.750) (-978.777) (-980.591) * (-980.219) [-977.108] (-980.075) (-978.568) -- 0:00:56
67000 -- (-977.925) (-979.160) (-979.375) [-977.761] * (-979.937) (-977.014) [-978.939] (-980.146) -- 0:00:55
67500 -- [-979.021] (-981.526) (-978.230) (-981.457) * [-980.645] (-978.269) (-979.623) (-978.096) -- 0:00:55
68000 -- (-977.843) [-981.453] (-980.943) (-980.400) * (-978.910) [-980.580] (-980.011) (-981.978) -- 0:00:54
68500 -- (-979.924) (-979.828) [-983.498] (-979.551) * (-980.752) (-980.136) (-979.482) [-979.550] -- 0:00:54
69000 -- [-979.632] (-980.364) (-977.715) (-979.278) * (-978.647) (-979.086) [-979.514] (-982.334) -- 0:00:53
69500 -- (-979.514) (-979.861) (-977.674) [-983.427] * [-979.356] (-977.709) (-981.062) (-983.836) -- 0:00:53
70000 -- (-976.703) (-980.898) (-977.231) [-977.991] * (-979.042) (-978.804) (-977.371) [-977.216] -- 0:00:53
Average standard deviation of split frequencies: 0.024864
70500 -- (-979.691) (-978.696) [-978.262] (-978.664) * (-978.239) (-978.212) [-977.269] (-977.071) -- 0:00:52
71000 -- [-978.831] (-978.094) (-977.979) (-977.432) * (-978.182) (-977.794) [-977.539] (-978.312) -- 0:00:52
71500 -- (-980.753) [-978.162] (-980.611) (-976.674) * [-979.971] (-978.149) (-977.736) (-979.970) -- 0:01:04
72000 -- (-983.988) (-978.885) (-980.708) [-978.762] * [-977.843] (-978.385) (-978.442) (-979.940) -- 0:01:04
72500 -- (-979.115) (-981.358) [-978.666] (-980.120) * [-979.703] (-978.618) (-980.354) (-978.938) -- 0:01:03
73000 -- (-977.822) (-979.749) (-981.542) [-979.729] * (-980.785) [-977.424] (-977.616) (-978.197) -- 0:01:03
73500 -- (-978.773) (-982.376) [-977.952] (-977.336) * (-978.082) (-979.799) [-978.926] (-984.346) -- 0:01:03
74000 -- (-982.264) (-977.802) [-977.268] (-977.552) * (-978.224) (-978.344) (-978.081) [-978.998] -- 0:01:02
74500 -- [-979.069] (-978.398) (-977.037) (-979.258) * (-979.830) [-977.108] (-978.839) (-979.070) -- 0:01:02
75000 -- (-978.398) (-976.988) [-979.173] (-978.217) * (-980.861) (-977.622) (-979.984) [-977.982] -- 0:01:01
Average standard deviation of split frequencies: 0.023119
75500 -- (-979.058) [-979.251] (-980.194) (-977.059) * (-980.684) (-979.421) [-976.946] (-979.160) -- 0:01:01
76000 -- [-978.207] (-979.318) (-981.185) (-981.286) * [-977.421] (-981.276) (-977.329) (-978.769) -- 0:01:00
76500 -- (-978.609) [-981.367] (-978.486) (-979.923) * [-979.712] (-980.651) (-977.139) (-978.618) -- 0:01:00
77000 -- [-979.437] (-978.281) (-981.079) (-984.240) * [-979.481] (-981.714) (-977.415) (-979.006) -- 0:00:59
77500 -- (-979.205) (-978.287) (-977.744) [-979.693] * (-980.724) [-979.767] (-978.749) (-980.376) -- 0:00:59
78000 -- [-978.143] (-979.244) (-979.535) (-985.852) * (-980.499) (-977.095) [-978.690] (-977.968) -- 0:00:59
78500 -- [-977.354] (-980.363) (-976.782) (-980.304) * (-978.061) (-978.193) (-977.790) [-980.714] -- 0:00:58
79000 -- (-979.339) (-982.505) (-981.208) [-979.730] * (-978.906) (-977.039) [-977.646] (-977.222) -- 0:00:58
79500 -- [-978.425] (-977.835) (-979.172) (-978.260) * (-979.021) (-977.148) [-978.112] (-981.423) -- 0:00:57
80000 -- (-982.370) (-977.272) (-978.144) [-977.781] * (-978.983) (-976.938) (-979.785) [-978.421] -- 0:00:57
Average standard deviation of split frequencies: 0.025235
80500 -- (-982.440) (-978.316) [-977.949] (-981.302) * (-978.349) (-979.985) (-978.046) [-980.482] -- 0:00:57
81000 -- (-980.391) (-978.442) [-977.856] (-978.586) * (-978.211) [-978.329] (-978.755) (-980.337) -- 0:00:56
81500 -- (-980.023) (-981.635) (-977.595) [-977.978] * (-978.211) (-978.975) (-979.162) [-978.237] -- 0:00:56
82000 -- (-978.630) [-979.170] (-980.666) (-978.703) * (-977.873) (-977.329) (-980.972) [-978.896] -- 0:00:55
82500 -- (-978.622) [-979.203] (-978.311) (-979.079) * (-978.164) (-977.587) [-977.590] (-980.193) -- 0:00:55
83000 -- (-982.187) (-977.031) [-977.844] (-980.584) * (-982.901) (-978.899) (-981.284) [-978.208] -- 0:00:55
83500 -- (-984.379) [-977.222] (-978.914) (-979.524) * (-978.985) (-981.192) (-979.962) [-978.322] -- 0:00:54
84000 -- [-977.976] (-977.538) (-979.264) (-978.777) * (-979.740) (-979.653) (-980.976) [-981.909] -- 0:00:54
84500 -- [-978.943] (-979.004) (-983.530) (-977.158) * (-978.139) [-981.434] (-978.088) (-982.178) -- 0:00:54
85000 -- (-979.224) (-978.189) (-979.592) [-978.198] * (-980.019) (-981.538) (-977.820) [-981.091] -- 0:00:53
Average standard deviation of split frequencies: 0.024014
85500 -- (-979.665) (-978.616) [-981.267] (-978.805) * [-978.669] (-978.015) (-977.793) (-978.893) -- 0:00:53
86000 -- (-977.841) [-979.564] (-981.031) (-982.226) * (-985.465) (-979.721) [-977.855] (-982.759) -- 0:00:53
86500 -- (-978.729) (-979.013) (-982.274) [-980.596] * (-979.646) (-980.341) (-979.154) [-979.768] -- 0:00:52
87000 -- [-979.192] (-979.800) (-977.327) (-977.768) * [-978.820] (-978.488) (-978.261) (-980.378) -- 0:00:52
87500 -- (-978.015) (-978.132) [-978.182] (-976.860) * (-978.632) (-978.097) [-980.586] (-987.716) -- 0:01:02
88000 -- (-977.235) (-979.839) [-979.613] (-978.615) * (-979.194) (-978.983) [-978.929] (-984.057) -- 0:01:02
88500 -- (-976.976) (-976.841) [-979.583] (-979.267) * [-978.306] (-981.673) (-979.199) (-977.280) -- 0:01:01
89000 -- [-978.635] (-976.796) (-978.580) (-982.354) * (-979.002) (-987.900) (-980.017) [-977.699] -- 0:01:01
89500 -- (-977.755) [-976.817] (-978.619) (-982.343) * (-979.894) (-982.593) [-979.972] (-977.699) -- 0:01:01
90000 -- [-977.779] (-977.822) (-980.602) (-980.341) * (-979.515) (-985.062) [-979.933] (-977.382) -- 0:01:00
Average standard deviation of split frequencies: 0.020277
90500 -- (-980.917) (-978.617) [-977.367] (-978.015) * (-979.133) (-982.386) [-979.183] (-979.760) -- 0:01:00
91000 -- (-978.437) (-980.328) (-977.828) [-977.650] * (-979.785) (-983.335) [-977.518] (-978.921) -- 0:00:59
91500 -- (-981.850) (-979.324) (-977.816) [-977.361] * (-978.870) (-987.821) [-977.108] (-978.753) -- 0:00:59
92000 -- (-979.690) [-978.939] (-977.867) (-979.002) * (-980.148) (-977.825) [-977.673] (-980.816) -- 0:00:59
92500 -- [-978.057] (-977.933) (-977.544) (-981.812) * [-978.346] (-977.671) (-979.518) (-978.878) -- 0:00:58
93000 -- [-980.017] (-977.163) (-977.388) (-982.583) * (-981.542) (-977.875) [-979.770] (-980.648) -- 0:00:58
93500 -- [-977.846] (-978.591) (-979.328) (-977.959) * [-979.144] (-978.749) (-979.103) (-978.078) -- 0:00:58
94000 -- (-977.726) [-977.864] (-979.744) (-979.491) * (-979.552) (-979.180) (-978.676) [-978.957] -- 0:00:57
94500 -- (-977.735) [-978.471] (-978.464) (-980.311) * (-978.864) (-979.380) (-981.215) [-979.080] -- 0:00:57
95000 -- (-981.261) [-978.512] (-977.792) (-979.740) * (-978.155) (-980.459) [-981.768] (-978.722) -- 0:00:57
Average standard deviation of split frequencies: 0.019396
95500 -- (-978.317) (-980.388) (-979.781) [-981.013] * (-978.689) (-978.681) (-980.277) [-978.302] -- 0:00:56
96000 -- (-982.338) (-977.915) [-978.660] (-978.644) * [-979.362] (-978.768) (-981.532) (-981.566) -- 0:00:56
96500 -- (-978.918) [-978.625] (-977.233) (-980.078) * (-978.954) (-979.310) [-980.539] (-982.456) -- 0:00:56
97000 -- (-978.834) (-977.715) (-977.327) [-982.228] * (-978.352) (-980.081) (-981.611) [-979.739] -- 0:00:55
97500 -- (-978.802) (-980.722) (-981.782) [-978.500] * [-978.701] (-980.411) (-979.013) (-978.219) -- 0:00:55
98000 -- (-979.616) [-979.820] (-980.280) (-978.665) * (-978.051) [-978.216] (-978.343) (-981.335) -- 0:00:55
98500 -- (-981.105) [-979.234] (-978.394) (-979.030) * [-979.984] (-980.237) (-978.387) (-980.679) -- 0:00:54
99000 -- (-983.012) (-977.787) [-978.312] (-978.302) * (-980.337) (-979.083) (-977.835) [-982.178] -- 0:00:54
99500 -- (-981.287) (-978.781) [-978.042] (-978.728) * (-980.604) (-980.199) [-978.923] (-978.376) -- 0:00:54
100000 -- [-978.847] (-977.515) (-978.516) (-977.915) * (-981.143) (-981.731) (-980.462) [-979.326] -- 0:00:54
Average standard deviation of split frequencies: 0.016513
100500 -- (-979.013) (-981.108) (-978.139) [-977.878] * (-981.633) [-981.110] (-980.255) (-979.021) -- 0:00:53
101000 -- (-984.302) (-980.890) (-979.369) [-978.144] * [-977.401] (-979.653) (-979.251) (-979.294) -- 0:00:53
101500 -- (-978.143) (-979.034) [-979.023] (-977.918) * (-978.997) (-978.922) (-978.808) [-978.448] -- 0:00:53
102000 -- (-979.828) (-980.126) [-978.415] (-980.826) * (-982.177) [-981.586] (-978.543) (-979.607) -- 0:00:52
102500 -- (-981.111) (-979.856) (-979.622) [-984.357] * [-985.684] (-981.171) (-977.782) (-982.561) -- 0:00:52
103000 -- [-977.907] (-979.338) (-978.693) (-982.010) * (-981.604) (-981.082) [-982.667] (-977.850) -- 0:00:52
103500 -- [-978.520] (-979.360) (-978.182) (-984.233) * (-977.316) [-977.958] (-977.547) (-978.991) -- 0:00:51
104000 -- (-979.223) [-978.665] (-978.745) (-987.508) * (-977.419) [-980.216] (-977.126) (-978.823) -- 0:01:00
104500 -- (-979.011) [-979.387] (-978.623) (-980.317) * (-978.416) (-977.538) (-979.471) [-979.661] -- 0:00:59
105000 -- (-979.241) (-978.817) [-982.794] (-980.178) * (-981.296) [-979.991] (-981.546) (-978.186) -- 0:00:59
Average standard deviation of split frequencies: 0.017555
105500 -- [-978.553] (-980.131) (-981.770) (-979.596) * [-980.283] (-981.103) (-982.775) (-980.109) -- 0:00:59
106000 -- (-979.546) (-979.779) (-977.746) [-980.130] * (-982.561) (-978.039) [-983.199] (-978.858) -- 0:00:59
106500 -- [-978.311] (-978.023) (-977.453) (-984.305) * (-980.600) (-977.875) (-979.943) [-980.509] -- 0:00:58
107000 -- (-977.028) (-979.190) [-979.146] (-981.223) * (-979.096) (-978.142) [-979.629] (-979.133) -- 0:00:58
107500 -- (-978.041) (-980.160) [-978.692] (-979.380) * (-979.523) [-977.476] (-979.495) (-977.671) -- 0:00:58
108000 -- (-978.623) [-977.653] (-980.457) (-979.765) * (-979.508) (-979.351) [-979.949] (-978.406) -- 0:00:57
108500 -- [-978.538] (-979.534) (-977.540) (-982.572) * (-980.567) [-977.601] (-980.706) (-978.358) -- 0:00:57
109000 -- (-979.081) (-977.874) [-978.680] (-981.834) * (-979.418) (-978.481) (-980.228) [-977.627] -- 0:00:57
109500 -- (-977.875) (-981.023) [-978.585] (-981.545) * (-977.176) (-982.036) (-977.890) [-979.930] -- 0:00:56
110000 -- [-978.613] (-977.777) (-980.545) (-977.404) * [-979.721] (-978.975) (-979.890) (-977.850) -- 0:00:56
Average standard deviation of split frequencies: 0.015469
110500 -- (-978.668) (-976.737) (-978.557) [-977.479] * (-980.725) (-979.312) [-979.887] (-978.882) -- 0:00:56
111000 -- (-978.577) (-977.360) [-980.335] (-977.194) * (-979.514) [-977.720] (-979.626) (-978.551) -- 0:00:56
111500 -- (-978.248) [-978.439] (-982.753) (-977.555) * (-982.605) (-980.275) (-982.566) [-978.651] -- 0:00:55
112000 -- (-976.997) (-978.020) [-981.065] (-977.401) * (-979.044) [-981.862] (-985.333) (-978.344) -- 0:00:55
112500 -- (-977.226) (-979.332) [-985.257] (-981.249) * (-978.961) (-981.670) (-980.233) [-978.504] -- 0:00:55
113000 -- (-977.868) (-978.725) (-979.271) [-979.517] * (-977.718) [-979.495] (-978.422) (-977.994) -- 0:00:54
113500 -- (-978.469) [-977.557] (-979.655) (-979.553) * (-978.414) [-979.264] (-977.705) (-980.622) -- 0:00:54
114000 -- (-977.738) (-979.617) [-979.836] (-980.196) * [-980.467] (-979.155) (-977.408) (-978.674) -- 0:00:54
114500 -- (-977.817) [-977.403] (-980.937) (-980.650) * (-978.888) (-979.026) [-979.055] (-979.198) -- 0:00:54
115000 -- (-977.809) (-978.480) [-978.106] (-978.476) * [-979.598] (-978.128) (-978.036) (-977.152) -- 0:00:53
Average standard deviation of split frequencies: 0.016683
115500 -- [-980.600] (-977.068) (-978.462) (-979.358) * (-978.553) [-979.846] (-978.019) (-978.703) -- 0:00:53
116000 -- [-980.097] (-979.488) (-978.624) (-979.851) * [-984.519] (-980.865) (-979.353) (-977.156) -- 0:00:53
116500 -- (-978.082) [-980.830] (-978.050) (-979.266) * (-978.869) (-981.435) (-978.510) [-977.347] -- 0:00:53
117000 -- (-978.292) (-978.231) [-978.591] (-979.856) * (-979.470) (-979.168) (-977.516) [-977.994] -- 0:00:52
117500 -- (-983.980) (-978.235) [-980.466] (-978.936) * (-979.629) (-978.948) (-978.623) [-979.241] -- 0:00:52
118000 -- (-980.805) [-980.991] (-982.112) (-979.872) * (-980.482) (-978.843) [-978.446] (-979.650) -- 0:00:52
118500 -- (-980.955) (-981.793) (-983.422) [-978.539] * [-978.136] (-980.343) (-981.700) (-981.163) -- 0:00:52
119000 -- (-988.000) (-980.481) [-977.961] (-979.179) * (-982.385) (-978.491) (-985.780) [-981.127] -- 0:00:51
119500 -- (-980.807) [-978.899] (-978.902) (-979.003) * [-978.549] (-977.754) (-979.783) (-977.381) -- 0:00:51
120000 -- (-980.624) (-982.460) [-977.189] (-979.379) * (-980.249) (-979.503) [-980.288] (-977.224) -- 0:00:58
Average standard deviation of split frequencies: 0.017971
120500 -- (-978.849) (-984.997) (-977.213) [-979.957] * (-978.688) (-982.119) (-978.736) [-978.049] -- 0:00:58
121000 -- [-978.241] (-983.124) (-977.072) (-977.806) * (-978.654) (-979.493) (-979.719) [-977.962] -- 0:00:58
121500 -- (-978.991) (-983.222) [-980.551] (-978.651) * (-978.274) (-990.916) [-980.042] (-978.602) -- 0:00:57
122000 -- [-978.089] (-979.060) (-982.136) (-977.875) * (-977.650) [-985.813] (-981.080) (-979.743) -- 0:00:57
122500 -- (-977.643) (-979.187) [-979.530] (-977.869) * (-978.164) (-981.781) [-978.253] (-983.214) -- 0:00:57
123000 -- (-978.694) [-982.265] (-979.863) (-977.756) * (-983.793) [-977.226] (-977.421) (-979.711) -- 0:00:57
123500 -- [-979.346] (-984.919) (-977.525) (-979.135) * (-981.600) [-978.939] (-977.861) (-983.798) -- 0:00:56
124000 -- (-978.524) (-979.926) (-977.100) [-977.709] * [-981.363] (-977.485) (-982.489) (-981.630) -- 0:00:56
124500 -- [-976.823] (-979.369) (-977.791) (-978.730) * [-979.315] (-980.165) (-978.348) (-979.945) -- 0:00:56
125000 -- (-977.449) (-979.174) [-977.719] (-979.862) * (-979.310) [-978.872] (-979.361) (-981.079) -- 0:00:56
Average standard deviation of split frequencies: 0.016326
125500 -- (-980.093) (-979.130) (-978.602) [-978.254] * (-978.573) (-978.450) [-980.588] (-979.821) -- 0:00:55
126000 -- (-979.391) (-978.815) (-977.062) [-977.346] * (-978.728) (-977.806) (-979.622) [-982.509] -- 0:00:55
126500 -- (-979.864) [-978.875] (-977.583) (-977.838) * (-977.452) (-977.685) (-983.645) [-981.895] -- 0:00:55
127000 -- (-978.125) (-978.043) [-978.564] (-978.635) * [-980.721] (-977.685) (-984.530) (-978.974) -- 0:00:54
127500 -- (-977.959) (-977.974) [-978.395] (-977.582) * (-980.976) (-977.877) (-981.071) [-977.924] -- 0:00:54
128000 -- (-978.566) [-978.142] (-979.679) (-978.240) * [-980.048] (-983.049) (-977.307) (-977.632) -- 0:00:54
128500 -- (-977.862) (-986.710) [-980.593] (-980.305) * (-982.945) (-980.856) (-979.092) [-978.862] -- 0:00:54
129000 -- [-978.191] (-980.692) (-978.609) (-980.497) * (-980.494) (-979.918) [-978.565] (-979.483) -- 0:00:54
129500 -- [-977.576] (-983.228) (-977.843) (-978.983) * [-977.551] (-980.958) (-979.810) (-981.336) -- 0:00:53
130000 -- [-979.887] (-978.532) (-980.405) (-978.206) * (-980.248) [-983.775] (-977.829) (-978.961) -- 0:00:53
Average standard deviation of split frequencies: 0.017678
130500 -- [-977.870] (-978.328) (-978.287) (-978.394) * (-978.831) (-982.090) (-979.270) [-978.397] -- 0:00:53
131000 -- (-981.290) (-978.298) [-978.082] (-979.284) * (-980.770) (-978.209) (-977.043) [-976.833] -- 0:00:53
131500 -- (-983.551) [-978.233] (-978.488) (-979.144) * (-980.670) (-978.775) [-976.959] (-979.573) -- 0:00:52
132000 -- (-982.377) [-978.627] (-978.934) (-981.426) * [-981.657] (-978.296) (-978.781) (-979.539) -- 0:00:52
132500 -- (-981.291) (-977.478) [-979.962] (-983.969) * (-983.545) [-980.576] (-980.510) (-978.820) -- 0:00:52
133000 -- (-979.519) (-977.739) (-978.905) [-982.416] * (-983.074) (-979.386) (-978.495) [-979.471] -- 0:00:52
133500 -- [-978.295] (-977.631) (-979.344) (-986.576) * (-981.075) (-979.485) (-976.906) [-978.016] -- 0:00:51
134000 -- (-977.822) [-978.101] (-979.060) (-980.862) * [-978.844] (-981.986) (-976.821) (-978.318) -- 0:00:51
134500 -- (-979.952) (-978.190) (-979.787) [-978.343] * (-981.485) (-977.051) (-976.808) [-980.288] -- 0:00:51
135000 -- (-985.043) [-977.171] (-982.474) (-980.717) * (-982.240) (-977.589) [-977.867] (-980.065) -- 0:00:51
Average standard deviation of split frequencies: 0.020451
135500 -- [-983.785] (-978.385) (-979.035) (-979.383) * (-980.517) (-978.780) (-979.438) [-980.665] -- 0:00:51
136000 -- (-987.569) [-978.148] (-979.111) (-986.398) * (-980.085) (-978.539) [-978.662] (-979.502) -- 0:00:57
136500 -- (-982.294) (-980.335) [-980.902] (-980.723) * (-983.206) [-978.939] (-980.359) (-978.167) -- 0:00:56
137000 -- (-981.210) (-977.664) [-980.379] (-981.855) * (-983.511) (-982.969) (-979.821) [-977.010] -- 0:00:56
137500 -- (-978.088) [-979.578] (-979.268) (-980.540) * (-980.706) [-979.619] (-977.122) (-980.257) -- 0:00:56
138000 -- [-978.887] (-978.539) (-978.517) (-979.307) * (-981.306) [-979.635] (-984.174) (-980.337) -- 0:00:56
138500 -- [-980.181] (-983.699) (-977.969) (-978.913) * (-978.879) (-977.290) (-977.895) [-977.714] -- 0:00:55
139000 -- (-981.342) [-978.929] (-978.129) (-979.362) * [-980.178] (-980.691) (-977.635) (-979.883) -- 0:00:55
139500 -- [-979.432] (-978.379) (-976.822) (-979.106) * (-978.435) (-980.085) (-979.893) [-977.268] -- 0:00:55
140000 -- [-978.404] (-981.022) (-977.462) (-981.937) * [-982.116] (-979.624) (-977.502) (-979.054) -- 0:00:55
Average standard deviation of split frequencies: 0.019755
140500 -- (-981.292) (-977.902) [-978.369] (-980.030) * [-979.063] (-979.535) (-979.553) (-977.896) -- 0:00:55
141000 -- (-981.154) (-981.189) (-978.170) [-978.165] * (-976.960) (-982.392) (-978.667) [-978.492] -- 0:00:54
141500 -- (-979.706) [-979.254] (-978.913) (-978.165) * [-979.256] (-981.391) (-977.070) (-977.572) -- 0:00:54
142000 -- (-980.366) [-980.107] (-979.785) (-978.867) * [-977.741] (-977.967) (-978.795) (-979.548) -- 0:00:54
142500 -- (-982.127) (-977.639) [-978.472] (-980.360) * [-978.633] (-978.460) (-977.878) (-982.324) -- 0:00:54
143000 -- [-982.343] (-981.182) (-978.936) (-978.676) * (-977.964) (-977.431) [-976.847] (-980.959) -- 0:00:53
143500 -- (-979.483) (-980.003) [-978.785] (-979.216) * (-981.023) [-978.283] (-978.170) (-982.023) -- 0:00:53
144000 -- (-984.257) (-980.194) [-977.408] (-980.569) * (-979.916) [-977.501] (-977.078) (-980.262) -- 0:00:53
144500 -- (-983.049) (-978.357) [-977.954] (-977.983) * (-979.703) (-977.106) (-980.293) [-979.049] -- 0:00:53
145000 -- (-980.113) (-979.157) (-985.272) [-979.160] * (-980.284) [-977.337] (-977.024) (-982.506) -- 0:00:53
Average standard deviation of split frequencies: 0.020826
145500 -- [-977.772] (-982.958) (-987.830) (-978.915) * [-978.844] (-977.930) (-981.026) (-979.378) -- 0:00:52
146000 -- [-979.736] (-979.422) (-981.051) (-981.326) * (-979.142) (-977.489) [-981.677] (-978.991) -- 0:00:52
146500 -- [-979.403] (-981.448) (-979.429) (-979.906) * [-979.648] (-978.608) (-978.146) (-979.154) -- 0:00:52
147000 -- (-978.182) [-977.032] (-980.402) (-979.493) * (-979.778) [-978.434] (-983.489) (-978.429) -- 0:00:52
147500 -- (-979.183) (-978.053) [-982.152] (-979.361) * (-977.802) (-982.120) (-979.355) [-977.691] -- 0:00:52
148000 -- (-978.800) (-978.175) (-985.506) [-979.393] * (-983.114) [-977.620] (-979.261) (-977.359) -- 0:00:51
148500 -- (-983.736) (-979.935) (-980.277) [-978.248] * [-979.913] (-984.422) (-980.563) (-978.545) -- 0:00:51
149000 -- (-978.573) [-979.100] (-981.667) (-978.849) * (-981.913) (-980.813) (-978.772) [-978.264] -- 0:00:51
149500 -- (-982.205) [-978.158] (-980.847) (-980.135) * [-981.476] (-977.823) (-979.622) (-980.111) -- 0:00:51
150000 -- (-980.541) (-978.197) (-978.908) [-978.479] * [-979.758] (-979.558) (-980.872) (-979.672) -- 0:00:51
Average standard deviation of split frequencies: 0.022066
150500 -- [-978.643] (-984.049) (-978.955) (-979.142) * (-978.656) [-986.131] (-981.077) (-979.953) -- 0:00:50
151000 -- [-979.282] (-981.137) (-978.951) (-982.806) * (-978.731) (-979.189) [-979.204] (-979.955) -- 0:00:50
151500 -- [-982.752] (-981.515) (-978.705) (-977.698) * [-979.561] (-979.088) (-978.128) (-979.925) -- 0:00:50
152000 -- (-979.257) [-978.486] (-978.514) (-981.642) * (-977.559) [-977.136] (-981.393) (-979.257) -- 0:00:50
152500 -- (-979.113) (-979.500) [-980.692] (-983.061) * (-978.554) (-976.903) [-978.312] (-979.717) -- 0:00:55
153000 -- (-977.584) [-980.846] (-979.543) (-978.670) * (-981.073) (-979.429) [-979.918] (-986.914) -- 0:00:55
153500 -- (-977.597) (-979.940) [-979.388] (-979.932) * (-980.792) (-980.185) (-978.649) [-979.557] -- 0:00:55
154000 -- [-977.469] (-980.259) (-979.075) (-978.993) * [-980.397] (-978.397) (-980.190) (-977.071) -- 0:00:54
154500 -- (-979.571) (-978.089) (-979.464) [-977.748] * [-977.767] (-978.957) (-980.311) (-980.822) -- 0:00:54
155000 -- (-980.012) (-977.001) (-982.735) [-977.583] * (-977.238) (-978.757) [-978.787] (-977.473) -- 0:00:54
Average standard deviation of split frequencies: 0.020517
155500 -- [-978.368] (-978.169) (-978.282) (-978.437) * (-981.867) [-978.566] (-979.341) (-977.620) -- 0:00:54
156000 -- (-984.574) (-980.515) (-981.882) [-978.305] * (-980.698) [-978.346] (-980.422) (-978.482) -- 0:00:54
156500 -- (-983.318) [-979.713] (-986.216) (-978.806) * (-977.929) (-980.908) (-979.567) [-980.229] -- 0:00:53
157000 -- (-977.744) (-984.637) (-986.410) [-980.305] * [-977.782] (-982.618) (-978.958) (-982.020) -- 0:00:53
157500 -- (-979.120) (-980.103) (-980.677) [-977.546] * (-979.150) (-979.263) (-979.642) [-978.120] -- 0:00:53
158000 -- (-978.036) (-980.930) [-978.368] (-978.534) * (-984.029) (-979.189) (-981.114) [-977.848] -- 0:00:53
158500 -- (-979.766) (-979.600) [-978.715] (-978.597) * (-983.612) [-979.685] (-981.343) (-977.128) -- 0:00:53
159000 -- (-979.061) [-978.145] (-983.275) (-984.485) * (-979.856) [-978.767] (-978.093) (-978.074) -- 0:00:52
159500 -- (-978.502) (-977.230) [-980.804] (-979.484) * (-981.655) [-978.223] (-978.059) (-978.138) -- 0:00:52
160000 -- [-980.858] (-978.560) (-978.788) (-979.509) * (-979.508) (-977.918) [-977.521] (-980.158) -- 0:00:52
Average standard deviation of split frequencies: 0.019612
160500 -- (-981.610) (-978.990) (-979.545) [-985.578] * [-980.975] (-979.686) (-978.239) (-980.426) -- 0:00:52
161000 -- (-980.833) (-979.773) [-978.099] (-985.219) * (-978.202) (-978.155) (-978.859) [-980.425] -- 0:00:52
161500 -- (-981.991) [-978.835] (-979.641) (-980.251) * [-981.269] (-982.841) (-978.831) (-985.115) -- 0:00:51
162000 -- (-980.215) (-979.696) [-978.761] (-981.921) * (-979.784) [-979.043] (-984.813) (-978.503) -- 0:00:51
162500 -- (-978.639) [-978.766] (-978.896) (-982.462) * [-979.529] (-980.105) (-983.502) (-977.196) -- 0:00:51
163000 -- (-986.154) (-977.654) [-980.268] (-977.125) * (-979.989) (-980.788) [-982.016] (-978.142) -- 0:00:51
163500 -- (-981.203) [-978.287] (-978.916) (-978.091) * (-979.057) (-978.673) (-982.301) [-977.656] -- 0:00:51
164000 -- (-982.510) (-979.283) [-980.151] (-977.852) * [-979.792] (-979.408) (-979.490) (-982.035) -- 0:00:50
164500 -- (-977.622) (-983.746) [-977.015] (-976.799) * [-980.129] (-981.030) (-976.933) (-980.149) -- 0:00:50
165000 -- (-982.578) (-984.119) (-980.171) [-978.987] * (-982.521) [-983.607] (-978.589) (-980.013) -- 0:00:50
Average standard deviation of split frequencies: 0.020177
165500 -- [-978.400] (-981.820) (-979.347) (-979.156) * (-979.913) [-980.891] (-977.231) (-979.090) -- 0:00:50
166000 -- [-979.812] (-982.811) (-978.397) (-980.687) * [-976.993] (-981.947) (-977.403) (-978.268) -- 0:00:50
166500 -- (-980.220) (-980.366) (-978.755) [-980.083] * (-977.703) [-980.695] (-978.989) (-985.778) -- 0:00:50
167000 -- [-979.692] (-988.542) (-980.110) (-979.685) * (-977.686) (-979.208) [-977.459] (-981.082) -- 0:00:49
167500 -- (-980.393) [-980.147] (-981.044) (-979.471) * (-982.741) (-979.134) (-977.581) [-981.535] -- 0:00:49
168000 -- (-977.616) (-981.239) [-983.471] (-977.835) * (-982.657) (-981.157) (-977.917) [-979.489] -- 0:00:49
168500 -- (-977.136) (-978.994) [-980.407] (-977.483) * [-982.909] (-977.885) (-979.298) (-979.089) -- 0:00:49
169000 -- (-977.694) [-980.886] (-981.443) (-979.921) * [-977.390] (-980.826) (-977.612) (-980.778) -- 0:00:54
169500 -- (-977.388) [-977.807] (-983.056) (-978.315) * [-977.390] (-980.259) (-980.953) (-981.497) -- 0:00:53
170000 -- [-977.416] (-979.846) (-978.483) (-978.381) * (-978.777) (-977.687) [-981.857] (-978.559) -- 0:00:53
Average standard deviation of split frequencies: 0.020563
170500 -- (-981.704) (-980.523) (-979.686) [-976.978] * (-978.796) (-979.276) [-984.191] (-979.791) -- 0:00:53
171000 -- (-980.270) [-979.032] (-980.131) (-979.890) * (-978.667) (-980.917) (-980.108) [-978.586] -- 0:00:53
171500 -- (-979.384) (-979.764) (-978.522) [-981.866] * (-977.856) (-978.702) (-978.671) [-976.918] -- 0:00:53
172000 -- (-981.404) [-978.558] (-977.906) (-981.072) * [-978.112] (-978.455) (-980.401) (-978.305) -- 0:00:52
172500 -- [-979.226] (-979.498) (-979.561) (-979.705) * (-979.091) (-978.725) [-977.719] (-978.590) -- 0:00:52
173000 -- [-978.399] (-980.652) (-981.324) (-979.662) * (-977.321) [-983.766] (-980.368) (-977.750) -- 0:00:52
173500 -- (-977.848) (-979.503) (-978.000) [-982.359] * [-979.844] (-978.435) (-979.453) (-978.309) -- 0:00:52
174000 -- (-979.765) (-981.144) [-977.796] (-978.065) * (-979.825) [-978.180] (-982.382) (-977.674) -- 0:00:52
174500 -- (-978.807) (-979.346) (-977.540) [-977.998] * [-978.885] (-979.608) (-980.480) (-978.259) -- 0:00:52
175000 -- (-978.256) (-979.321) (-979.258) [-978.611] * (-978.729) (-979.173) (-978.483) [-978.669] -- 0:00:51
Average standard deviation of split frequencies: 0.020683
175500 -- (-981.331) [-979.847] (-977.008) (-979.476) * (-979.559) (-978.722) [-979.258] (-980.085) -- 0:00:51
176000 -- (-979.294) [-980.725] (-977.055) (-980.575) * (-979.736) (-978.738) (-979.800) [-980.541] -- 0:00:51
176500 -- (-978.972) (-983.396) [-977.055] (-981.000) * [-977.476] (-978.651) (-981.687) (-978.868) -- 0:00:51
177000 -- (-978.385) (-977.779) [-977.275] (-984.403) * (-977.783) (-978.843) (-978.682) [-982.589] -- 0:00:51
177500 -- (-981.413) (-977.789) (-978.040) [-979.094] * (-980.052) (-978.157) (-978.616) [-978.263] -- 0:00:50
178000 -- (-979.965) (-978.412) [-979.492] (-979.507) * (-981.777) [-978.024] (-978.890) (-977.612) -- 0:00:50
178500 -- (-979.475) [-978.038] (-978.884) (-977.835) * [-978.566] (-978.097) (-979.152) (-978.147) -- 0:00:50
179000 -- (-979.006) [-978.052] (-978.772) (-979.014) * (-977.509) (-979.586) (-985.964) [-980.921] -- 0:00:50
179500 -- (-980.040) [-980.391] (-979.114) (-977.981) * (-978.537) (-980.441) (-980.290) [-978.051] -- 0:00:50
180000 -- [-978.612] (-980.071) (-981.079) (-976.892) * [-980.561] (-978.455) (-977.014) (-980.730) -- 0:00:50
Average standard deviation of split frequencies: 0.020294
180500 -- [-978.655] (-978.701) (-977.140) (-977.222) * (-982.682) [-977.425] (-981.723) (-978.304) -- 0:00:49
181000 -- (-979.496) [-978.947] (-977.665) (-977.231) * [-981.164] (-977.006) (-983.151) (-978.070) -- 0:00:49
181500 -- (-981.239) (-979.464) (-977.760) [-980.984] * (-980.797) (-979.223) [-977.708] (-978.100) -- 0:00:49
182000 -- (-980.916) (-978.374) [-977.666] (-981.618) * (-982.285) (-977.392) [-977.616] (-978.971) -- 0:00:49
182500 -- (-978.554) [-979.251] (-976.893) (-979.953) * (-977.963) (-977.872) [-980.551] (-979.229) -- 0:00:49
183000 -- (-979.717) (-980.202) (-978.553) [-981.226] * (-977.473) [-978.022] (-980.965) (-983.440) -- 0:00:49
183500 -- [-978.427] (-981.486) (-983.493) (-977.854) * (-978.548) (-980.628) [-980.562] (-980.835) -- 0:00:48
184000 -- (-981.029) (-981.187) [-978.557] (-982.737) * (-978.374) [-977.042] (-982.011) (-980.088) -- 0:00:48
184500 -- [-978.825] (-977.858) (-979.557) (-979.012) * (-978.898) (-979.883) (-977.550) [-978.991] -- 0:00:48
185000 -- (-979.899) [-977.714] (-979.778) (-977.007) * (-977.844) (-979.753) (-981.007) [-977.543] -- 0:00:48
Average standard deviation of split frequencies: 0.021402
185500 -- (-979.971) [-980.342] (-980.998) (-978.431) * (-978.334) (-981.354) (-977.063) [-978.140] -- 0:00:52
186000 -- (-979.904) [-978.361] (-979.566) (-977.254) * [-978.641] (-981.972) (-979.065) (-978.050) -- 0:00:52
186500 -- [-978.363] (-978.348) (-978.265) (-980.097) * (-979.280) [-977.639] (-976.980) (-979.648) -- 0:00:52
187000 -- (-978.404) [-979.545] (-977.939) (-982.152) * (-977.708) [-977.750] (-977.325) (-980.052) -- 0:00:52
187500 -- (-979.641) (-980.571) [-977.990] (-978.071) * (-982.234) (-977.897) [-977.832] (-981.461) -- 0:00:52
188000 -- (-978.700) (-980.545) [-978.575] (-981.587) * (-979.611) (-979.752) (-980.729) [-978.698] -- 0:00:51
188500 -- [-979.133] (-979.602) (-979.078) (-979.793) * (-980.598) (-977.654) [-980.476] (-978.226) -- 0:00:51
189000 -- (-980.004) (-979.420) [-978.968] (-977.419) * (-984.531) [-978.428] (-980.865) (-978.221) -- 0:00:51
189500 -- (-979.172) (-976.906) (-982.176) [-976.943] * [-980.598] (-978.710) (-982.090) (-977.775) -- 0:00:51
190000 -- [-979.478] (-978.798) (-977.691) (-978.291) * (-978.989) (-977.449) (-977.548) [-978.395] -- 0:00:51
Average standard deviation of split frequencies: 0.020329
190500 -- (-981.236) [-978.271] (-980.988) (-978.342) * (-980.526) [-981.258] (-977.937) (-977.714) -- 0:00:50
191000 -- (-978.591) (-980.549) [-981.992] (-981.226) * [-979.438] (-981.177) (-978.403) (-978.184) -- 0:00:50
191500 -- [-978.034] (-977.792) (-979.549) (-979.603) * (-977.939) (-978.155) [-978.255] (-977.427) -- 0:00:50
192000 -- [-979.504] (-981.145) (-980.867) (-984.294) * (-977.777) [-980.041] (-978.102) (-978.846) -- 0:00:50
192500 -- (-980.043) [-979.759] (-980.539) (-981.818) * (-981.779) (-977.939) [-979.222] (-978.353) -- 0:00:50
193000 -- (-983.694) (-980.506) (-977.931) [-981.497] * [-977.584] (-977.301) (-980.782) (-978.709) -- 0:00:50
193500 -- (-981.191) [-981.599] (-980.565) (-979.559) * (-978.220) [-978.105] (-977.593) (-979.137) -- 0:00:50
194000 -- (-979.578) [-977.859] (-978.321) (-980.723) * (-978.010) (-978.403) (-977.435) [-979.041] -- 0:00:49
194500 -- (-980.376) [-980.911] (-978.370) (-979.097) * (-978.219) (-978.410) [-981.580] (-979.185) -- 0:00:49
195000 -- (-979.474) (-980.605) (-978.271) [-980.049] * [-979.598] (-980.099) (-983.371) (-979.157) -- 0:00:49
Average standard deviation of split frequencies: 0.020176
195500 -- (-979.981) (-979.722) (-978.663) [-978.544] * (-977.775) (-989.109) [-980.629] (-980.159) -- 0:00:49
196000 -- (-979.867) [-978.522] (-978.799) (-978.315) * [-982.205] (-980.198) (-981.555) (-979.198) -- 0:00:49
196500 -- (-979.655) (-978.086) (-979.141) [-978.760] * (-980.787) (-979.517) [-983.461] (-980.618) -- 0:00:49
197000 -- (-980.569) (-978.657) (-978.695) [-978.656] * (-979.410) (-982.253) [-984.036] (-979.140) -- 0:00:48
197500 -- (-980.346) (-977.771) (-979.135) [-978.544] * (-978.280) (-978.951) [-983.184] (-980.023) -- 0:00:48
198000 -- (-979.838) [-978.784] (-978.780) (-977.667) * (-979.612) (-980.009) (-979.473) [-979.068] -- 0:00:48
198500 -- [-980.862] (-977.632) (-978.309) (-978.148) * [-979.729] (-979.439) (-978.119) (-978.507) -- 0:00:48
199000 -- (-982.216) (-982.443) (-981.869) [-978.272] * [-979.380] (-977.937) (-980.391) (-978.270) -- 0:00:48
199500 -- (-979.074) (-978.817) [-981.235] (-978.913) * (-978.502) (-979.016) [-977.660] (-978.091) -- 0:00:48
200000 -- (-979.455) (-978.362) (-982.098) [-978.238] * (-977.065) [-980.867] (-978.187) (-977.874) -- 0:00:48
Average standard deviation of split frequencies: 0.020621
200500 -- (-977.852) (-977.475) [-978.849] (-978.114) * (-977.196) (-983.199) [-980.854] (-978.244) -- 0:00:47
201000 -- [-981.189] (-980.097) (-981.117) (-979.263) * [-977.345] (-982.902) (-982.852) (-984.258) -- 0:00:47
201500 -- (-980.445) (-978.778) [-979.235] (-977.630) * (-976.929) (-979.560) (-978.181) [-981.775] -- 0:00:51
202000 -- (-978.336) [-979.611] (-978.790) (-977.745) * (-977.392) (-979.520) [-977.825] (-980.610) -- 0:00:51
202500 -- (-980.427) (-982.586) [-977.351] (-978.155) * (-978.642) (-981.496) [-978.417] (-978.511) -- 0:00:51
203000 -- (-980.043) [-980.717] (-978.115) (-978.627) * (-978.253) (-979.883) (-979.352) [-980.314] -- 0:00:51
203500 -- (-983.636) [-980.594] (-978.889) (-978.458) * [-976.982] (-977.676) (-979.341) (-978.012) -- 0:00:50
204000 -- (-983.706) [-979.342] (-978.102) (-981.802) * (-977.608) (-977.256) (-979.661) [-977.097] -- 0:00:50
204500 -- (-981.292) [-980.419] (-980.862) (-983.246) * [-978.234] (-977.184) (-978.116) (-977.859) -- 0:00:50
205000 -- (-978.012) (-979.128) (-978.073) [-978.623] * (-979.744) (-977.466) [-977.245] (-981.199) -- 0:00:50
Average standard deviation of split frequencies: 0.019705
205500 -- (-977.522) (-980.748) (-980.834) [-978.366] * [-980.832] (-978.136) (-980.885) (-983.439) -- 0:00:50
206000 -- (-978.050) [-980.006] (-979.643) (-976.975) * [-979.318] (-978.998) (-977.382) (-980.419) -- 0:00:50
206500 -- (-978.773) (-977.297) (-978.660) [-977.789] * (-979.620) (-979.184) (-982.021) [-979.894] -- 0:00:49
207000 -- [-979.000] (-978.624) (-977.904) (-977.189) * (-979.543) [-978.990] (-980.408) (-977.399) -- 0:00:49
207500 -- (-978.955) (-979.647) [-978.440] (-978.845) * [-978.219] (-980.060) (-979.914) (-979.089) -- 0:00:49
208000 -- (-980.007) (-978.883) (-981.543) [-977.436] * (-977.347) (-979.884) (-980.010) [-977.613] -- 0:00:49
208500 -- (-978.641) [-978.033] (-979.575) (-981.638) * (-979.299) (-978.573) [-979.223] (-982.135) -- 0:00:49
209000 -- (-979.378) (-980.573) [-981.080] (-977.131) * (-980.471) (-978.551) (-982.764) [-978.134] -- 0:00:49
209500 -- (-978.170) (-979.418) [-978.031] (-977.187) * (-978.406) [-979.693] (-978.808) (-978.337) -- 0:00:49
210000 -- (-981.737) (-977.978) (-977.639) [-976.730] * [-978.430] (-980.076) (-980.025) (-980.834) -- 0:00:48
Average standard deviation of split frequencies: 0.021982
210500 -- (-980.315) (-978.447) (-978.182) [-977.720] * (-978.695) (-977.594) [-978.040] (-978.735) -- 0:00:48
211000 -- (-978.533) (-981.670) [-981.119] (-983.634) * (-981.438) (-980.891) [-980.083] (-980.200) -- 0:00:48
211500 -- (-978.500) [-982.910] (-978.046) (-979.917) * [-978.318] (-980.461) (-985.662) (-977.860) -- 0:00:48
212000 -- [-978.835] (-983.551) (-977.691) (-977.079) * (-976.802) [-978.163] (-980.023) (-977.738) -- 0:00:48
212500 -- (-981.974) (-980.424) [-979.518] (-983.831) * (-982.555) (-979.056) (-982.939) [-979.046] -- 0:00:48
213000 -- (-977.732) [-979.896] (-981.264) (-980.189) * (-981.634) (-981.276) (-983.606) [-979.797] -- 0:00:48
213500 -- (-978.567) [-983.948] (-978.291) (-978.314) * [-979.808] (-978.719) (-978.911) (-981.682) -- 0:00:47
214000 -- [-978.563] (-978.812) (-978.269) (-981.001) * (-980.552) (-978.111) [-979.957] (-981.073) -- 0:00:47
214500 -- (-984.728) [-979.274] (-979.844) (-977.990) * (-984.046) (-978.434) (-979.382) [-985.098] -- 0:00:47
215000 -- (-983.689) (-977.204) [-981.741] (-977.983) * (-978.344) (-977.122) [-977.834] (-978.696) -- 0:00:47
Average standard deviation of split frequencies: 0.021054
215500 -- (-983.357) [-977.315] (-979.834) (-978.155) * (-977.289) (-978.467) (-980.936) [-978.906] -- 0:00:47
216000 -- (-983.451) (-978.768) [-978.665] (-979.079) * (-977.514) (-977.586) (-981.985) [-977.955] -- 0:00:47
216500 -- (-981.123) [-980.654] (-981.304) (-979.279) * (-978.403) (-977.602) (-982.159) [-981.072] -- 0:00:47
217000 -- (-980.761) (-979.719) [-979.176] (-978.036) * [-979.276] (-979.074) (-983.382) (-977.650) -- 0:00:46
217500 -- (-978.520) (-980.279) (-983.677) [-979.072] * (-977.540) (-981.937) (-979.443) [-979.625] -- 0:00:46
218000 -- (-980.161) [-979.632] (-978.498) (-979.716) * (-979.258) [-981.937] (-979.937) (-980.814) -- 0:00:50
218500 -- (-977.051) [-979.560] (-979.426) (-978.421) * [-977.995] (-981.752) (-980.067) (-980.866) -- 0:00:50
219000 -- [-977.679] (-980.603) (-979.110) (-977.536) * (-978.653) (-977.069) [-980.789] (-981.883) -- 0:00:49
219500 -- (-980.278) (-980.091) (-979.559) [-977.939] * (-981.249) (-978.052) [-982.166] (-979.668) -- 0:00:49
220000 -- (-979.068) (-979.159) [-978.291] (-978.702) * (-980.320) (-976.994) [-978.477] (-981.215) -- 0:00:49
Average standard deviation of split frequencies: 0.021614
220500 -- [-978.027] (-980.392) (-978.940) (-977.500) * [-979.939] (-979.395) (-978.951) (-983.022) -- 0:00:49
221000 -- [-979.318] (-982.210) (-978.405) (-981.049) * (-979.852) [-980.032] (-979.475) (-979.494) -- 0:00:49
221500 -- (-979.689) (-981.400) (-978.110) [-978.285] * (-978.969) [-977.112] (-978.890) (-979.187) -- 0:00:49
222000 -- (-979.196) (-979.583) (-979.210) [-977.053] * [-986.453] (-984.056) (-978.304) (-978.695) -- 0:00:49
222500 -- (-979.461) [-981.097] (-979.085) (-979.694) * (-986.743) (-985.388) (-979.076) [-980.575] -- 0:00:48
223000 -- (-982.849) (-980.174) (-985.241) [-981.394] * (-977.940) [-979.955] (-980.731) (-980.139) -- 0:00:48
223500 -- (-981.571) (-979.932) (-982.696) [-979.757] * (-979.649) [-981.656] (-976.701) (-978.471) -- 0:00:48
224000 -- (-980.045) [-979.604] (-977.898) (-981.534) * (-978.302) (-984.553) [-978.389] (-983.010) -- 0:00:48
224500 -- (-985.255) [-978.112] (-979.327) (-979.363) * (-980.807) (-976.873) (-977.396) [-978.356] -- 0:00:48
225000 -- (-979.532) (-977.325) [-979.979] (-980.646) * (-979.663) [-979.628] (-979.307) (-980.507) -- 0:00:48
Average standard deviation of split frequencies: 0.023067
225500 -- (-978.503) [-980.122] (-976.880) (-979.246) * (-980.478) (-978.234) (-981.107) [-979.767] -- 0:00:48
226000 -- (-983.474) [-978.957] (-977.246) (-979.452) * (-979.712) [-977.617] (-978.284) (-980.169) -- 0:00:47
226500 -- (-978.914) [-978.101] (-976.766) (-978.273) * [-978.117] (-979.160) (-978.653) (-980.290) -- 0:00:47
227000 -- (-982.987) [-979.847] (-976.884) (-977.972) * (-987.524) (-979.905) (-978.935) [-979.661] -- 0:00:47
227500 -- [-979.698] (-977.932) (-977.993) (-977.333) * (-984.568) (-978.750) [-977.310] (-977.593) -- 0:00:47
228000 -- [-977.775] (-979.590) (-977.383) (-978.219) * (-981.483) [-979.467] (-977.188) (-977.826) -- 0:00:47
228500 -- (-979.201) [-981.303] (-979.826) (-978.908) * (-984.812) [-977.728] (-977.875) (-977.615) -- 0:00:47
229000 -- [-979.300] (-981.538) (-980.827) (-978.949) * (-987.380) (-979.541) (-981.115) [-979.926] -- 0:00:47
229500 -- [-980.612] (-978.558) (-980.779) (-978.977) * [-979.198] (-982.109) (-982.439) (-978.614) -- 0:00:47
230000 -- [-978.617] (-978.542) (-979.154) (-984.214) * (-977.676) [-982.140] (-981.561) (-977.557) -- 0:00:46
Average standard deviation of split frequencies: 0.024524
230500 -- (-977.705) (-979.253) (-977.883) [-977.438] * (-981.174) [-978.330] (-980.571) (-978.130) -- 0:00:46
231000 -- (-979.515) (-978.483) [-978.589] (-977.027) * (-980.472) [-984.829] (-978.542) (-979.966) -- 0:00:46
231500 -- (-977.574) (-979.794) (-979.194) [-977.309] * (-981.363) (-982.961) (-982.916) [-978.350] -- 0:00:46
232000 -- (-979.806) [-979.379] (-977.586) (-977.673) * (-977.382) (-978.526) (-978.314) [-977.414] -- 0:00:46
232500 -- (-976.880) (-980.745) [-977.673] (-978.589) * [-977.828] (-982.150) (-978.219) (-981.310) -- 0:00:46
233000 -- (-980.080) (-977.445) [-977.920] (-980.877) * [-976.748] (-980.202) (-979.027) (-977.654) -- 0:00:46
233500 -- (-979.316) (-981.732) (-977.336) [-981.851] * (-979.151) [-977.405] (-983.936) (-980.451) -- 0:00:45
234000 -- [-977.646] (-978.193) (-978.374) (-980.153) * (-979.640) (-977.130) [-977.887] (-978.726) -- 0:00:45
234500 -- (-983.609) (-981.256) [-979.110] (-977.409) * (-980.380) [-979.190] (-980.080) (-980.568) -- 0:00:48
235000 -- [-978.212] (-980.480) (-979.835) (-977.437) * (-978.221) [-978.556] (-985.773) (-982.757) -- 0:00:48
Average standard deviation of split frequencies: 0.024205
235500 -- (-979.415) (-983.283) (-978.218) [-978.350] * (-979.238) (-979.130) (-982.295) [-979.675] -- 0:00:48
236000 -- (-977.663) (-981.558) (-978.529) [-983.153] * (-978.308) [-978.039] (-977.560) (-981.115) -- 0:00:48
236500 -- [-976.734] (-982.245) (-978.608) (-981.901) * (-978.149) (-979.028) (-977.425) [-977.086] -- 0:00:48
237000 -- [-977.597] (-977.170) (-979.540) (-979.736) * [-977.454] (-979.216) (-978.293) (-977.401) -- 0:00:48
237500 -- [-980.596] (-979.255) (-979.098) (-984.395) * [-977.116] (-980.268) (-983.288) (-981.624) -- 0:00:48
238000 -- [-980.820] (-979.371) (-980.602) (-982.315) * [-976.687] (-979.898) (-981.611) (-978.380) -- 0:00:48
238500 -- (-977.884) [-979.604] (-979.783) (-979.946) * (-980.864) (-981.359) [-977.716] (-977.816) -- 0:00:47
239000 -- [-978.077] (-980.384) (-977.989) (-980.295) * (-978.680) [-979.156] (-980.764) (-978.664) -- 0:00:47
239500 -- [-977.568] (-980.213) (-979.457) (-983.916) * [-978.290] (-976.861) (-980.796) (-978.864) -- 0:00:47
240000 -- (-979.717) (-977.651) (-980.341) [-980.936] * (-979.725) (-979.423) (-977.558) [-979.272] -- 0:00:47
Average standard deviation of split frequencies: 0.021892
240500 -- (-980.598) [-979.125] (-983.524) (-978.006) * [-979.305] (-980.418) (-980.737) (-978.857) -- 0:00:47
241000 -- (-977.674) [-980.625] (-980.572) (-977.863) * (-980.829) (-981.817) (-978.315) [-979.827] -- 0:00:47
241500 -- (-979.139) (-980.642) (-978.279) [-978.590] * (-979.652) (-978.442) [-978.252] (-978.420) -- 0:00:47
242000 -- [-977.587] (-979.508) (-980.077) (-980.618) * (-978.384) (-976.740) [-978.249] (-983.394) -- 0:00:46
242500 -- (-979.372) (-978.986) (-981.371) [-979.175] * (-980.274) (-982.873) [-977.875] (-979.803) -- 0:00:46
243000 -- [-981.107] (-978.839) (-982.647) (-979.067) * (-977.338) [-977.492] (-978.156) (-977.976) -- 0:00:46
243500 -- (-980.132) [-979.976] (-982.233) (-978.714) * (-980.767) (-977.728) [-977.456] (-979.670) -- 0:00:46
244000 -- (-981.826) (-978.285) (-983.896) [-981.761] * (-981.308) [-980.465] (-977.929) (-978.102) -- 0:00:46
244500 -- [-982.244] (-978.902) (-981.953) (-980.373) * (-984.595) (-981.113) (-980.650) [-979.649] -- 0:00:46
245000 -- (-980.469) (-978.589) [-985.944] (-978.808) * (-985.472) (-979.741) (-977.238) [-980.472] -- 0:00:46
Average standard deviation of split frequencies: 0.020854
245500 -- (-979.072) [-980.178] (-978.646) (-980.148) * (-980.594) (-978.033) (-977.855) [-979.271] -- 0:00:46
246000 -- (-978.196) (-982.112) [-980.406] (-978.259) * (-979.390) (-978.612) [-981.042] (-982.049) -- 0:00:45
246500 -- [-978.734] (-982.935) (-980.784) (-978.897) * (-978.655) [-980.023] (-978.457) (-981.609) -- 0:00:45
247000 -- (-977.679) (-980.531) [-980.892] (-978.297) * (-978.689) [-979.939] (-978.495) (-983.094) -- 0:00:45
247500 -- (-977.079) [-977.262] (-980.846) (-983.711) * (-977.430) [-977.746] (-977.182) (-980.842) -- 0:00:45
248000 -- (-977.850) (-977.331) (-979.385) [-977.842] * (-977.058) [-978.442] (-977.710) (-978.729) -- 0:00:45
248500 -- (-977.309) (-980.079) (-979.319) [-977.946] * [-978.000] (-977.455) (-977.872) (-981.769) -- 0:00:45
249000 -- (-978.409) [-977.599] (-978.616) (-978.672) * [-979.508] (-977.819) (-980.086) (-982.908) -- 0:00:45
249500 -- (-978.742) [-978.997] (-978.987) (-981.742) * (-978.963) (-977.935) [-980.544] (-980.247) -- 0:00:45
250000 -- (-978.276) [-977.681] (-979.985) (-977.761) * (-980.941) (-977.713) [-979.840] (-979.693) -- 0:00:45
Average standard deviation of split frequencies: 0.021000
250500 -- (-979.620) [-979.067] (-978.887) (-979.019) * (-980.367) (-979.723) [-980.239] (-980.421) -- 0:00:47
251000 -- (-977.257) (-980.295) (-977.759) [-984.102] * [-977.461] (-978.744) (-979.545) (-979.994) -- 0:00:47
251500 -- (-979.243) (-981.608) (-983.029) [-980.183] * [-979.856] (-982.020) (-979.189) (-978.803) -- 0:00:47
252000 -- (-983.173) [-977.428] (-981.191) (-979.404) * [-977.321] (-981.038) (-976.969) (-978.731) -- 0:00:47
252500 -- (-979.694) [-977.428] (-979.460) (-979.306) * [-984.223] (-978.359) (-983.313) (-978.565) -- 0:00:47
253000 -- (-978.269) [-978.179] (-978.501) (-979.515) * (-976.679) (-980.570) [-977.651] (-978.398) -- 0:00:47
253500 -- (-979.643) (-979.909) (-978.279) [-980.534] * (-977.417) (-977.907) (-978.879) [-977.595] -- 0:00:47
254000 -- (-981.024) (-978.780) [-977.012] (-978.502) * [-977.334] (-978.661) (-977.767) (-981.403) -- 0:00:46
254500 -- (-982.354) [-977.089] (-978.363) (-981.872) * (-976.742) (-979.444) (-978.877) [-978.578] -- 0:00:46
255000 -- (-979.685) (-977.848) (-984.643) [-981.769] * (-977.066) (-978.777) (-978.013) [-981.881] -- 0:00:46
Average standard deviation of split frequencies: 0.021483
255500 -- (-980.357) [-977.638] (-979.799) (-980.122) * (-977.069) [-978.634] (-979.707) (-979.083) -- 0:00:46
256000 -- (-978.332) [-978.496] (-979.425) (-979.998) * (-977.921) (-977.059) (-979.077) [-977.272] -- 0:00:46
256500 -- (-980.549) (-977.402) (-979.064) [-979.593] * (-977.769) (-976.942) [-979.723] (-977.785) -- 0:00:46
257000 -- (-978.298) (-977.396) (-983.342) [-977.501] * (-977.668) (-978.313) (-981.323) [-977.818] -- 0:00:46
257500 -- (-978.535) (-979.429) [-981.147] (-981.901) * (-978.775) [-979.110] (-978.669) (-976.975) -- 0:00:46
258000 -- (-978.083) (-979.769) [-977.588] (-982.665) * [-978.238] (-979.747) (-981.046) (-977.668) -- 0:00:46
258500 -- (-979.067) (-983.281) [-978.454] (-979.956) * [-981.115] (-979.009) (-979.026) (-982.860) -- 0:00:45
259000 -- [-980.590] (-982.912) (-978.174) (-978.432) * (-985.737) (-980.060) [-978.058] (-979.364) -- 0:00:45
259500 -- (-982.180) [-981.199] (-980.857) (-979.245) * (-981.722) (-981.004) [-977.964] (-977.402) -- 0:00:45
260000 -- (-978.347) [-978.416] (-979.117) (-978.664) * (-980.800) (-981.452) (-980.394) [-978.277] -- 0:00:45
Average standard deviation of split frequencies: 0.020940
260500 -- (-979.047) (-981.913) (-978.491) [-980.471] * [-980.831] (-979.262) (-980.308) (-980.376) -- 0:00:45
261000 -- (-980.431) (-981.013) (-978.714) [-978.139] * (-979.142) (-981.275) (-981.241) [-981.275] -- 0:00:45
261500 -- (-978.175) (-981.516) [-978.840] (-977.847) * [-977.544] (-977.418) (-980.732) (-979.582) -- 0:00:45
262000 -- (-977.046) (-978.905) [-982.418] (-978.496) * (-978.434) (-979.063) (-979.519) [-978.188] -- 0:00:45
262500 -- (-977.277) (-979.108) [-979.767] (-979.317) * (-977.203) [-979.884] (-978.914) (-979.933) -- 0:00:44
263000 -- (-980.254) [-979.156] (-979.183) (-980.654) * (-978.806) (-981.283) (-979.828) [-978.865] -- 0:00:44
263500 -- (-983.915) (-980.711) (-983.216) [-978.813] * [-980.032] (-977.452) (-978.832) (-977.340) -- 0:00:44
264000 -- (-980.776) (-979.721) [-979.036] (-978.412) * (-978.661) [-978.735] (-977.660) (-978.830) -- 0:00:44
264500 -- (-981.011) (-978.596) (-979.774) [-978.215] * [-978.416] (-982.003) (-981.265) (-977.827) -- 0:00:44
265000 -- [-977.734] (-978.646) (-980.738) (-978.467) * (-978.461) (-981.470) (-977.974) [-979.196] -- 0:00:44
Average standard deviation of split frequencies: 0.019587
265500 -- [-977.011] (-980.417) (-981.187) (-978.409) * (-979.007) (-983.451) (-977.844) [-977.970] -- 0:00:44
266000 -- (-976.992) (-980.482) (-978.064) [-978.526] * (-979.917) (-983.656) [-977.284] (-977.334) -- 0:00:44
266500 -- (-979.044) (-980.981) [-980.124] (-979.516) * (-977.963) (-980.025) (-980.130) [-977.947] -- 0:00:44
267000 -- (-978.985) (-978.503) [-980.325] (-977.741) * (-980.302) (-981.404) (-977.106) [-980.167] -- 0:00:46
267500 -- [-977.255] (-978.485) (-981.433) (-977.745) * [-978.510] (-978.677) (-980.783) (-977.637) -- 0:00:46
268000 -- (-977.231) [-981.155] (-979.016) (-977.991) * (-978.912) (-978.308) [-977.697] (-977.477) -- 0:00:46
268500 -- [-977.502] (-981.231) (-978.324) (-979.319) * [-976.807] (-978.532) (-979.924) (-987.608) -- 0:00:46
269000 -- (-977.711) (-981.104) (-979.839) [-978.531] * (-983.196) (-983.322) (-977.445) [-979.398] -- 0:00:46
269500 -- [-977.998] (-978.351) (-982.617) (-979.148) * (-983.271) (-980.750) [-978.090] (-982.576) -- 0:00:46
270000 -- (-979.035) (-977.568) (-978.322) [-977.756] * (-985.597) (-980.239) [-978.185] (-978.003) -- 0:00:45
Average standard deviation of split frequencies: 0.019250
270500 -- (-979.144) (-978.016) (-979.333) [-977.955] * (-979.937) [-980.036] (-977.857) (-978.965) -- 0:00:45
271000 -- (-977.653) (-978.000) [-981.124] (-981.405) * (-983.217) (-978.608) [-977.994] (-978.093) -- 0:00:45
271500 -- (-981.704) (-978.655) [-979.750] (-980.159) * (-981.129) (-982.314) [-980.728] (-981.768) -- 0:00:45
272000 -- [-981.122] (-978.260) (-981.290) (-983.495) * [-978.398] (-979.498) (-979.536) (-981.251) -- 0:00:45
272500 -- (-980.957) (-981.079) [-977.984] (-979.325) * (-979.160) [-979.631] (-977.136) (-980.463) -- 0:00:45
273000 -- (-978.069) [-978.328] (-977.592) (-981.045) * (-980.080) (-978.145) (-978.001) [-978.758] -- 0:00:45
273500 -- (-980.789) (-980.641) (-976.926) [-977.977] * (-979.196) (-978.287) [-977.877] (-977.647) -- 0:00:45
274000 -- (-983.136) (-980.798) (-981.175) [-980.406] * (-977.865) [-978.590] (-985.745) (-978.891) -- 0:00:45
274500 -- (-980.356) [-978.553] (-979.665) (-978.824) * (-979.095) (-978.296) [-981.167] (-980.052) -- 0:00:44
275000 -- (-981.185) [-979.571] (-979.383) (-979.670) * (-977.452) (-979.214) [-980.921] (-979.491) -- 0:00:44
Average standard deviation of split frequencies: 0.020586
275500 -- (-982.425) [-980.210] (-980.538) (-978.503) * [-978.904] (-979.376) (-980.194) (-979.442) -- 0:00:44
276000 -- (-981.847) [-980.564] (-980.386) (-976.943) * [-980.262] (-981.142) (-977.919) (-978.797) -- 0:00:44
276500 -- [-979.569] (-977.993) (-979.607) (-979.063) * (-986.738) (-979.829) (-978.376) [-978.978] -- 0:00:44
277000 -- (-981.279) (-978.741) (-980.087) [-981.563] * (-985.991) (-978.661) (-978.483) [-978.867] -- 0:00:44
277500 -- [-979.170] (-979.803) (-981.355) (-984.233) * [-979.453] (-977.409) (-980.073) (-980.083) -- 0:00:44
278000 -- (-978.673) (-977.827) (-980.376) [-979.624] * (-982.391) (-976.951) (-978.360) [-979.126] -- 0:00:44
278500 -- (-979.027) (-977.822) (-980.366) [-979.934] * (-980.264) (-977.129) [-978.669] (-979.488) -- 0:00:44
279000 -- [-978.869] (-981.852) (-979.908) (-982.387) * (-979.164) (-979.676) (-979.792) [-979.208] -- 0:00:43
279500 -- (-979.853) [-979.020] (-985.199) (-982.154) * [-979.386] (-979.894) (-979.460) (-980.922) -- 0:00:43
280000 -- (-979.739) [-980.083] (-983.524) (-978.561) * [-978.733] (-978.750) (-978.464) (-981.527) -- 0:00:43
Average standard deviation of split frequencies: 0.019713
280500 -- (-980.058) (-980.171) (-977.140) [-977.552] * (-980.948) (-980.270) [-978.844] (-982.421) -- 0:00:43
281000 -- (-985.524) (-979.936) [-978.687] (-979.371) * [-981.387] (-979.527) (-980.882) (-979.203) -- 0:00:43
281500 -- (-977.719) [-981.727] (-979.133) (-978.194) * [-979.462] (-978.533) (-982.301) (-977.726) -- 0:00:43
282000 -- (-979.443) (-977.999) [-979.132] (-977.066) * [-983.552] (-977.444) (-978.179) (-979.467) -- 0:00:43
282500 -- (-982.511) [-977.537] (-978.266) (-978.333) * [-980.961] (-979.268) (-977.660) (-980.989) -- 0:00:43
283000 -- (-980.189) (-980.617) (-978.318) [-978.230] * (-979.449) (-979.023) [-977.705] (-977.444) -- 0:00:43
283500 -- [-980.463] (-980.867) (-978.132) (-980.343) * (-979.018) [-984.118] (-978.383) (-979.882) -- 0:00:45
284000 -- [-978.563] (-977.180) (-977.804) (-977.693) * (-977.509) [-980.497] (-977.331) (-981.293) -- 0:00:45
284500 -- (-979.224) (-980.427) [-977.804] (-978.294) * (-977.180) (-980.674) [-977.261] (-981.680) -- 0:00:45
285000 -- (-977.607) [-983.660] (-981.666) (-979.180) * [-977.081] (-978.281) (-978.080) (-981.803) -- 0:00:45
Average standard deviation of split frequencies: 0.019953
285500 -- (-979.233) (-978.358) [-982.168] (-978.874) * (-977.982) [-977.508] (-977.679) (-979.987) -- 0:00:45
286000 -- (-981.707) [-978.688] (-979.070) (-984.985) * (-977.360) (-982.215) [-977.148] (-980.832) -- 0:00:44
286500 -- (-981.798) (-977.589) (-978.838) [-978.452] * (-981.034) [-979.894] (-976.935) (-978.966) -- 0:00:44
287000 -- (-978.494) [-977.692] (-977.091) (-977.395) * (-984.332) (-979.946) (-977.835) [-977.287] -- 0:00:44
287500 -- (-977.855) [-978.175] (-977.411) (-977.803) * (-983.156) (-982.906) (-977.701) [-977.504] -- 0:00:44
288000 -- (-978.180) (-979.788) [-979.625] (-978.567) * [-978.212] (-982.143) (-977.824) (-979.947) -- 0:00:44
288500 -- [-979.789] (-978.320) (-979.362) (-978.161) * [-978.341] (-979.433) (-981.292) (-979.834) -- 0:00:44
289000 -- (-977.371) (-978.124) (-980.226) [-978.173] * [-979.400] (-983.256) (-979.603) (-979.679) -- 0:00:44
289500 -- (-980.374) (-977.487) (-981.682) [-977.984] * (-978.212) (-978.379) (-978.965) [-981.935] -- 0:00:44
290000 -- (-981.511) [-981.029] (-979.789) (-978.019) * (-977.621) (-977.186) (-978.686) [-981.835] -- 0:00:44
Average standard deviation of split frequencies: 0.020002
290500 -- (-983.336) (-980.150) (-979.502) [-978.892] * (-980.259) [-978.430] (-978.686) (-981.341) -- 0:00:43
291000 -- (-980.607) (-979.235) [-977.887] (-980.289) * (-982.044) (-977.196) [-980.067] (-981.229) -- 0:00:43
291500 -- [-977.294] (-979.751) (-977.461) (-980.821) * (-982.537) (-977.257) (-978.883) [-979.744] -- 0:00:43
292000 -- (-979.615) [-978.195] (-977.924) (-979.559) * [-979.621] (-977.340) (-978.149) (-978.771) -- 0:00:43
292500 -- [-977.040] (-977.690) (-978.218) (-985.471) * (-980.180) (-979.752) (-978.448) [-980.623] -- 0:00:43
293000 -- (-977.920) [-977.723] (-978.405) (-978.511) * [-978.939] (-979.705) (-980.435) (-981.044) -- 0:00:43
293500 -- (-978.931) (-979.109) (-979.732) [-978.994] * [-977.870] (-983.308) (-978.955) (-979.590) -- 0:00:43
294000 -- (-979.665) (-978.313) (-981.895) [-977.634] * (-977.786) (-978.251) [-977.536] (-977.898) -- 0:00:43
294500 -- [-977.487] (-977.234) (-981.446) (-977.547) * (-978.273) [-980.100] (-980.273) (-979.944) -- 0:00:43
295000 -- (-978.323) (-977.993) (-977.492) [-980.247] * [-980.734] (-979.496) (-977.039) (-981.936) -- 0:00:43
Average standard deviation of split frequencies: 0.019614
295500 -- (-981.900) [-982.202] (-977.834) (-982.080) * (-978.713) (-978.937) (-979.603) [-985.003] -- 0:00:42
296000 -- (-980.787) (-979.666) [-978.366] (-978.812) * (-978.110) [-978.546] (-977.640) (-979.563) -- 0:00:42
296500 -- (-977.137) (-981.882) (-978.341) [-977.270] * [-977.564] (-977.955) (-977.375) (-979.158) -- 0:00:42
297000 -- (-978.883) (-978.138) (-981.625) [-979.044] * (-979.177) [-977.818] (-980.245) (-977.977) -- 0:00:42
297500 -- [-979.582] (-977.669) (-979.792) (-980.093) * (-978.555) [-977.622] (-979.796) (-976.837) -- 0:00:42
298000 -- [-977.985] (-980.529) (-980.678) (-980.624) * (-978.410) (-978.240) [-979.112] (-981.137) -- 0:00:42
298500 -- (-980.157) (-979.634) [-977.390] (-982.189) * [-978.891] (-978.874) (-981.221) (-977.947) -- 0:00:42
299000 -- (-977.439) (-981.433) [-979.943] (-980.676) * [-981.916] (-978.432) (-978.267) (-978.216) -- 0:00:42
299500 -- (-979.685) (-977.310) [-979.122] (-979.535) * (-978.712) (-980.048) [-980.448] (-982.808) -- 0:00:42
300000 -- [-982.021] (-978.269) (-981.441) (-976.880) * (-978.411) (-980.320) [-980.567] (-981.015) -- 0:00:44
Average standard deviation of split frequencies: 0.019337
300500 -- (-982.595) (-977.245) [-978.383] (-976.842) * [-981.295] (-980.297) (-981.422) (-979.859) -- 0:00:44
301000 -- (-979.843) (-977.151) (-981.905) [-988.809] * (-981.047) [-978.119] (-981.446) (-983.416) -- 0:00:44
301500 -- (-979.184) (-977.678) (-979.459) [-978.202] * (-979.736) [-979.642] (-980.718) (-983.375) -- 0:00:44
302000 -- [-978.936] (-977.924) (-980.862) (-978.631) * (-979.975) (-979.258) [-977.990] (-982.785) -- 0:00:43
302500 -- (-984.363) (-978.735) [-978.279] (-983.428) * [-979.385] (-980.486) (-979.200) (-980.668) -- 0:00:43
303000 -- (-978.189) (-978.081) (-978.263) [-983.536] * (-988.769) [-979.370] (-977.883) (-979.147) -- 0:00:43
303500 -- (-980.621) (-978.022) [-977.590] (-978.115) * [-977.434] (-977.635) (-977.971) (-982.389) -- 0:00:43
304000 -- (-979.097) (-978.317) [-980.672] (-979.408) * [-978.899] (-978.490) (-979.415) (-981.837) -- 0:00:43
304500 -- [-978.694] (-979.408) (-980.081) (-979.601) * [-980.745] (-979.732) (-977.113) (-978.022) -- 0:00:43
305000 -- (-981.800) [-981.090] (-981.407) (-978.300) * (-979.714) [-980.506] (-977.029) (-978.919) -- 0:00:43
Average standard deviation of split frequencies: 0.018649
305500 -- (-979.737) (-978.945) [-978.487] (-978.301) * [-977.512] (-979.434) (-977.566) (-977.591) -- 0:00:43
306000 -- (-981.911) (-979.074) (-978.352) [-981.915] * (-981.332) (-980.337) [-978.928] (-980.160) -- 0:00:43
306500 -- (-978.586) (-977.542) (-977.894) [-983.154] * (-983.270) [-980.215] (-980.146) (-978.235) -- 0:00:42
307000 -- (-977.505) (-983.544) (-977.885) [-981.751] * [-978.101] (-977.484) (-981.839) (-981.189) -- 0:00:42
307500 -- (-977.221) (-978.556) (-977.549) [-980.479] * [-978.849] (-977.989) (-982.773) (-979.485) -- 0:00:42
308000 -- (-978.279) [-977.636] (-977.492) (-983.625) * (-977.977) [-978.126] (-979.039) (-979.487) -- 0:00:42
308500 -- (-977.997) (-980.501) [-979.286] (-979.735) * (-980.555) [-976.877] (-980.152) (-979.210) -- 0:00:42
309000 -- (-978.008) (-978.044) (-977.722) [-979.347] * (-978.193) (-977.735) (-981.222) [-978.653] -- 0:00:42
309500 -- (-978.044) (-978.721) (-979.719) [-979.717] * (-979.718) (-977.671) (-977.117) [-978.783] -- 0:00:42
310000 -- (-977.238) (-979.897) [-979.012] (-979.211) * (-978.596) (-979.127) [-978.418] (-981.383) -- 0:00:42
Average standard deviation of split frequencies: 0.018848
310500 -- (-976.984) (-977.800) (-983.980) [-982.109] * (-979.016) [-977.629] (-979.845) (-978.882) -- 0:00:42
311000 -- (-978.912) (-977.937) (-980.877) [-984.123] * (-978.334) [-978.259] (-978.442) (-978.182) -- 0:00:42
311500 -- (-981.188) (-979.821) (-984.412) [-980.554] * [-978.035] (-979.177) (-978.554) (-980.751) -- 0:00:41
312000 -- (-979.204) (-982.914) [-982.491] (-979.015) * [-977.630] (-978.856) (-980.904) (-980.529) -- 0:00:41
312500 -- (-978.854) (-983.533) (-978.300) [-981.299] * (-976.748) (-978.883) (-981.236) [-979.306] -- 0:00:41
313000 -- (-978.931) [-980.704] (-979.334) (-979.578) * [-976.982] (-984.489) (-978.794) (-979.250) -- 0:00:41
313500 -- (-978.110) (-981.442) (-977.601) [-979.812] * [-977.681] (-981.548) (-980.466) (-979.226) -- 0:00:41
314000 -- [-977.656] (-980.852) (-979.847) (-980.633) * (-981.123) (-982.252) (-982.522) [-981.148] -- 0:00:41
314500 -- [-977.597] (-978.985) (-980.194) (-979.274) * [-980.237] (-982.044) (-977.122) (-981.679) -- 0:00:41
315000 -- (-977.733) (-978.337) (-977.262) [-978.514] * (-978.523) (-983.209) (-977.638) [-979.893] -- 0:00:41
Average standard deviation of split frequencies: 0.017666
315500 -- (-978.521) (-977.748) [-977.270] (-976.753) * (-980.510) (-979.989) (-982.085) [-977.536] -- 0:00:41
316000 -- (-978.601) (-978.712) (-978.167) [-977.009] * (-979.072) (-977.788) (-978.969) [-977.721] -- 0:00:43
316500 -- (-977.858) (-983.587) [-978.475] (-978.138) * (-980.992) (-978.781) (-980.020) [-977.332] -- 0:00:43
317000 -- (-985.656) (-979.787) [-977.795] (-979.180) * [-980.542] (-982.051) (-979.239) (-979.765) -- 0:00:43
317500 -- [-978.727] (-982.257) (-979.430) (-981.245) * (-980.613) (-979.375) [-978.011] (-979.004) -- 0:00:42
318000 -- [-981.316] (-984.398) (-980.252) (-980.246) * (-982.029) (-981.425) (-978.457) [-979.236] -- 0:00:42
318500 -- (-984.763) (-982.983) [-978.555] (-980.881) * [-983.551] (-982.363) (-980.680) (-980.264) -- 0:00:42
319000 -- (-983.308) (-981.003) (-978.137) [-981.053] * (-980.046) (-980.216) (-982.774) [-980.754] -- 0:00:42
319500 -- (-981.037) (-981.502) (-978.122) [-980.874] * [-978.358] (-980.289) (-978.570) (-978.901) -- 0:00:42
320000 -- (-982.885) (-980.241) (-977.846) [-983.340] * (-978.975) (-980.507) [-977.249] (-979.065) -- 0:00:42
Average standard deviation of split frequencies: 0.018028
320500 -- (-979.785) [-977.424] (-978.774) (-983.282) * (-977.667) [-978.153] (-978.753) (-978.070) -- 0:00:42
321000 -- (-978.930) (-978.446) [-982.470] (-978.270) * (-976.779) (-977.968) (-978.652) [-977.397] -- 0:00:42
321500 -- (-977.503) [-978.599] (-978.171) (-977.974) * (-978.426) (-981.387) (-978.752) [-977.500] -- 0:00:42
322000 -- (-978.423) [-979.789] (-981.772) (-978.745) * (-983.414) (-981.368) [-980.576] (-979.953) -- 0:00:42
322500 -- (-978.498) (-980.207) (-977.644) [-979.958] * (-977.899) (-981.723) (-979.233) [-977.837] -- 0:00:42
323000 -- (-978.787) (-982.053) (-980.097) [-981.913] * (-979.020) (-977.184) (-979.480) [-981.053] -- 0:00:41
323500 -- [-980.061] (-978.263) (-977.974) (-977.496) * (-977.729) (-977.572) (-978.674) [-979.064] -- 0:00:41
324000 -- (-979.276) (-977.156) [-977.508] (-979.352) * [-978.213] (-978.556) (-978.263) (-977.815) -- 0:00:41
324500 -- (-979.422) [-977.733] (-983.466) (-977.379) * (-981.051) (-977.608) (-977.903) [-978.670] -- 0:00:41
325000 -- (-982.992) [-981.596] (-980.528) (-977.798) * (-981.737) (-979.437) [-978.791] (-978.326) -- 0:00:41
Average standard deviation of split frequencies: 0.016439
325500 -- (-978.986) [-979.178] (-978.387) (-977.244) * (-979.445) (-982.903) (-985.167) [-979.756] -- 0:00:41
326000 -- (-979.113) [-979.175] (-981.477) (-977.087) * (-979.599) (-981.488) [-977.461] (-980.370) -- 0:00:41
326500 -- (-976.889) (-981.306) [-978.596] (-976.949) * (-979.137) (-979.559) [-979.863] (-980.238) -- 0:00:41
327000 -- (-977.150) (-981.705) (-977.138) [-978.002] * [-978.732] (-979.793) (-977.697) (-977.742) -- 0:00:41
327500 -- (-977.636) (-989.009) (-977.482) [-978.428] * (-977.343) (-979.174) (-978.362) [-976.722] -- 0:00:41
328000 -- [-980.657] (-978.933) (-977.287) (-978.204) * [-980.935] (-978.088) (-978.187) (-977.460) -- 0:00:40
328500 -- (-982.078) (-979.212) [-978.066] (-981.394) * (-979.942) (-980.296) [-978.730] (-978.458) -- 0:00:40
329000 -- [-980.764] (-978.998) (-979.679) (-978.981) * (-980.703) [-978.269] (-978.567) (-977.863) -- 0:00:40
329500 -- [-978.439] (-978.603) (-979.960) (-980.040) * [-979.446] (-977.803) (-977.692) (-979.703) -- 0:00:40
330000 -- (-978.491) (-977.579) (-977.164) [-983.795] * (-977.533) [-980.524] (-978.551) (-978.131) -- 0:00:40
Average standard deviation of split frequencies: 0.017266
330500 -- (-977.175) [-977.302] (-977.674) (-977.256) * [-978.651] (-978.876) (-979.875) (-979.250) -- 0:00:40
331000 -- [-977.795] (-978.330) (-979.625) (-979.370) * (-983.012) [-982.652] (-981.193) (-979.325) -- 0:00:40
331500 -- (-978.059) (-977.298) [-978.858] (-981.126) * (-977.760) (-980.744) (-977.930) [-978.412] -- 0:00:40
332000 -- (-979.061) (-977.625) (-978.715) [-978.919] * [-976.851] (-978.844) (-980.145) (-981.456) -- 0:00:40
332500 -- (-981.165) [-978.440] (-985.293) (-979.308) * [-978.260] (-977.445) (-978.043) (-978.428) -- 0:00:42
333000 -- (-981.655) (-979.059) [-976.869] (-978.908) * [-978.218] (-977.671) (-977.805) (-980.557) -- 0:00:42
333500 -- (-978.903) (-983.359) [-976.864] (-978.706) * [-978.137] (-978.611) (-978.471) (-979.097) -- 0:00:41
334000 -- (-977.500) (-981.999) (-977.475) [-978.811] * (-980.690) [-979.746] (-978.118) (-977.976) -- 0:00:41
334500 -- (-980.245) (-980.405) (-978.422) [-977.147] * (-977.353) (-982.147) (-977.436) [-982.542] -- 0:00:41
335000 -- (-979.978) (-977.253) [-977.865] (-979.173) * (-978.272) (-979.617) (-977.130) [-978.441] -- 0:00:41
Average standard deviation of split frequencies: 0.016680
335500 -- [-978.889] (-977.339) (-979.668) (-979.152) * (-978.388) (-978.942) [-977.464] (-978.506) -- 0:00:41
336000 -- (-980.321) (-977.536) (-976.970) [-978.591] * (-980.416) [-977.439] (-977.494) (-977.204) -- 0:00:41
336500 -- (-978.727) [-979.807] (-978.361) (-978.598) * (-979.897) (-980.791) [-977.264] (-977.198) -- 0:00:41
337000 -- [-978.218] (-977.389) (-981.864) (-977.374) * [-978.537] (-983.460) (-977.264) (-977.747) -- 0:00:41
337500 -- (-977.801) (-978.081) [-977.277] (-978.865) * (-978.595) (-977.958) (-977.011) [-977.327] -- 0:00:41
338000 -- (-978.176) (-981.856) [-978.620] (-978.510) * (-979.809) (-978.569) [-981.697] (-978.771) -- 0:00:41
338500 -- (-981.535) [-982.256] (-980.350) (-980.442) * (-979.950) (-980.035) (-977.933) [-978.322] -- 0:00:41
339000 -- (-980.696) (-979.297) [-980.113] (-979.099) * (-981.788) (-978.952) (-979.570) [-980.452] -- 0:00:40
339500 -- (-979.943) (-980.721) (-978.448) [-977.100] * (-979.784) (-977.709) [-979.432] (-977.638) -- 0:00:40
340000 -- [-979.666] (-979.370) (-980.310) (-977.846) * (-978.669) (-979.443) (-978.923) [-977.880] -- 0:00:40
Average standard deviation of split frequencies: 0.016442
340500 -- (-979.898) [-978.967] (-980.753) (-980.218) * (-977.759) [-978.249] (-986.015) (-981.417) -- 0:00:40
341000 -- (-979.926) [-979.401] (-980.446) (-978.067) * (-978.044) [-978.729] (-978.770) (-979.047) -- 0:00:40
341500 -- (-979.435) (-983.266) (-977.781) [-977.990] * (-979.218) (-977.300) (-977.695) [-977.588] -- 0:00:40
342000 -- (-983.991) (-980.033) [-980.569] (-979.869) * (-978.996) (-982.334) (-977.720) [-981.159] -- 0:00:40
342500 -- (-978.213) [-978.661] (-978.193) (-976.955) * (-979.750) (-978.497) [-978.589] (-979.724) -- 0:00:40
343000 -- (-978.951) (-978.772) [-979.506] (-977.633) * (-980.388) [-978.508] (-978.495) (-978.601) -- 0:00:40
343500 -- [-979.240] (-977.630) (-979.094) (-977.679) * (-982.863) (-978.588) (-979.365) [-981.003] -- 0:00:40
344000 -- (-978.188) (-978.071) [-977.510] (-979.177) * (-983.427) [-983.583] (-979.260) (-979.024) -- 0:00:40
344500 -- [-980.115] (-984.308) (-977.705) (-977.238) * (-977.748) [-978.423] (-979.417) (-981.297) -- 0:00:39
345000 -- [-979.391] (-981.062) (-979.061) (-977.879) * [-977.876] (-981.088) (-981.772) (-979.389) -- 0:00:39
Average standard deviation of split frequencies: 0.015868
345500 -- (-977.856) [-978.476] (-978.596) (-977.482) * (-978.770) [-980.421] (-980.264) (-978.845) -- 0:00:39
346000 -- (-977.218) (-982.350) [-978.736] (-977.621) * (-978.259) (-979.100) (-977.915) [-978.764] -- 0:00:39
346500 -- (-976.934) (-980.686) [-978.437] (-979.029) * (-978.824) (-977.085) [-977.631] (-978.539) -- 0:00:39
347000 -- (-977.674) (-979.193) [-979.424] (-979.647) * (-983.560) (-978.813) (-977.564) [-978.018] -- 0:00:39
347500 -- (-985.129) (-979.949) (-980.366) [-980.042] * (-982.959) [-977.292] (-981.138) (-980.235) -- 0:00:39
348000 -- (-982.995) (-980.548) [-977.664] (-978.328) * (-980.637) (-979.556) [-981.086] (-978.195) -- 0:00:39
348500 -- [-979.314] (-977.423) (-978.500) (-980.905) * (-979.234) (-977.683) (-980.998) [-977.470] -- 0:00:39
349000 -- (-985.061) (-977.037) (-978.446) [-979.585] * (-979.024) [-978.716] (-983.964) (-977.921) -- 0:00:41
349500 -- (-978.148) (-977.530) (-977.177) [-979.852] * [-979.001] (-978.775) (-982.520) (-977.556) -- 0:00:40
350000 -- (-978.146) (-979.245) [-977.629] (-981.358) * (-978.593) (-978.146) (-978.863) [-977.033] -- 0:00:40
Average standard deviation of split frequencies: 0.016729
350500 -- (-977.022) (-978.910) [-977.657] (-980.145) * [-978.467] (-978.608) (-978.698) (-977.829) -- 0:00:40
351000 -- (-980.011) (-979.738) [-978.348] (-977.783) * (-977.155) (-979.842) (-980.961) [-980.231] -- 0:00:40
351500 -- (-982.324) [-983.699] (-979.627) (-979.088) * (-979.275) [-980.459] (-978.256) (-977.944) -- 0:00:40
352000 -- (-981.396) (-978.747) [-979.613] (-979.502) * (-980.298) (-988.636) (-979.522) [-979.022] -- 0:00:40
352500 -- (-978.633) [-979.656] (-982.241) (-977.850) * (-981.359) (-978.397) (-978.977) [-978.584] -- 0:00:40
353000 -- (-979.029) [-984.834] (-981.661) (-978.390) * (-979.221) (-981.967) [-977.750] (-979.647) -- 0:00:40
353500 -- [-976.893] (-982.762) (-980.089) (-980.826) * (-980.600) (-978.475) (-979.948) [-980.617] -- 0:00:40
354000 -- (-982.904) (-982.673) [-981.149] (-978.132) * [-977.880] (-981.088) (-977.628) (-980.414) -- 0:00:40
354500 -- [-979.490] (-978.474) (-981.535) (-977.406) * [-979.261] (-978.154) (-980.960) (-981.852) -- 0:00:40
355000 -- (-977.535) (-977.762) (-982.777) [-978.495] * (-981.719) (-977.908) [-978.907] (-979.372) -- 0:00:39
Average standard deviation of split frequencies: 0.016405
355500 -- (-978.871) [-978.382] (-978.252) (-978.066) * (-980.209) (-979.446) (-979.215) [-980.709] -- 0:00:39
356000 -- (-978.310) (-979.454) [-978.461] (-977.550) * [-978.507] (-979.433) (-980.775) (-978.790) -- 0:00:39
356500 -- (-979.607) [-980.740] (-980.505) (-978.099) * (-978.000) (-978.017) (-980.712) [-979.340] -- 0:00:39
357000 -- [-977.030] (-980.814) (-979.323) (-983.552) * (-981.302) (-978.765) (-980.766) [-977.823] -- 0:00:39
357500 -- (-977.903) (-979.012) [-978.361] (-979.204) * (-977.055) [-978.629] (-979.270) (-981.549) -- 0:00:39
358000 -- (-977.316) (-979.939) (-977.139) [-979.503] * [-977.787] (-978.976) (-979.047) (-980.075) -- 0:00:39
358500 -- (-978.167) (-977.315) [-979.592] (-982.164) * (-978.466) (-986.347) [-979.631] (-977.433) -- 0:00:39
359000 -- (-977.059) (-976.914) (-977.115) [-978.334] * (-977.771) (-985.134) [-977.612] (-979.626) -- 0:00:39
359500 -- [-977.601] (-985.141) (-977.213) (-982.725) * (-979.408) [-977.473] (-978.838) (-979.660) -- 0:00:39
360000 -- [-979.409] (-977.957) (-978.307) (-979.523) * (-978.870) [-976.885] (-977.888) (-980.393) -- 0:00:39
Average standard deviation of split frequencies: 0.016300
360500 -- [-983.058] (-978.928) (-977.569) (-984.130) * [-980.115] (-976.894) (-980.638) (-977.718) -- 0:00:39
361000 -- (-982.326) [-979.215] (-978.171) (-982.678) * (-979.620) (-977.947) [-979.747] (-978.827) -- 0:00:38
361500 -- (-981.976) (-983.638) (-980.393) [-982.146] * (-978.202) [-977.730] (-979.390) (-980.189) -- 0:00:38
362000 -- (-980.146) (-983.446) [-979.821] (-979.649) * (-982.030) [-978.708] (-980.431) (-978.272) -- 0:00:38
362500 -- (-980.510) (-977.046) (-980.989) [-978.776] * (-980.836) (-977.368) [-979.689] (-981.031) -- 0:00:38
363000 -- (-981.592) (-978.887) (-977.783) [-979.090] * (-983.009) (-978.287) (-978.688) [-978.392] -- 0:00:38
363500 -- (-980.586) [-978.073] (-978.386) (-979.759) * (-981.101) (-979.968) [-978.611] (-978.504) -- 0:00:38
364000 -- (-977.218) [-979.880] (-980.279) (-980.506) * [-979.676] (-978.518) (-978.700) (-979.633) -- 0:00:38
364500 -- (-978.506) (-978.549) [-980.760] (-979.020) * [-979.931] (-982.130) (-980.198) (-980.082) -- 0:00:38
365000 -- [-978.677] (-981.237) (-985.617) (-978.319) * (-977.933) [-986.601] (-980.612) (-980.270) -- 0:00:38
Average standard deviation of split frequencies: 0.015759
365500 -- (-985.361) (-979.134) (-982.983) [-977.958] * (-978.243) (-980.962) (-985.915) [-978.010] -- 0:00:39
366000 -- (-982.127) (-980.501) (-979.632) [-978.210] * (-978.751) (-979.147) (-984.258) [-979.928] -- 0:00:39
366500 -- (-980.818) (-977.979) (-979.469) [-981.992] * (-983.345) (-981.445) [-979.692] (-983.061) -- 0:00:39
367000 -- (-982.641) (-977.495) [-978.408] (-980.025) * (-981.816) (-981.064) (-979.124) [-980.651] -- 0:00:39
367500 -- (-980.462) (-979.173) [-977.866] (-980.717) * (-977.999) (-982.307) (-979.298) [-977.473] -- 0:00:39
368000 -- [-980.197] (-977.116) (-977.055) (-982.483) * (-978.310) [-979.561] (-978.638) (-977.747) -- 0:00:39
368500 -- [-982.484] (-979.204) (-980.974) (-984.761) * (-979.210) [-980.413] (-978.605) (-979.912) -- 0:00:39
369000 -- (-979.844) (-979.641) (-981.435) [-982.244] * (-978.793) (-979.491) (-977.379) [-979.003] -- 0:00:39
369500 -- (-981.504) (-977.775) [-977.950] (-978.089) * (-978.690) [-979.413] (-979.090) (-977.333) -- 0:00:39
370000 -- [-980.010] (-983.424) (-980.327) (-978.118) * (-977.951) (-980.348) [-977.100] (-981.636) -- 0:00:39
Average standard deviation of split frequencies: 0.015261
370500 -- (-979.394) (-980.500) (-980.364) [-978.179] * [-979.954] (-981.917) (-977.571) (-979.904) -- 0:00:39
371000 -- (-984.765) (-980.500) (-977.913) [-978.016] * (-979.658) (-978.340) [-978.926] (-979.612) -- 0:00:38
371500 -- (-981.859) [-980.456] (-981.378) (-978.294) * (-979.224) (-980.919) (-977.737) [-977.949] -- 0:00:38
372000 -- (-982.977) [-977.124] (-979.049) (-978.176) * [-979.395] (-979.110) (-979.085) (-979.029) -- 0:00:38
372500 -- [-981.159] (-978.198) (-978.655) (-979.246) * (-981.750) [-978.840] (-979.268) (-978.642) -- 0:00:38
373000 -- (-984.538) [-979.330] (-978.174) (-979.860) * (-982.713) [-980.570] (-977.057) (-977.900) -- 0:00:38
373500 -- (-985.168) (-977.956) [-976.968] (-980.478) * (-979.687) (-979.589) (-983.053) [-979.351] -- 0:00:38
374000 -- (-980.796) [-978.395] (-976.968) (-982.301) * [-976.937] (-980.137) (-978.029) (-980.669) -- 0:00:38
374500 -- (-979.904) (-978.720) (-978.399) [-982.611] * (-979.136) (-977.799) (-978.308) [-977.671] -- 0:00:38
375000 -- (-981.972) (-977.800) [-977.062] (-978.681) * (-983.475) [-977.204] (-978.547) (-978.422) -- 0:00:38
Average standard deviation of split frequencies: 0.015811
375500 -- [-978.854] (-981.416) (-980.277) (-978.850) * (-978.076) [-978.764] (-982.189) (-979.580) -- 0:00:38
376000 -- (-979.116) (-978.971) [-980.886] (-981.096) * (-979.719) [-980.301] (-978.346) (-976.892) -- 0:00:38
376500 -- (-980.108) (-979.893) [-979.704] (-980.467) * [-979.350] (-978.425) (-978.382) (-983.957) -- 0:00:38
377000 -- (-977.822) [-980.756] (-979.885) (-978.020) * (-979.740) (-979.498) [-980.265] (-979.199) -- 0:00:38
377500 -- (-978.998) (-980.017) (-980.103) [-979.528] * (-977.020) (-978.765) (-979.458) [-980.097] -- 0:00:37
378000 -- (-980.720) [-979.019] (-982.519) (-980.074) * (-979.465) [-976.827] (-980.413) (-980.516) -- 0:00:37
378500 -- (-979.870) [-978.505] (-978.033) (-979.342) * [-978.360] (-977.749) (-983.039) (-979.806) -- 0:00:37
379000 -- (-984.846) (-981.670) [-976.728] (-980.615) * (-978.766) (-978.694) (-978.597) [-981.308] -- 0:00:37
379500 -- (-979.523) (-981.039) [-976.918] (-978.273) * [-977.219] (-985.679) (-982.902) (-980.536) -- 0:00:37
380000 -- (-979.345) (-980.470) [-976.936] (-978.450) * (-978.711) (-981.889) (-980.392) [-977.625] -- 0:00:37
Average standard deviation of split frequencies: 0.014379
380500 -- (-978.910) (-983.419) [-978.868] (-979.170) * (-980.282) (-981.295) (-979.981) [-977.377] -- 0:00:37
381000 -- (-979.363) [-978.815] (-977.779) (-977.454) * [-978.486] (-981.024) (-979.705) (-986.452) -- 0:00:37
381500 -- (-977.517) (-977.248) [-984.092] (-978.613) * (-978.224) (-978.119) [-978.777] (-982.528) -- 0:00:37
382000 -- [-980.092] (-977.932) (-977.926) (-977.708) * (-977.667) (-980.321) [-977.300] (-978.495) -- 0:00:38
382500 -- (-978.890) [-980.007] (-980.774) (-979.055) * (-977.671) [-979.520] (-979.078) (-979.076) -- 0:00:38
383000 -- (-979.590) (-978.876) [-982.709] (-978.235) * (-980.783) (-980.482) (-979.086) [-978.740] -- 0:00:38
383500 -- (-978.675) (-984.262) [-979.644] (-978.476) * (-983.745) (-978.333) (-978.400) [-978.667] -- 0:00:38
384000 -- (-978.124) (-981.314) (-976.860) [-977.819] * [-980.683] (-979.739) (-979.038) (-978.720) -- 0:00:38
384500 -- (-977.579) (-978.305) (-978.499) [-979.130] * (-981.715) (-979.172) (-980.541) [-978.874] -- 0:00:38
385000 -- (-977.189) (-978.549) [-978.574] (-978.117) * (-982.267) (-980.359) (-977.915) [-982.287] -- 0:00:38
Average standard deviation of split frequencies: 0.013637
385500 -- (-978.556) (-981.097) [-979.756] (-978.170) * (-985.030) [-977.500] (-977.224) (-983.668) -- 0:00:38
386000 -- (-977.378) (-981.355) (-979.506) [-978.142] * (-979.491) [-979.245] (-980.970) (-983.246) -- 0:00:38
386500 -- (-983.391) (-980.179) [-980.058] (-985.579) * [-978.133] (-981.676) (-978.863) (-983.510) -- 0:00:38
387000 -- (-981.702) (-980.193) [-979.376] (-985.209) * [-977.431] (-980.717) (-980.937) (-981.871) -- 0:00:38
387500 -- (-981.445) (-978.927) [-977.678] (-977.308) * (-978.074) (-981.604) (-985.464) [-978.683] -- 0:00:37
388000 -- (-978.816) (-976.948) [-977.964] (-979.335) * [-978.787] (-982.935) (-978.642) (-977.153) -- 0:00:37
388500 -- (-979.841) [-978.443] (-979.447) (-978.155) * [-978.409] (-982.898) (-977.053) (-977.756) -- 0:00:37
389000 -- [-979.787] (-980.492) (-979.352) (-978.929) * (-981.132) [-977.605] (-978.854) (-977.604) -- 0:00:37
389500 -- (-979.666) (-979.065) (-979.308) [-979.685] * (-979.266) (-980.066) [-980.902] (-977.141) -- 0:00:37
390000 -- (-979.320) (-981.453) [-977.485] (-976.971) * (-979.986) [-977.543] (-977.523) (-977.457) -- 0:00:37
Average standard deviation of split frequencies: 0.013877
390500 -- (-978.373) [-982.666] (-977.984) (-977.161) * (-979.479) (-982.503) (-977.310) [-977.042] -- 0:00:37
391000 -- (-977.707) (-981.291) [-977.959] (-978.277) * (-982.616) [-978.429] (-978.584) (-977.672) -- 0:00:37
391500 -- (-977.807) [-978.582] (-978.318) (-977.893) * [-981.515] (-983.407) (-978.064) (-977.827) -- 0:00:37
392000 -- (-978.739) (-977.514) (-980.786) [-978.085] * (-978.928) [-980.602] (-982.307) (-977.517) -- 0:00:37
392500 -- (-978.810) (-980.244) (-982.128) [-978.766] * (-979.167) (-980.915) (-980.692) [-977.737] -- 0:00:37
393000 -- (-979.268) [-977.330] (-978.989) (-977.776) * [-978.566] (-982.737) (-982.572) (-980.829) -- 0:00:37
393500 -- [-978.155] (-978.951) (-978.618) (-977.734) * [-978.549] (-983.624) (-980.126) (-978.471) -- 0:00:36
394000 -- [-978.476] (-978.262) (-977.347) (-977.507) * (-979.113) [-977.265] (-979.531) (-978.167) -- 0:00:36
394500 -- (-979.165) (-978.951) [-978.141] (-977.788) * (-978.167) (-979.103) [-979.902] (-980.394) -- 0:00:36
395000 -- (-979.132) [-979.387] (-978.686) (-978.989) * (-977.728) [-979.103] (-978.907) (-978.479) -- 0:00:36
Average standard deviation of split frequencies: 0.013095
395500 -- (-988.021) [-978.380] (-979.040) (-978.841) * [-979.290] (-976.782) (-976.985) (-978.609) -- 0:00:36
396000 -- [-987.521] (-979.114) (-978.920) (-978.021) * (-979.209) (-980.652) [-978.134] (-982.923) -- 0:00:36
396500 -- (-978.374) [-977.892] (-981.089) (-982.997) * (-981.190) (-978.645) (-978.563) [-979.360] -- 0:00:36
397000 -- (-979.278) (-984.217) [-978.516] (-984.355) * (-980.654) [-979.074] (-977.426) (-977.977) -- 0:00:36
397500 -- (-979.359) (-978.233) [-978.342] (-977.501) * [-980.946] (-980.109) (-977.466) (-983.170) -- 0:00:36
398000 -- [-978.895] (-978.294) (-981.396) (-978.743) * (-980.714) [-979.105] (-980.180) (-980.553) -- 0:00:36
398500 -- (-979.070) (-979.747) (-982.364) [-978.908] * (-981.593) (-977.321) (-980.750) [-977.333] -- 0:00:37
399000 -- [-979.182] (-981.568) (-978.165) (-979.627) * (-979.941) (-977.389) (-982.990) [-978.373] -- 0:00:37
399500 -- (-981.639) (-980.909) [-979.411] (-979.794) * (-984.869) [-978.491] (-982.388) (-977.743) -- 0:00:37
400000 -- (-981.263) (-978.399) [-980.981] (-980.281) * (-978.825) (-977.883) [-977.348] (-981.088) -- 0:00:37
Average standard deviation of split frequencies: 0.013357
400500 -- (-982.216) [-978.566] (-987.525) (-980.063) * (-979.094) [-978.916] (-978.495) (-982.892) -- 0:00:37
401000 -- (-978.449) [-978.680] (-984.932) (-980.144) * (-979.403) (-979.794) (-977.315) [-981.503] -- 0:00:37
401500 -- (-979.791) [-979.554] (-980.555) (-977.472) * (-979.078) (-980.314) (-978.100) [-978.578] -- 0:00:37
402000 -- (-978.414) [-978.702] (-978.888) (-981.033) * [-978.940] (-978.816) (-977.524) (-977.635) -- 0:00:37
402500 -- [-977.587] (-981.603) (-980.621) (-978.086) * (-978.279) (-979.859) [-979.313] (-981.137) -- 0:00:37
403000 -- [-978.432] (-979.622) (-977.061) (-991.590) * [-978.100] (-980.988) (-979.901) (-981.613) -- 0:00:37
403500 -- (-979.459) (-979.002) (-977.907) [-978.754] * (-981.584) (-982.737) [-981.074] (-981.993) -- 0:00:36
404000 -- [-982.308] (-978.293) (-977.016) (-980.407) * [-978.273] (-978.333) (-978.906) (-979.799) -- 0:00:36
404500 -- (-978.541) [-979.582] (-977.491) (-979.639) * [-978.284] (-977.689) (-978.443) (-977.046) -- 0:00:36
405000 -- (-978.799) (-977.544) [-978.476] (-986.191) * [-978.149] (-979.750) (-979.698) (-978.370) -- 0:00:36
Average standard deviation of split frequencies: 0.012191
405500 -- (-980.007) (-978.197) (-977.668) [-978.940] * (-980.015) (-980.541) [-977.533] (-978.239) -- 0:00:36
406000 -- (-981.128) [-978.790] (-977.028) (-978.404) * [-978.734] (-980.947) (-978.808) (-980.149) -- 0:00:36
406500 -- (-978.382) [-980.697] (-981.723) (-977.187) * (-979.673) (-981.277) [-978.100] (-980.116) -- 0:00:36
407000 -- (-977.179) (-982.106) [-980.421] (-980.526) * (-981.317) [-977.393] (-978.018) (-981.089) -- 0:00:36
407500 -- (-978.161) (-979.541) (-981.384) [-978.585] * (-980.226) (-977.708) [-977.929] (-983.835) -- 0:00:36
408000 -- [-979.445] (-982.319) (-981.240) (-979.649) * (-978.751) (-983.249) [-978.749] (-977.618) -- 0:00:36
408500 -- [-980.757] (-982.865) (-979.794) (-980.217) * (-979.850) (-977.006) [-978.226] (-977.578) -- 0:00:36
409000 -- (-978.044) (-981.770) [-978.172] (-978.422) * (-976.865) (-977.537) [-977.479] (-978.039) -- 0:00:36
409500 -- [-978.962] (-980.690) (-977.279) (-978.274) * (-979.802) [-978.395] (-978.380) (-977.151) -- 0:00:36
410000 -- [-978.222] (-979.097) (-980.934) (-977.218) * [-978.120] (-980.728) (-978.387) (-977.275) -- 0:00:35
Average standard deviation of split frequencies: 0.012244
410500 -- (-979.548) (-980.970) (-981.068) [-977.643] * [-978.364] (-978.923) (-978.134) (-977.554) -- 0:00:35
411000 -- (-980.267) (-979.282) [-978.289] (-978.055) * (-980.904) (-981.330) [-978.609] (-977.893) -- 0:00:35
411500 -- (-980.117) (-977.307) (-981.388) [-979.375] * [-979.576] (-979.163) (-979.608) (-977.772) -- 0:00:35
412000 -- [-979.742] (-980.104) (-978.304) (-978.431) * (-978.227) (-978.129) (-977.132) [-981.834] -- 0:00:35
412500 -- (-981.698) [-979.286] (-980.486) (-982.543) * (-978.907) (-979.325) (-977.930) [-977.999] -- 0:00:35
413000 -- [-978.858] (-979.958) (-979.325) (-979.933) * (-981.348) [-980.795] (-979.192) (-978.864) -- 0:00:35
413500 -- (-979.927) [-985.683] (-979.461) (-978.083) * (-977.549) (-979.377) (-979.454) [-977.574] -- 0:00:35
414000 -- (-979.131) (-982.041) (-981.532) [-981.349] * (-978.177) [-978.142] (-979.575) (-978.537) -- 0:00:35
414500 -- (-977.958) (-979.131) (-982.196) [-979.309] * (-978.296) [-978.761] (-978.195) (-980.320) -- 0:00:35
415000 -- (-978.139) (-978.823) (-981.686) [-978.688] * (-979.961) (-978.436) [-978.437] (-980.836) -- 0:00:36
Average standard deviation of split frequencies: 0.011835
415500 -- [-979.979] (-981.297) (-977.999) (-977.135) * [-977.510] (-979.273) (-981.375) (-982.046) -- 0:00:36
416000 -- [-978.606] (-980.944) (-977.088) (-981.093) * [-977.557] (-978.656) (-979.416) (-980.974) -- 0:00:36
416500 -- [-979.262] (-982.039) (-982.795) (-980.433) * (-978.286) (-978.732) (-979.347) [-983.369] -- 0:00:36
417000 -- [-979.426] (-979.145) (-984.276) (-978.953) * (-978.434) (-977.494) (-984.316) [-978.360] -- 0:00:36
417500 -- (-978.372) [-978.114] (-977.051) (-979.614) * [-978.672] (-977.668) (-976.875) (-978.071) -- 0:00:36
418000 -- (-978.424) [-977.084] (-976.818) (-980.589) * (-980.192) [-979.882] (-980.687) (-978.156) -- 0:00:36
418500 -- [-977.524] (-977.430) (-976.857) (-981.842) * (-983.105) (-980.222) [-979.019] (-979.520) -- 0:00:36
419000 -- (-978.122) (-979.776) [-978.897] (-978.933) * [-983.913] (-983.380) (-978.553) (-977.690) -- 0:00:36
419500 -- (-980.170) (-978.512) (-986.680) [-978.787] * (-979.371) (-981.313) [-983.880] (-977.313) -- 0:00:35
420000 -- (-983.251) [-980.673] (-980.656) (-978.512) * (-979.467) (-979.055) [-979.691] (-979.885) -- 0:00:35
Average standard deviation of split frequencies: 0.011393
420500 -- (-977.622) (-978.513) [-978.157] (-982.267) * [-978.990] (-980.099) (-977.357) (-978.529) -- 0:00:35
421000 -- (-980.205) (-978.556) [-977.972] (-978.273) * (-979.637) (-980.484) [-977.906] (-978.897) -- 0:00:35
421500 -- (-979.011) (-979.870) [-978.295] (-978.448) * (-978.240) [-978.321] (-979.025) (-977.957) -- 0:00:35
422000 -- (-981.009) (-986.052) (-978.993) [-977.905] * (-978.838) [-982.119] (-979.481) (-977.691) -- 0:00:35
422500 -- (-978.651) (-977.842) (-976.876) [-978.048] * [-979.169] (-980.817) (-980.820) (-978.171) -- 0:00:35
423000 -- (-977.319) (-981.342) (-978.515) [-979.288] * (-979.977) (-979.129) (-980.866) [-980.909] -- 0:00:35
423500 -- (-979.030) (-980.270) (-979.655) [-981.706] * (-981.120) (-981.830) (-979.720) [-981.784] -- 0:00:35
424000 -- (-977.610) (-977.474) (-977.807) [-978.935] * (-983.357) [-978.456] (-977.761) (-980.117) -- 0:00:35
424500 -- (-979.791) (-978.167) (-977.307) [-978.735] * (-979.565) [-978.117] (-985.371) (-977.382) -- 0:00:35
425000 -- (-977.070) (-980.638) (-977.417) [-978.992] * (-978.118) [-977.015] (-982.281) (-977.555) -- 0:00:35
Average standard deviation of split frequencies: 0.011127
425500 -- (-976.974) [-981.795] (-977.658) (-978.669) * (-978.732) (-981.916) [-979.810] (-978.938) -- 0:00:35
426000 -- (-978.221) (-978.137) (-977.860) [-979.640] * (-979.390) [-981.222] (-979.279) (-980.529) -- 0:00:35
426500 -- (-979.603) (-977.911) (-979.576) [-977.918] * (-977.196) (-984.253) (-978.079) [-981.247] -- 0:00:34
427000 -- [-980.896] (-977.630) (-979.496) (-980.879) * (-978.193) (-978.147) (-979.129) [-980.501] -- 0:00:34
427500 -- [-982.192] (-979.017) (-982.932) (-978.987) * (-979.522) [-977.813] (-980.496) (-977.434) -- 0:00:34
428000 -- [-978.891] (-978.858) (-982.358) (-980.404) * (-981.078) (-978.441) [-979.778] (-977.817) -- 0:00:34
428500 -- (-977.913) [-981.337] (-976.911) (-979.911) * (-980.516) [-978.675] (-981.491) (-983.617) -- 0:00:34
429000 -- (-979.593) (-979.488) (-980.600) [-978.922] * (-980.976) [-979.632] (-981.398) (-982.147) -- 0:00:34
429500 -- (-978.761) (-981.921) [-979.828] (-977.496) * (-980.120) [-977.991] (-983.095) (-979.589) -- 0:00:34
430000 -- (-986.670) (-981.346) (-980.886) [-977.498] * (-980.344) (-978.953) [-978.476] (-980.061) -- 0:00:34
Average standard deviation of split frequencies: 0.011493
430500 -- (-978.341) (-980.552) (-980.011) [-982.538] * (-980.181) [-978.162] (-977.904) (-982.238) -- 0:00:34
431000 -- [-980.718] (-981.042) (-979.010) (-978.138) * (-977.041) (-977.769) (-978.253) [-979.176] -- 0:00:34
431500 -- (-981.906) (-979.334) (-982.035) [-980.578] * [-977.444] (-982.359) (-980.163) (-980.452) -- 0:00:35
432000 -- [-977.750] (-977.849) (-985.079) (-978.384) * (-977.420) (-979.157) (-983.824) [-981.601] -- 0:00:35
432500 -- (-980.243) [-978.446] (-980.159) (-978.397) * (-979.612) (-978.016) (-979.037) [-980.606] -- 0:00:35
433000 -- (-980.035) (-980.128) (-979.694) [-982.625] * [-979.995] (-977.384) (-977.131) (-981.604) -- 0:00:35
433500 -- (-979.097) [-979.562] (-979.093) (-978.945) * (-977.888) [-980.306] (-977.769) (-982.151) -- 0:00:35
434000 -- (-980.988) (-977.230) (-983.364) [-978.682] * [-977.331] (-980.296) (-981.652) (-979.733) -- 0:00:35
434500 -- [-981.410] (-977.608) (-978.837) (-980.900) * (-977.232) [-978.323] (-982.298) (-980.226) -- 0:00:35
435000 -- [-981.683] (-978.634) (-977.731) (-980.523) * [-980.266] (-977.561) (-979.627) (-978.656) -- 0:00:35
Average standard deviation of split frequencies: 0.011473
435500 -- (-979.289) (-976.977) [-981.853] (-980.401) * (-986.068) (-980.834) (-978.552) [-978.449] -- 0:00:34
436000 -- (-979.308) (-979.967) [-977.417] (-979.574) * (-977.795) (-981.552) (-978.960) [-977.794] -- 0:00:34
436500 -- (-978.209) (-980.613) [-982.005] (-978.144) * [-977.835] (-979.526) (-977.713) (-978.868) -- 0:00:34
437000 -- (-980.144) (-979.970) [-981.786] (-977.508) * (-980.002) (-982.119) (-981.449) [-978.229] -- 0:00:34
437500 -- (-978.674) (-977.304) (-981.315) [-978.804] * [-977.831] (-980.701) (-980.049) (-977.994) -- 0:00:34
438000 -- (-979.623) [-979.812] (-979.772) (-977.623) * [-976.972] (-981.358) (-978.423) (-980.615) -- 0:00:34
438500 -- (-980.230) (-979.647) (-977.844) [-977.623] * [-976.918] (-980.660) (-978.469) (-977.428) -- 0:00:34
439000 -- (-979.765) (-978.925) (-979.980) [-979.149] * (-977.586) (-978.398) (-978.407) [-977.120] -- 0:00:34
439500 -- (-978.782) (-977.746) (-983.186) [-980.393] * [-978.713] (-978.173) (-979.542) (-977.779) -- 0:00:34
440000 -- (-977.735) (-979.393) (-981.239) [-980.647] * [-978.814] (-977.491) (-979.582) (-977.064) -- 0:00:34
Average standard deviation of split frequencies: 0.011292
440500 -- (-978.605) (-979.647) [-981.962] (-978.655) * (-980.746) (-978.229) (-984.126) [-977.749] -- 0:00:34
441000 -- (-977.435) [-978.150] (-978.279) (-977.357) * (-979.764) (-978.559) [-979.644] (-978.239) -- 0:00:34
441500 -- (-979.045) [-982.686] (-980.092) (-981.346) * [-978.748] (-978.940) (-978.943) (-977.043) -- 0:00:34
442000 -- [-979.983] (-981.877) (-981.717) (-984.249) * [-977.978] (-979.208) (-979.084) (-977.699) -- 0:00:34
442500 -- (-978.039) (-979.034) (-981.445) [-977.939] * (-981.464) [-977.744] (-979.000) (-980.732) -- 0:00:34
443000 -- (-980.374) (-978.951) (-979.833) [-978.598] * (-982.224) (-978.304) [-980.730] (-981.765) -- 0:00:33
443500 -- (-978.880) [-977.552] (-982.840) (-977.568) * (-982.157) [-978.653] (-981.310) (-983.704) -- 0:00:33
444000 -- (-979.618) (-980.168) [-978.877] (-977.137) * (-980.089) [-977.926] (-980.579) (-981.454) -- 0:00:33
444500 -- (-978.759) (-981.519) (-979.655) [-977.504] * (-979.875) [-978.088] (-979.963) (-980.189) -- 0:00:33
445000 -- [-978.554] (-979.526) (-981.619) (-978.376) * [-978.670] (-979.609) (-980.252) (-977.898) -- 0:00:33
Average standard deviation of split frequencies: 0.010863
445500 -- (-980.707) (-978.328) (-980.716) [-981.261] * (-980.328) [-976.903] (-978.104) (-978.123) -- 0:00:33
446000 -- [-980.126] (-978.781) (-980.035) (-979.776) * (-980.310) [-978.860] (-977.534) (-979.798) -- 0:00:33
446500 -- (-979.237) (-980.175) (-980.363) [-977.516] * (-978.023) [-978.729] (-977.289) (-978.321) -- 0:00:33
447000 -- [-978.267] (-980.152) (-987.847) (-977.601) * (-978.031) (-980.030) (-978.512) [-978.888] -- 0:00:33
447500 -- (-978.768) [-981.161] (-980.044) (-978.090) * [-979.390] (-979.762) (-982.453) (-980.463) -- 0:00:33
448000 -- (-979.829) (-979.191) [-978.620] (-981.374) * (-981.367) [-980.667] (-981.534) (-976.966) -- 0:00:34
448500 -- (-984.370) (-980.099) [-979.048] (-978.971) * (-977.705) (-981.637) [-980.112] (-976.966) -- 0:00:34
449000 -- (-986.388) (-979.951) [-977.427] (-978.181) * [-977.387] (-979.653) (-980.264) (-977.984) -- 0:00:34
449500 -- [-977.898] (-979.809) (-978.956) (-977.916) * [-977.226] (-980.385) (-981.344) (-977.531) -- 0:00:34
450000 -- (-977.384) (-978.767) [-979.133] (-977.984) * (-977.446) [-978.507] (-982.406) (-977.972) -- 0:00:34
Average standard deviation of split frequencies: 0.010693
450500 -- (-983.012) (-978.562) [-979.100] (-977.610) * [-978.371] (-985.697) (-977.010) (-982.033) -- 0:00:34
451000 -- (-977.691) (-981.882) [-977.907] (-978.739) * [-980.252] (-979.000) (-979.525) (-977.998) -- 0:00:34
451500 -- (-982.310) (-981.041) [-976.910] (-978.651) * (-980.871) (-980.581) [-978.387] (-978.184) -- 0:00:34
452000 -- (-978.180) (-979.744) (-981.436) [-978.743] * (-981.515) (-977.680) [-983.265] (-977.893) -- 0:00:33
452500 -- (-978.488) (-983.784) (-980.457) [-981.187] * (-978.824) [-977.392] (-977.635) (-977.893) -- 0:00:33
453000 -- (-980.407) (-979.761) (-979.343) [-977.035] * (-977.619) [-980.981] (-977.987) (-979.290) -- 0:00:33
453500 -- (-977.907) [-978.761] (-977.518) (-979.393) * (-978.919) (-979.300) [-978.214] (-978.286) -- 0:00:33
454000 -- (-979.951) [-977.241] (-977.513) (-978.375) * [-977.980] (-976.959) (-977.596) (-979.117) -- 0:00:33
454500 -- (-978.905) (-977.109) [-977.486] (-983.143) * (-978.710) (-981.246) (-984.118) [-978.505] -- 0:00:33
455000 -- (-984.745) [-978.985] (-978.600) (-978.045) * (-979.610) (-981.962) (-979.759) [-977.617] -- 0:00:33
Average standard deviation of split frequencies: 0.009821
455500 -- (-989.622) (-981.240) [-983.052] (-980.517) * (-978.545) (-982.029) (-980.261) [-978.458] -- 0:00:33
456000 -- (-983.432) [-978.846] (-980.926) (-980.861) * [-978.507] (-979.346) (-978.066) (-978.736) -- 0:00:33
456500 -- (-979.173) (-978.807) (-979.025) [-977.210] * (-978.237) [-978.185] (-977.099) (-979.324) -- 0:00:33
457000 -- (-978.849) (-985.438) [-979.477] (-976.943) * (-977.760) (-977.959) (-979.894) [-978.212] -- 0:00:33
457500 -- [-978.233] (-985.361) (-977.838) (-978.679) * [-980.836] (-980.898) (-978.909) (-981.422) -- 0:00:33
458000 -- (-978.077) (-981.361) [-978.519] (-981.448) * [-979.519] (-978.014) (-980.771) (-978.886) -- 0:00:33
458500 -- (-979.878) (-979.040) (-978.666) [-976.823] * (-980.635) (-978.565) [-980.892] (-982.688) -- 0:00:33
459000 -- (-980.234) (-978.973) (-980.152) [-977.587] * [-979.737] (-977.813) (-978.812) (-979.117) -- 0:00:33
459500 -- (-982.837) (-977.992) (-980.202) [-977.741] * (-977.437) [-977.259] (-978.739) (-982.679) -- 0:00:32
460000 -- [-979.355] (-979.981) (-977.052) (-977.592) * (-979.400) [-977.020] (-980.063) (-977.870) -- 0:00:32
Average standard deviation of split frequencies: 0.009551
460500 -- (-983.238) [-978.124] (-978.129) (-978.494) * (-981.533) [-982.190] (-978.391) (-979.374) -- 0:00:32
461000 -- [-978.838] (-983.461) (-978.407) (-978.785) * (-979.128) [-980.775] (-978.475) (-979.905) -- 0:00:32
461500 -- (-979.069) (-982.132) (-978.697) [-978.046] * (-980.854) (-982.879) (-978.075) [-980.095] -- 0:00:32
462000 -- (-979.718) (-980.182) [-977.852] (-977.256) * [-978.651] (-979.515) (-978.685) (-978.018) -- 0:00:32
462500 -- (-978.316) [-981.088] (-977.955) (-981.149) * (-979.477) (-978.021) (-978.127) [-978.617] -- 0:00:32
463000 -- (-977.082) (-978.206) [-977.903] (-980.085) * [-978.449] (-977.994) (-977.196) (-978.304) -- 0:00:32
463500 -- (-978.183) (-977.125) [-979.379] (-982.565) * [-978.065] (-979.460) (-976.829) (-980.401) -- 0:00:32
464000 -- (-979.827) [-977.800] (-984.065) (-979.369) * (-978.662) (-979.003) [-977.565] (-978.802) -- 0:00:32
464500 -- [-978.979] (-978.127) (-987.257) (-978.887) * (-982.466) [-980.091] (-978.531) (-977.347) -- 0:00:33
465000 -- (-978.666) [-978.769] (-978.664) (-977.419) * (-980.720) (-978.898) [-980.239] (-978.925) -- 0:00:33
Average standard deviation of split frequencies: 0.009329
465500 -- (-983.158) (-977.636) (-977.391) [-978.368] * [-979.505] (-980.359) (-977.677) (-979.576) -- 0:00:33
466000 -- (-984.042) [-977.676] (-977.283) (-977.798) * (-982.507) [-980.545] (-979.784) (-979.491) -- 0:00:33
466500 -- (-983.472) (-978.774) [-981.044] (-981.487) * (-980.725) [-977.887] (-979.387) (-979.419) -- 0:00:33
467000 -- [-978.600] (-978.218) (-981.770) (-982.233) * (-979.689) [-979.098] (-979.067) (-979.636) -- 0:00:33
467500 -- (-978.812) (-981.205) (-978.425) [-979.089] * (-977.929) (-977.439) (-978.960) [-979.452] -- 0:00:33
468000 -- [-979.026] (-979.230) (-979.252) (-979.455) * (-977.118) (-979.530) [-984.213] (-978.404) -- 0:00:32
468500 -- (-979.141) [-978.969] (-980.202) (-980.201) * [-978.101] (-979.100) (-979.768) (-978.930) -- 0:00:32
469000 -- (-980.533) (-978.905) [-977.110] (-981.810) * (-979.820) (-978.514) (-977.947) [-976.848] -- 0:00:32
469500 -- (-978.217) [-978.507] (-982.904) (-978.112) * (-977.664) (-977.297) (-978.411) [-977.392] -- 0:00:32
470000 -- (-978.200) (-982.072) (-978.104) [-982.108] * (-978.403) (-978.545) (-978.855) [-979.465] -- 0:00:32
Average standard deviation of split frequencies: 0.008903
470500 -- (-977.843) (-980.365) [-977.222] (-983.585) * (-981.259) (-983.208) [-979.401] (-983.714) -- 0:00:32
471000 -- (-979.631) (-980.282) [-977.176] (-981.362) * (-978.754) (-979.427) [-978.984] (-978.515) -- 0:00:32
471500 -- [-979.843] (-980.920) (-977.535) (-985.432) * (-984.179) (-982.700) [-979.220] (-977.782) -- 0:00:32
472000 -- (-980.331) [-978.001] (-980.115) (-979.583) * (-980.521) (-981.649) (-977.528) [-977.265] -- 0:00:32
472500 -- (-980.584) (-978.485) (-980.554) [-978.658] * (-979.065) (-982.052) [-977.576] (-982.168) -- 0:00:32
473000 -- [-978.678] (-978.822) (-980.559) (-978.496) * (-978.602) (-979.189) [-980.229] (-978.363) -- 0:00:32
473500 -- (-980.696) [-978.153] (-979.047) (-981.306) * (-981.911) (-983.065) [-978.482] (-977.960) -- 0:00:32
474000 -- (-979.745) [-984.358] (-982.769) (-979.114) * (-980.051) (-980.010) [-978.663] (-978.464) -- 0:00:32
474500 -- (-979.019) (-980.680) (-980.722) [-978.425] * (-979.901) [-978.144] (-981.629) (-979.207) -- 0:00:32
475000 -- (-979.717) (-978.146) (-978.837) [-981.107] * (-982.104) (-977.952) (-979.638) [-982.270] -- 0:00:32
Average standard deviation of split frequencies: 0.008505
475500 -- (-982.071) [-980.399] (-979.305) (-978.757) * [-979.465] (-978.595) (-984.293) (-981.013) -- 0:00:31
476000 -- (-982.011) (-981.176) (-978.687) [-979.321] * (-980.150) [-983.671] (-978.488) (-981.742) -- 0:00:31
476500 -- (-980.209) (-986.344) (-978.922) [-977.223] * (-980.176) (-980.506) [-980.149] (-976.918) -- 0:00:31
477000 -- (-981.360) [-982.562] (-980.262) (-976.991) * (-981.332) (-980.234) [-978.794] (-977.621) -- 0:00:31
477500 -- (-979.821) (-977.117) [-979.820] (-977.574) * (-979.291) (-978.860) [-977.347] (-977.283) -- 0:00:31
478000 -- (-979.407) [-978.126] (-980.037) (-977.493) * (-978.821) [-980.436] (-977.699) (-984.950) -- 0:00:31
478500 -- (-979.322) [-977.346] (-981.417) (-978.418) * (-977.959) (-985.493) (-979.100) [-978.258] -- 0:00:31
479000 -- (-979.943) [-978.285] (-979.057) (-981.065) * (-976.901) (-978.931) (-987.117) [-979.371] -- 0:00:31
479500 -- (-978.701) (-979.200) (-979.410) [-978.345] * (-977.669) (-977.695) (-983.635) [-977.769] -- 0:00:31
480000 -- (-979.873) (-979.441) (-979.027) [-979.856] * (-977.324) [-980.989] (-981.367) (-980.200) -- 0:00:31
Average standard deviation of split frequencies: 0.008134
480500 -- (-979.797) (-980.172) [-978.170] (-977.598) * (-981.315) (-980.188) (-980.343) [-978.137] -- 0:00:32
481000 -- (-979.091) (-977.464) [-979.310] (-976.970) * (-982.817) (-980.856) [-980.646] (-978.417) -- 0:00:32
481500 -- (-979.910) [-977.897] (-978.973) (-977.780) * [-981.102] (-979.991) (-979.477) (-980.397) -- 0:00:32
482000 -- [-978.384] (-979.327) (-981.735) (-979.382) * (-978.976) (-983.512) [-981.330] (-979.969) -- 0:00:32
482500 -- (-978.474) (-979.615) [-979.807] (-979.943) * (-979.425) (-980.146) (-983.422) [-977.006] -- 0:00:32
483000 -- (-977.746) (-981.749) [-977.511] (-978.503) * [-980.458] (-992.374) (-981.557) (-980.482) -- 0:00:32
483500 -- (-978.160) (-980.356) [-977.877] (-979.297) * (-980.737) [-987.661] (-978.835) (-980.639) -- 0:00:32
484000 -- (-978.748) (-984.309) [-978.087] (-980.617) * (-981.139) (-984.223) (-978.772) [-977.340] -- 0:00:31
484500 -- (-984.395) (-980.807) [-979.104] (-980.180) * (-981.656) (-978.697) [-977.705] (-977.281) -- 0:00:31
485000 -- (-978.871) [-980.613] (-977.739) (-976.978) * (-978.016) (-983.311) (-979.247) [-977.126] -- 0:00:31
Average standard deviation of split frequencies: 0.008137
485500 -- (-977.824) (-983.093) [-977.916] (-979.642) * (-977.744) (-980.280) [-978.055] (-979.309) -- 0:00:31
486000 -- (-982.747) [-979.979] (-980.088) (-983.082) * (-977.986) [-979.579] (-979.334) (-979.107) -- 0:00:31
486500 -- (-981.315) (-980.349) [-979.642] (-977.139) * [-977.944] (-976.998) (-978.470) (-979.312) -- 0:00:31
487000 -- (-977.072) [-982.274] (-980.121) (-980.658) * (-980.430) (-978.743) (-979.728) [-979.038] -- 0:00:31
487500 -- [-980.576] (-981.444) (-985.766) (-980.072) * (-979.085) [-978.081] (-981.935) (-985.391) -- 0:00:31
488000 -- (-977.122) (-980.671) (-979.394) [-977.955] * (-978.088) [-978.030] (-982.192) (-981.553) -- 0:00:31
488500 -- [-977.007] (-979.309) (-978.181) (-979.613) * (-981.180) [-978.607] (-978.301) (-979.345) -- 0:00:31
489000 -- (-976.967) (-979.044) (-979.405) [-978.046] * (-981.115) (-977.958) (-981.364) [-979.401] -- 0:00:31
489500 -- (-979.374) (-979.233) (-979.001) [-977.459] * (-980.136) [-980.264] (-983.380) (-980.000) -- 0:00:31
490000 -- (-980.863) (-984.833) (-979.240) [-979.421] * (-978.066) (-979.124) [-980.964] (-982.778) -- 0:00:31
Average standard deviation of split frequencies: 0.008166
490500 -- (-979.304) [-986.160] (-978.713) (-977.951) * (-980.329) (-979.489) [-980.331] (-984.023) -- 0:00:31
491000 -- (-977.133) (-979.928) [-978.087] (-977.200) * (-978.481) [-981.035] (-981.444) (-978.455) -- 0:00:31
491500 -- (-977.133) [-978.866] (-979.034) (-977.976) * (-978.638) (-978.899) [-978.493] (-980.214) -- 0:00:31
492000 -- (-977.133) (-978.637) [-979.696] (-978.060) * (-977.841) [-978.175] (-979.729) (-979.113) -- 0:00:30
492500 -- [-977.133] (-978.148) (-980.777) (-978.687) * [-979.039] (-977.762) (-977.461) (-978.307) -- 0:00:30
493000 -- (-980.178) (-978.587) [-979.566] (-980.754) * (-978.901) (-980.056) [-977.878] (-978.484) -- 0:00:30
493500 -- (-978.547) [-978.749] (-977.499) (-979.597) * [-978.043] (-977.661) (-979.328) (-981.308) -- 0:00:30
494000 -- (-978.123) [-978.219] (-979.754) (-979.221) * (-977.715) (-979.728) (-980.528) [-981.477] -- 0:00:30
494500 -- (-978.563) (-977.427) [-979.412] (-982.710) * (-977.189) (-981.467) [-977.357] (-979.142) -- 0:00:30
495000 -- (-980.857) (-978.699) (-983.495) [-979.577] * (-977.395) (-977.361) [-979.170] (-981.213) -- 0:00:30
Average standard deviation of split frequencies: 0.008945
495500 -- (-981.113) (-980.751) [-978.908] (-981.139) * (-977.534) [-978.150] (-977.342) (-980.150) -- 0:00:30
496000 -- (-978.815) (-980.690) [-979.060] (-980.057) * (-979.145) (-977.396) [-978.901] (-984.291) -- 0:00:30
496500 -- (-979.128) (-977.507) [-978.940] (-978.014) * [-980.419] (-979.143) (-979.960) (-977.768) -- 0:00:30
497000 -- (-978.462) [-977.112] (-978.744) (-979.484) * (-978.897) [-979.880] (-980.171) (-979.291) -- 0:00:31
497500 -- (-980.461) (-979.312) (-982.403) [-978.099] * [-978.976] (-980.563) (-981.921) (-981.537) -- 0:00:31
498000 -- [-980.018] (-982.511) (-983.275) (-978.670) * (-980.581) [-982.472] (-978.673) (-982.382) -- 0:00:31
498500 -- (-986.145) (-977.851) (-977.786) [-978.198] * (-980.318) (-982.509) (-979.112) [-979.528] -- 0:00:31
499000 -- (-985.414) (-977.351) [-978.009] (-979.575) * [-979.147] (-978.785) (-983.638) (-979.124) -- 0:00:31
499500 -- (-986.564) (-978.338) [-977.000] (-986.812) * (-980.302) (-980.181) [-980.438] (-978.148) -- 0:00:31
500000 -- (-979.006) (-978.200) [-977.995] (-978.159) * [-978.914] (-980.701) (-980.947) (-980.090) -- 0:00:31
Average standard deviation of split frequencies: 0.009028
500500 -- (-979.360) (-980.861) [-977.819] (-978.338) * (-979.309) [-978.125] (-979.919) (-979.428) -- 0:00:30
501000 -- (-980.336) [-979.220] (-979.828) (-978.158) * (-977.923) [-980.316] (-983.117) (-979.510) -- 0:00:30
501500 -- (-983.268) (-978.368) [-977.858] (-979.153) * (-978.814) (-979.601) [-978.559] (-979.203) -- 0:00:30
502000 -- (-979.329) (-980.297) (-978.007) [-979.056] * (-978.218) (-980.242) [-978.079] (-977.816) -- 0:00:30
502500 -- [-979.545] (-980.334) (-978.003) (-979.307) * (-980.899) (-982.596) [-982.739] (-978.486) -- 0:00:30
503000 -- (-979.779) (-976.898) [-977.267] (-979.305) * (-978.963) (-980.613) [-981.904] (-980.124) -- 0:00:30
503500 -- [-978.416] (-977.256) (-979.650) (-983.525) * (-978.334) [-978.386] (-985.651) (-978.382) -- 0:00:30
504000 -- [-978.439] (-978.372) (-980.676) (-985.181) * [-977.891] (-978.839) (-978.970) (-979.910) -- 0:00:30
504500 -- (-983.902) (-979.061) [-981.362] (-979.376) * (-980.716) (-978.250) [-980.329] (-981.483) -- 0:00:30
505000 -- [-977.277] (-979.261) (-979.996) (-978.149) * (-983.497) [-977.720] (-984.153) (-982.896) -- 0:00:30
Average standard deviation of split frequencies: 0.008878
505500 -- (-977.277) (-982.381) (-983.794) [-979.722] * (-979.861) (-978.006) [-982.595] (-979.025) -- 0:00:30
506000 -- (-978.353) (-984.639) (-980.394) [-977.763] * (-979.351) (-980.933) (-978.512) [-978.975] -- 0:00:30
506500 -- (-981.661) (-978.555) (-979.299) [-979.178] * (-979.226) (-978.498) [-977.220] (-981.991) -- 0:00:30
507000 -- (-979.886) (-979.562) [-978.915] (-978.295) * (-980.318) (-981.571) [-981.095] (-982.851) -- 0:00:30
507500 -- (-979.903) (-980.616) [-978.399] (-980.021) * [-977.082] (-979.404) (-981.164) (-982.926) -- 0:00:30
508000 -- [-979.290] (-979.261) (-978.264) (-981.149) * (-979.444) [-978.254] (-982.572) (-978.165) -- 0:00:30
508500 -- (-982.537) (-980.451) [-978.847] (-978.324) * (-978.068) (-978.766) [-980.057] (-981.144) -- 0:00:29
509000 -- [-977.768] (-981.041) (-978.323) (-980.374) * [-978.797] (-978.786) (-982.004) (-979.928) -- 0:00:29
509500 -- (-979.157) [-979.616] (-978.193) (-979.137) * (-978.068) [-978.041] (-981.293) (-979.839) -- 0:00:29
510000 -- (-979.545) (-979.008) (-977.619) [-979.556] * (-977.863) [-978.383] (-983.067) (-978.364) -- 0:00:29
Average standard deviation of split frequencies: 0.008797
510500 -- (-984.350) [-979.463] (-984.088) (-978.986) * (-979.826) (-978.788) (-979.012) [-978.470] -- 0:00:29
511000 -- [-980.110] (-979.544) (-984.808) (-978.445) * (-978.928) (-983.574) [-981.189] (-977.227) -- 0:00:29
511500 -- [-978.668] (-979.355) (-983.456) (-980.806) * (-978.762) (-980.343) [-978.182] (-977.405) -- 0:00:29
512000 -- (-979.127) [-980.116] (-979.262) (-979.612) * (-979.065) [-977.318] (-977.297) (-981.473) -- 0:00:29
512500 -- (-978.438) (-978.750) [-981.093] (-985.617) * (-979.383) [-977.543] (-978.162) (-977.780) -- 0:00:29
513000 -- (-979.101) (-981.930) (-979.194) [-980.174] * (-979.529) (-982.838) (-977.491) [-977.779] -- 0:00:29
513500 -- (-977.453) (-982.112) [-979.194] (-979.640) * [-977.249] (-980.381) (-982.798) (-978.194) -- 0:00:30
514000 -- [-977.646] (-978.665) (-977.571) (-982.294) * (-978.056) (-982.161) (-980.594) [-980.760] -- 0:00:30
514500 -- (-978.501) (-977.930) [-978.339] (-980.817) * (-977.265) (-978.771) (-981.879) [-977.457] -- 0:00:30
515000 -- [-977.946] (-977.664) (-982.568) (-987.233) * (-978.100) (-977.963) (-979.974) [-978.101] -- 0:00:30
Average standard deviation of split frequencies: 0.008491
515500 -- (-978.154) (-979.346) [-981.014] (-981.719) * [-977.461] (-978.667) (-981.603) (-979.542) -- 0:00:30
516000 -- (-980.895) (-985.632) (-981.851) [-980.087] * [-978.954] (-980.399) (-979.982) (-980.713) -- 0:00:30
516500 -- [-977.870] (-986.931) (-981.972) (-978.597) * (-978.109) (-979.011) (-977.241) [-980.193] -- 0:00:29
517000 -- (-977.937) (-982.142) [-978.139] (-980.948) * [-978.771] (-979.975) (-978.354) (-984.322) -- 0:00:29
517500 -- [-978.879] (-978.908) (-979.231) (-979.951) * (-979.145) (-986.719) [-980.037] (-979.997) -- 0:00:29
518000 -- (-979.062) (-978.282) (-979.486) [-979.013] * (-982.892) (-979.671) [-980.457] (-980.971) -- 0:00:29
518500 -- [-978.211] (-979.560) (-979.117) (-977.759) * (-984.434) (-980.050) [-977.740] (-980.815) -- 0:00:29
519000 -- [-980.838] (-978.123) (-980.362) (-979.887) * [-979.195] (-978.436) (-979.262) (-979.970) -- 0:00:29
519500 -- (-979.572) (-977.792) [-979.083] (-982.038) * (-978.864) (-978.775) [-979.167] (-981.214) -- 0:00:29
520000 -- (-978.000) [-977.661] (-976.876) (-985.593) * (-984.871) (-979.019) [-978.101] (-978.177) -- 0:00:29
Average standard deviation of split frequencies: 0.007979
520500 -- (-985.042) (-978.060) (-981.607) [-979.375] * [-981.480] (-978.510) (-979.767) (-978.649) -- 0:00:29
521000 -- (-986.714) [-981.113] (-978.768) (-978.036) * [-980.869] (-979.886) (-978.654) (-978.219) -- 0:00:29
521500 -- (-981.043) (-982.509) [-979.807] (-981.412) * [-981.848] (-980.867) (-979.131) (-978.541) -- 0:00:29
522000 -- (-979.564) (-978.833) [-979.769] (-977.123) * (-977.785) (-978.552) [-979.358] (-977.866) -- 0:00:29
522500 -- (-979.196) (-979.313) (-981.132) [-976.878] * (-981.540) (-979.033) (-982.147) [-977.427] -- 0:00:29
523000 -- (-979.154) (-978.640) [-977.329] (-977.696) * (-980.057) (-978.865) (-979.056) [-977.233] -- 0:00:29
523500 -- [-979.282] (-977.874) (-979.083) (-981.778) * [-981.553] (-979.072) (-978.531) (-978.125) -- 0:00:29
524000 -- (-979.261) (-978.186) (-979.514) [-979.385] * (-979.337) [-978.283] (-977.690) (-980.996) -- 0:00:29
524500 -- (-979.617) (-980.097) (-978.258) [-979.987] * (-978.005) (-979.020) (-979.831) [-978.972] -- 0:00:29
525000 -- (-978.999) [-978.890] (-980.066) (-982.614) * (-978.803) [-977.759] (-978.730) (-980.132) -- 0:00:28
Average standard deviation of split frequencies: 0.008013
525500 -- (-979.556) (-979.985) [-981.120] (-985.356) * (-983.971) (-978.853) [-978.451] (-978.432) -- 0:00:28
526000 -- (-983.143) [-979.361] (-980.827) (-980.992) * [-978.603] (-978.157) (-978.574) (-979.116) -- 0:00:28
526500 -- (-981.821) [-977.465] (-979.194) (-983.914) * (-979.547) [-977.470] (-977.138) (-978.670) -- 0:00:28
527000 -- [-978.199] (-978.446) (-979.196) (-978.559) * (-981.846) (-982.322) (-977.496) [-978.636] -- 0:00:28
527500 -- (-978.427) (-977.316) [-981.303] (-979.077) * (-977.146) (-977.457) (-977.297) [-982.388] -- 0:00:28
528000 -- (-978.046) (-977.767) (-980.939) [-979.823] * (-977.092) [-978.956] (-978.658) (-978.941) -- 0:00:28
528500 -- (-977.601) (-980.808) (-979.514) [-980.074] * (-978.393) [-982.629] (-977.521) (-978.703) -- 0:00:28
529000 -- (-977.665) (-977.178) [-985.279] (-980.300) * (-977.763) (-978.180) [-978.189] (-978.769) -- 0:00:28
529500 -- [-980.056] (-979.124) (-979.333) (-978.190) * (-980.301) (-979.427) (-981.716) [-979.913] -- 0:00:28
530000 -- (-979.808) (-982.539) [-980.786] (-979.080) * [-978.974] (-979.256) (-981.600) (-977.686) -- 0:00:29
Average standard deviation of split frequencies: 0.008256
530500 -- (-978.976) [-978.290] (-981.446) (-977.107) * [-978.640] (-979.848) (-984.383) (-979.881) -- 0:00:29
531000 -- (-978.079) (-977.749) (-980.209) [-979.753] * (-979.490) [-977.884] (-980.032) (-978.781) -- 0:00:29
531500 -- [-978.750] (-976.978) (-981.370) (-977.497) * (-977.218) [-979.590] (-977.503) (-980.957) -- 0:00:29
532000 -- (-978.484) [-976.963] (-979.212) (-977.314) * [-977.971] (-979.247) (-980.834) (-978.370) -- 0:00:29
532500 -- (-976.939) (-977.768) (-982.639) [-976.964] * (-978.075) (-982.383) (-977.838) [-978.037] -- 0:00:28
533000 -- (-977.086) (-977.770) (-977.734) [-978.189] * (-978.920) (-983.115) (-977.464) [-980.099] -- 0:00:28
533500 -- (-978.960) [-978.500] (-978.085) (-978.666) * [-977.965] (-978.725) (-979.386) (-981.868) -- 0:00:28
534000 -- [-977.966] (-979.427) (-977.336) (-978.046) * (-977.500) (-978.391) (-979.105) [-979.993] -- 0:00:28
534500 -- (-979.177) (-977.277) [-978.545] (-981.828) * (-977.046) (-980.387) [-980.737] (-979.338) -- 0:00:28
535000 -- (-977.776) (-978.342) [-977.757] (-978.549) * (-978.038) [-980.365] (-980.681) (-978.510) -- 0:00:28
Average standard deviation of split frequencies: 0.008484
535500 -- [-976.930] (-978.272) (-978.557) (-977.778) * (-981.980) (-980.244) (-982.328) [-980.379] -- 0:00:28
536000 -- (-978.516) (-977.727) (-979.902) [-977.358] * [-977.668] (-977.093) (-981.549) (-984.007) -- 0:00:28
536500 -- [-978.617] (-979.482) (-979.329) (-977.469) * (-977.834) [-981.572] (-978.730) (-978.308) -- 0:00:28
537000 -- (-977.659) [-978.509] (-981.637) (-978.195) * [-978.338] (-977.319) (-979.153) (-979.566) -- 0:00:28
537500 -- (-985.106) (-982.676) (-979.456) [-978.077] * (-977.626) (-978.377) (-980.428) [-978.354] -- 0:00:28
538000 -- [-979.829] (-980.355) (-978.703) (-978.338) * (-979.140) (-980.601) (-981.092) [-977.532] -- 0:00:28
538500 -- (-980.436) (-982.892) (-978.245) [-978.469] * (-978.244) (-981.218) (-979.417) [-977.427] -- 0:00:28
539000 -- [-980.953] (-984.969) (-977.453) (-979.227) * [-982.559] (-977.546) (-977.987) (-977.035) -- 0:00:28
539500 -- (-979.432) (-981.482) (-977.357) [-979.408] * (-980.256) [-977.760] (-981.289) (-978.741) -- 0:00:28
540000 -- [-978.032] (-979.110) (-978.093) (-979.151) * (-978.602) (-980.488) (-980.227) [-978.389] -- 0:00:28
Average standard deviation of split frequencies: 0.008514
540500 -- [-978.900] (-987.039) (-982.100) (-978.722) * (-978.494) (-979.580) (-979.824) [-978.174] -- 0:00:28
541000 -- [-978.833] (-979.030) (-977.925) (-978.723) * (-978.578) [-977.753] (-980.354) (-983.095) -- 0:00:27
541500 -- (-978.886) [-980.124] (-979.619) (-977.591) * (-978.472) (-979.532) [-978.032] (-983.279) -- 0:00:27
542000 -- (-979.546) (-978.844) (-980.153) [-980.000] * (-978.944) (-978.456) (-978.484) [-980.869] -- 0:00:27
542500 -- [-981.033] (-979.742) (-979.058) (-983.132) * (-982.281) [-979.816] (-981.381) (-981.455) -- 0:00:27
543000 -- [-982.180] (-977.377) (-978.458) (-978.177) * (-982.416) (-978.588) [-979.300] (-978.760) -- 0:00:27
543500 -- (-978.768) [-978.733] (-979.053) (-979.654) * (-978.409) (-978.088) (-983.527) [-976.882] -- 0:00:27
544000 -- (-981.049) [-978.166] (-978.160) (-977.787) * (-982.460) (-977.150) (-978.268) [-976.957] -- 0:00:27
544500 -- (-978.646) (-982.327) (-978.159) [-981.290] * (-983.885) [-977.934] (-980.357) (-978.950) -- 0:00:27
545000 -- (-978.939) [-980.523] (-980.362) (-979.758) * (-985.253) (-977.911) [-978.525] (-981.892) -- 0:00:27
Average standard deviation of split frequencies: 0.007872
545500 -- (-977.395) [-978.122] (-980.246) (-979.261) * (-978.752) [-978.393] (-980.496) (-979.129) -- 0:00:27
546000 -- (-978.075) (-981.155) [-979.772] (-980.426) * (-979.441) (-977.796) (-978.866) [-977.747] -- 0:00:27
546500 -- [-977.601] (-980.335) (-978.877) (-979.317) * (-978.681) (-978.477) (-978.037) [-978.396] -- 0:00:28
547000 -- [-978.387] (-978.597) (-978.264) (-977.756) * (-979.901) (-977.730) (-979.903) [-978.561] -- 0:00:28
547500 -- (-979.827) (-977.304) (-979.821) [-981.338] * (-978.410) (-977.429) [-980.588] (-978.896) -- 0:00:28
548000 -- (-978.769) [-978.820] (-979.327) (-980.250) * (-977.441) (-979.717) (-982.943) [-977.770] -- 0:00:28
548500 -- (-979.622) (-977.750) [-978.489] (-979.202) * (-979.171) [-978.654] (-978.574) (-981.861) -- 0:00:27
549000 -- (-984.441) [-978.884] (-977.496) (-977.839) * [-978.214] (-980.562) (-978.830) (-977.974) -- 0:00:27
549500 -- (-980.295) (-978.197) (-977.487) [-978.474] * (-979.320) [-980.460] (-978.717) (-978.628) -- 0:00:27
550000 -- (-982.587) (-979.972) [-978.167] (-980.243) * (-979.520) (-979.588) [-979.442] (-977.232) -- 0:00:27
Average standard deviation of split frequencies: 0.008007
550500 -- (-977.778) (-979.669) (-979.271) [-977.758] * (-978.856) (-980.553) (-980.172) [-978.785] -- 0:00:27
551000 -- (-978.245) (-979.490) (-979.827) [-979.922] * (-977.898) (-981.863) [-979.729] (-978.677) -- 0:00:27
551500 -- (-979.776) (-979.342) (-979.017) [-980.347] * (-977.813) (-977.664) (-979.268) [-977.615] -- 0:00:27
552000 -- (-979.649) (-978.530) (-979.400) [-977.676] * (-979.273) [-977.496] (-977.882) (-979.385) -- 0:00:27
552500 -- [-980.083] (-981.917) (-981.019) (-980.351) * (-978.599) (-982.886) [-978.347] (-978.869) -- 0:00:27
553000 -- (-978.127) [-977.717] (-979.494) (-980.132) * (-979.034) (-980.481) (-978.138) [-977.970] -- 0:00:27
553500 -- (-980.884) (-980.113) (-978.563) [-977.541] * (-978.899) (-977.864) [-977.788] (-986.042) -- 0:00:27
554000 -- (-983.042) (-977.347) [-978.575] (-976.945) * (-978.778) (-980.145) [-977.022] (-980.830) -- 0:00:27
554500 -- [-982.071] (-978.756) (-981.703) (-976.991) * (-978.116) [-979.444] (-978.811) (-979.502) -- 0:00:27
555000 -- (-978.756) (-978.631) (-982.621) [-976.983] * (-978.591) (-981.963) [-977.589] (-979.212) -- 0:00:27
Average standard deviation of split frequencies: 0.007331
555500 -- (-978.376) (-979.447) [-977.563] (-979.184) * [-977.694] (-982.613) (-978.689) (-980.356) -- 0:00:27
556000 -- (-978.799) (-978.007) (-977.873) [-983.806] * (-984.129) (-984.756) (-980.313) [-979.598] -- 0:00:27
556500 -- [-977.523] (-977.643) (-978.092) (-978.469) * (-987.472) (-979.821) (-979.642) [-980.296] -- 0:00:27
557000 -- (-977.071) (-977.045) (-977.980) [-981.950] * (-979.819) [-977.478] (-977.590) (-977.979) -- 0:00:27
557500 -- (-978.241) [-981.802] (-978.768) (-981.459) * [-977.737] (-980.707) (-980.737) (-978.329) -- 0:00:26
558000 -- (-978.363) (-978.809) [-978.502] (-979.777) * [-978.389] (-979.096) (-979.918) (-979.186) -- 0:00:26
558500 -- (-979.985) (-977.155) [-982.307] (-978.485) * (-979.806) (-979.546) (-978.149) [-979.331] -- 0:00:26
559000 -- (-978.343) [-976.909] (-982.077) (-980.297) * (-979.102) (-981.882) (-978.426) [-979.216] -- 0:00:26
559500 -- (-980.954) (-982.501) [-979.906] (-980.648) * (-978.942) (-978.721) [-978.930] (-978.114) -- 0:00:26
560000 -- (-978.914) (-982.422) (-977.829) [-979.782] * (-978.808) [-979.208] (-979.657) (-979.983) -- 0:00:26
Average standard deviation of split frequencies: 0.007913
560500 -- (-980.469) [-980.429] (-978.388) (-981.367) * [-978.528] (-980.309) (-982.511) (-982.287) -- 0:00:26
561000 -- (-978.797) [-978.447] (-977.689) (-980.041) * (-978.582) (-980.495) (-981.794) [-977.145] -- 0:00:26
561500 -- (-979.099) (-981.919) (-983.261) [-979.060] * (-978.477) (-980.979) [-980.591] (-977.555) -- 0:00:26
562000 -- (-979.671) (-982.984) (-983.240) [-977.583] * (-980.424) (-983.106) [-978.774] (-977.444) -- 0:00:26
562500 -- (-979.223) (-977.201) (-984.292) [-978.734] * (-979.739) [-978.775] (-977.815) (-977.686) -- 0:00:26
563000 -- [-978.259] (-977.633) (-981.054) (-979.848) * (-977.174) [-981.430] (-979.781) (-978.833) -- 0:00:27
563500 -- (-978.521) (-978.893) [-977.794] (-983.354) * (-979.908) (-982.323) [-981.166] (-978.609) -- 0:00:27
564000 -- (-982.281) (-977.527) (-978.143) [-984.304] * (-981.951) (-979.685) (-980.225) [-977.670] -- 0:00:27
564500 -- (-981.050) [-980.721] (-981.849) (-982.652) * [-979.328] (-982.481) (-980.911) (-977.033) -- 0:00:27
565000 -- (-980.283) (-977.403) (-976.966) [-983.206] * [-977.578] (-980.176) (-979.201) (-980.731) -- 0:00:26
Average standard deviation of split frequencies: 0.008231
565500 -- (-979.374) (-977.768) [-976.931] (-979.995) * (-978.970) (-981.309) [-978.365] (-978.630) -- 0:00:26
566000 -- (-980.243) [-977.888] (-977.503) (-977.337) * (-978.812) (-980.877) (-980.391) [-978.128] -- 0:00:26
566500 -- [-977.847] (-980.823) (-983.948) (-978.130) * [-978.726] (-977.861) (-982.590) (-977.585) -- 0:00:26
567000 -- (-978.796) (-981.594) [-981.857] (-979.208) * (-980.210) [-978.378] (-982.347) (-980.360) -- 0:00:26
567500 -- (-977.936) (-980.303) (-978.366) [-979.612] * [-979.588] (-978.316) (-977.528) (-978.055) -- 0:00:26
568000 -- (-978.508) [-979.673] (-985.258) (-977.615) * (-984.912) [-978.996] (-978.936) (-978.133) -- 0:00:26
568500 -- [-977.402] (-978.355) (-979.056) (-978.442) * (-978.534) [-980.434] (-981.354) (-978.177) -- 0:00:26
569000 -- [-978.543] (-979.856) (-978.360) (-978.150) * [-978.161] (-978.583) (-977.164) (-977.797) -- 0:00:26
569500 -- (-977.162) (-977.425) [-977.000] (-980.734) * (-979.643) [-980.841] (-979.088) (-979.235) -- 0:00:26
570000 -- (-979.468) (-980.090) [-977.077] (-978.467) * (-979.737) [-978.460] (-980.061) (-982.215) -- 0:00:26
Average standard deviation of split frequencies: 0.008504
570500 -- (-980.272) [-978.210] (-977.653) (-977.913) * (-980.803) [-979.008] (-979.445) (-984.818) -- 0:00:26
571000 -- (-981.091) (-979.115) [-981.317] (-979.459) * (-980.421) [-980.283] (-978.387) (-980.705) -- 0:00:26
571500 -- (-978.051) (-978.028) (-983.039) [-981.536] * [-978.208] (-981.480) (-978.366) (-979.158) -- 0:00:26
572000 -- (-978.394) [-978.173] (-980.039) (-977.882) * (-983.509) (-979.275) [-977.827] (-977.806) -- 0:00:26
572500 -- [-978.281] (-978.660) (-982.065) (-980.016) * [-979.639] (-977.259) (-982.221) (-978.701) -- 0:00:26
573000 -- (-982.379) (-979.030) [-979.432] (-978.681) * (-977.818) (-980.565) [-982.612] (-979.554) -- 0:00:26
573500 -- (-978.884) [-979.054] (-980.424) (-981.142) * [-980.608] (-977.310) (-983.988) (-979.160) -- 0:00:26
574000 -- [-981.103] (-980.184) (-978.379) (-980.204) * (-981.636) (-981.321) (-977.474) [-978.139] -- 0:00:25
574500 -- [-981.525] (-980.022) (-980.959) (-979.108) * (-979.709) (-980.535) (-978.450) [-977.214] -- 0:00:25
575000 -- (-983.606) [-977.978] (-977.494) (-979.070) * (-979.597) (-980.266) [-979.519] (-978.675) -- 0:00:25
Average standard deviation of split frequencies: 0.008184
575500 -- (-982.697) [-977.288] (-977.625) (-977.777) * (-980.357) [-977.446] (-978.582) (-978.659) -- 0:00:25
576000 -- (-977.733) (-977.416) [-977.869] (-977.151) * (-981.438) (-977.306) [-980.442] (-978.245) -- 0:00:25
576500 -- (-983.894) [-979.086] (-978.265) (-977.010) * (-978.291) (-977.046) [-979.732] (-978.600) -- 0:00:25
577000 -- (-978.558) (-978.343) (-978.894) [-978.753] * (-978.322) (-978.140) (-979.793) [-977.964] -- 0:00:25
577500 -- (-977.073) [-977.588] (-978.298) (-978.057) * (-977.389) (-977.893) [-980.746] (-978.342) -- 0:00:25
578000 -- (-980.376) [-978.121] (-977.885) (-979.565) * (-979.191) (-979.665) (-981.225) [-978.053] -- 0:00:25
578500 -- [-978.530] (-979.319) (-977.959) (-982.544) * (-980.593) [-979.452] (-983.997) (-978.053) -- 0:00:25
579000 -- (-977.946) (-978.300) (-981.700) [-977.467] * (-978.224) (-980.034) [-983.184] (-985.559) -- 0:00:25
579500 -- (-979.611) [-981.412] (-982.887) (-977.814) * (-982.887) [-979.147] (-980.480) (-981.914) -- 0:00:26
580000 -- (-980.502) [-983.867] (-979.300) (-977.814) * (-981.028) (-981.750) (-980.514) [-981.582] -- 0:00:26
Average standard deviation of split frequencies: 0.008309
580500 -- [-979.393] (-977.877) (-978.591) (-977.465) * [-978.394] (-979.534) (-980.650) (-980.052) -- 0:00:26
581000 -- [-978.642] (-981.283) (-983.295) (-977.660) * [-977.415] (-980.112) (-980.493) (-978.350) -- 0:00:25
581500 -- (-978.431) [-979.470] (-983.668) (-979.861) * (-979.813) (-977.944) (-977.127) [-978.700] -- 0:00:25
582000 -- (-977.944) [-979.709] (-980.156) (-980.849) * (-979.395) [-977.527] (-976.817) (-980.584) -- 0:00:25
582500 -- (-983.608) (-979.069) (-979.413) [-977.595] * (-978.069) (-977.784) [-978.821] (-977.790) -- 0:00:25
583000 -- (-978.731) [-981.965] (-979.070) (-978.021) * [-978.079] (-978.164) (-978.800) (-981.254) -- 0:00:25
583500 -- (-984.891) (-979.121) [-981.976] (-978.625) * (-979.785) (-979.582) [-978.378] (-980.504) -- 0:00:25
584000 -- (-980.371) (-977.351) [-979.020] (-977.984) * (-978.871) (-977.249) (-981.894) [-977.329] -- 0:00:25
584500 -- (-979.536) (-981.102) [-978.415] (-985.551) * (-978.400) (-979.569) [-978.796] (-978.203) -- 0:00:25
585000 -- (-977.720) (-977.931) [-978.106] (-983.841) * (-977.816) (-980.350) (-983.173) [-979.448] -- 0:00:25
Average standard deviation of split frequencies: 0.008660
585500 -- (-978.527) (-980.382) (-979.502) [-979.783] * (-978.482) (-980.856) (-986.369) [-978.267] -- 0:00:25
586000 -- [-979.586] (-977.429) (-977.958) (-978.048) * (-977.577) (-980.684) [-980.766] (-978.750) -- 0:00:25
586500 -- (-979.555) (-978.601) [-979.191] (-980.569) * (-978.542) (-978.326) (-979.020) [-979.344] -- 0:00:25
587000 -- (-981.943) [-980.176] (-979.210) (-981.730) * (-980.384) (-977.828) [-977.811] (-978.967) -- 0:00:25
587500 -- (-980.103) (-979.869) (-978.780) [-979.332] * (-982.727) [-982.152] (-977.734) (-977.128) -- 0:00:25
588000 -- (-979.925) (-984.992) [-978.345] (-979.749) * [-979.997] (-977.654) (-984.919) (-978.985) -- 0:00:25
588500 -- (-979.990) (-981.346) (-981.609) [-981.491] * (-979.793) (-980.811) (-981.725) [-978.771] -- 0:00:25
589000 -- (-980.197) [-978.968] (-979.050) (-979.639) * [-981.960] (-977.936) (-978.348) (-979.185) -- 0:00:25
589500 -- (-978.742) (-978.582) (-977.302) [-979.348] * (-980.728) (-980.597) [-979.485] (-978.533) -- 0:00:25
590000 -- (-977.721) (-979.392) (-979.662) [-977.724] * (-977.221) [-978.246] (-979.726) (-977.490) -- 0:00:25
Average standard deviation of split frequencies: 0.008310
590500 -- (-977.315) (-982.550) (-978.869) [-977.627] * (-979.901) (-980.220) (-980.290) [-979.488] -- 0:00:24
591000 -- (-978.284) (-989.963) (-979.254) [-978.028] * (-978.218) [-982.711] (-982.535) (-978.884) -- 0:00:24
591500 -- (-977.201) (-983.251) [-977.677] (-981.110) * [-979.501] (-981.241) (-977.976) (-980.312) -- 0:00:24
592000 -- (-980.494) (-979.636) [-977.225] (-980.179) * (-978.701) [-979.260] (-979.105) (-980.098) -- 0:00:24
592500 -- (-978.577) [-977.986] (-977.170) (-981.332) * (-977.233) (-982.131) (-979.911) [-983.171] -- 0:00:24
593000 -- (-982.865) [-978.749] (-981.676) (-981.666) * (-977.511) (-978.407) (-982.048) [-979.925] -- 0:00:24
593500 -- (-979.218) (-979.779) [-981.418] (-981.069) * (-979.776) (-977.571) [-977.571] (-978.410) -- 0:00:24
594000 -- (-978.982) (-980.022) [-979.014] (-977.206) * (-979.205) (-978.646) (-978.312) [-978.520] -- 0:00:24
594500 -- [-978.075] (-981.197) (-979.020) (-977.213) * [-978.305] (-978.475) (-978.312) (-980.871) -- 0:00:24
595000 -- (-978.197) (-981.163) (-979.937) [-978.763] * (-978.007) (-977.087) [-979.371] (-981.225) -- 0:00:24
Average standard deviation of split frequencies: 0.008375
595500 -- (-979.577) [-980.385] (-978.055) (-978.293) * [-980.022] (-977.096) (-980.156) (-980.283) -- 0:00:24
596000 -- (-979.509) [-979.329] (-978.095) (-979.313) * (-983.227) (-979.883) (-980.738) [-977.652] -- 0:00:25
596500 -- (-979.288) (-979.242) (-980.742) [-978.496] * (-977.812) [-977.230] (-979.337) (-979.345) -- 0:00:25
597000 -- [-979.968] (-978.894) (-979.099) (-979.371) * (-978.091) (-977.314) [-982.005] (-978.278) -- 0:00:24
597500 -- (-978.670) [-976.742] (-978.031) (-977.316) * (-979.520) (-978.242) (-979.914) [-977.715] -- 0:00:24
598000 -- (-979.345) (-978.776) (-979.108) [-978.805] * (-980.037) [-979.262] (-979.610) (-978.519) -- 0:00:24
598500 -- (-978.294) [-977.698] (-977.881) (-977.938) * (-977.921) (-980.096) (-977.076) [-977.265] -- 0:00:24
599000 -- (-979.708) [-978.555] (-977.785) (-978.648) * (-978.942) [-977.208] (-977.865) (-978.081) -- 0:00:24
599500 -- (-977.839) (-977.674) [-979.726] (-980.231) * (-977.849) (-978.439) (-979.194) [-977.241] -- 0:00:24
600000 -- [-980.357] (-982.091) (-977.590) (-981.348) * (-979.659) [-977.036] (-977.704) (-979.312) -- 0:00:24
Average standard deviation of split frequencies: 0.008402
600500 -- (-978.364) [-978.922] (-978.325) (-977.531) * (-982.067) (-977.913) [-978.092] (-981.101) -- 0:00:24
601000 -- [-977.066] (-978.479) (-978.424) (-977.431) * (-979.663) [-978.252] (-982.637) (-979.924) -- 0:00:24
601500 -- (-978.264) (-981.287) [-978.104] (-981.232) * (-979.588) (-979.861) (-978.571) [-979.912] -- 0:00:24
602000 -- (-981.110) [-977.926] (-978.585) (-979.324) * (-979.106) [-979.629] (-977.597) (-979.046) -- 0:00:24
602500 -- (-983.269) (-978.341) [-978.786] (-979.409) * (-978.693) (-979.135) (-979.384) [-977.954] -- 0:00:24
603000 -- (-979.290) (-980.716) [-981.229] (-979.235) * (-980.228) [-977.611] (-985.082) (-977.842) -- 0:00:24
603500 -- [-979.541] (-978.583) (-979.757) (-979.642) * (-981.035) [-979.294] (-983.847) (-980.321) -- 0:00:24
604000 -- (-979.615) (-982.781) (-981.841) [-976.873] * [-978.769] (-982.405) (-982.685) (-978.641) -- 0:00:24
604500 -- (-980.853) [-978.077] (-988.174) (-981.239) * [-977.575] (-978.833) (-978.508) (-978.132) -- 0:00:24
605000 -- (-980.259) (-978.755) (-977.602) [-978.863] * [-980.570] (-978.095) (-978.583) (-976.922) -- 0:00:24
Average standard deviation of split frequencies: 0.008282
605500 -- (-983.256) [-978.288] (-979.511) (-979.758) * (-980.581) (-979.028) [-977.738] (-979.313) -- 0:00:24
606000 -- (-981.225) (-979.119) [-978.886] (-981.002) * [-980.738] (-978.700) (-984.021) (-980.174) -- 0:00:24
606500 -- (-977.538) [-977.707] (-976.924) (-980.678) * (-980.525) (-977.748) (-981.232) [-981.954] -- 0:00:24
607000 -- (-978.451) [-977.652] (-978.223) (-980.914) * (-985.584) (-978.062) (-983.589) [-978.496] -- 0:00:23
607500 -- (-978.836) (-978.647) (-978.107) [-977.291] * (-979.487) [-981.085] (-985.384) (-978.584) -- 0:00:23
608000 -- (-985.385) [-979.329] (-977.745) (-977.538) * (-979.576) (-978.610) (-979.453) [-979.893] -- 0:00:23
608500 -- (-979.625) (-977.485) [-978.775] (-979.327) * (-978.220) (-982.433) (-980.164) [-979.584] -- 0:00:23
609000 -- (-978.441) (-979.543) (-981.559) [-980.278] * (-979.065) (-982.010) [-977.367] (-980.937) -- 0:00:23
609500 -- (-980.016) [-977.250] (-980.244) (-977.691) * (-976.806) (-979.651) (-977.145) [-977.454] -- 0:00:23
610000 -- (-984.991) [-977.859] (-982.070) (-978.404) * (-978.106) (-978.105) [-978.769] (-980.153) -- 0:00:23
Average standard deviation of split frequencies: 0.008401
610500 -- (-978.835) (-979.766) [-980.877] (-980.269) * (-978.666) (-978.581) [-979.344] (-982.267) -- 0:00:23
611000 -- (-978.645) [-978.593] (-978.641) (-978.588) * [-978.244] (-981.345) (-982.302) (-976.910) -- 0:00:23
611500 -- [-979.794] (-979.126) (-978.155) (-981.547) * (-980.028) (-980.213) (-981.459) [-977.665] -- 0:00:23
612000 -- (-981.474) [-978.076] (-978.506) (-978.028) * [-979.152] (-979.694) (-979.336) (-979.402) -- 0:00:24
612500 -- (-982.584) [-978.877] (-978.437) (-978.463) * [-977.112] (-978.203) (-977.149) (-979.333) -- 0:00:24
613000 -- (-979.097) [-978.384] (-979.162) (-977.537) * (-977.061) (-977.842) (-978.625) [-979.394] -- 0:00:23
613500 -- (-979.218) [-978.112] (-978.117) (-977.111) * [-977.313] (-977.273) (-977.763) (-978.780) -- 0:00:23
614000 -- [-978.583] (-978.222) (-977.646) (-978.406) * (-979.601) (-978.313) (-976.923) [-977.677] -- 0:00:23
614500 -- (-979.875) (-978.729) (-978.726) [-979.384] * (-977.401) (-980.328) (-976.855) [-977.782] -- 0:00:23
615000 -- (-977.675) (-977.778) [-978.599] (-979.121) * (-978.738) (-979.772) (-980.702) [-977.188] -- 0:00:23
Average standard deviation of split frequencies: 0.008328
615500 -- (-979.514) (-977.612) [-978.655] (-979.872) * (-980.406) (-977.042) [-978.935] (-979.364) -- 0:00:23
616000 -- (-980.852) (-977.069) (-981.488) [-978.689] * (-977.904) [-977.530] (-981.672) (-979.411) -- 0:00:23
616500 -- [-978.678] (-977.025) (-981.660) (-978.376) * (-977.643) (-977.432) (-978.605) [-981.595] -- 0:00:23
617000 -- (-977.244) [-976.780] (-981.572) (-978.840) * (-980.090) (-981.732) (-978.014) [-978.330] -- 0:00:23
617500 -- (-977.807) (-978.746) (-982.474) [-979.493] * (-980.227) [-981.275] (-980.691) (-979.749) -- 0:00:23
618000 -- [-977.953] (-981.696) (-977.799) (-980.343) * (-977.650) (-979.135) [-982.702] (-978.654) -- 0:00:23
618500 -- (-979.888) (-981.138) (-979.985) [-977.458] * (-979.813) (-979.380) (-980.322) [-978.919] -- 0:00:23
619000 -- (-977.816) (-977.765) [-980.057] (-977.450) * (-980.947) [-978.690] (-983.368) (-981.518) -- 0:00:23
619500 -- (-978.496) (-979.135) [-978.842] (-978.560) * (-979.226) (-977.684) (-980.240) [-977.768] -- 0:00:23
620000 -- (-977.876) [-977.919] (-979.500) (-978.269) * (-978.503) (-978.908) (-979.607) [-978.769] -- 0:00:23
Average standard deviation of split frequencies: 0.008221
620500 -- (-979.198) (-982.140) (-977.099) [-977.232] * (-980.589) (-978.710) (-979.365) [-979.655] -- 0:00:23
621000 -- [-979.154] (-980.139) (-976.903) (-978.431) * (-982.161) [-977.639] (-977.084) (-978.628) -- 0:00:23
621500 -- [-978.825] (-977.924) (-981.040) (-979.653) * (-980.192) (-977.787) [-978.784] (-978.005) -- 0:00:23
622000 -- (-978.284) (-979.942) (-983.220) [-979.142] * (-982.219) [-979.975] (-977.797) (-977.381) -- 0:00:23
622500 -- (-977.363) (-987.334) [-979.502] (-978.872) * [-978.138] (-981.369) (-978.179) (-978.602) -- 0:00:23
623000 -- (-978.865) [-979.921] (-979.925) (-982.160) * [-979.171] (-977.565) (-979.067) (-979.487) -- 0:00:22
623500 -- (-981.369) (-978.113) [-981.274] (-982.439) * [-977.424] (-979.886) (-978.300) (-978.133) -- 0:00:22
624000 -- [-978.066] (-978.334) (-980.717) (-980.147) * (-979.737) (-978.291) (-979.184) [-977.618] -- 0:00:22
624500 -- [-980.488] (-977.967) (-978.111) (-980.010) * (-980.282) (-978.789) (-978.676) [-977.279] -- 0:00:22
625000 -- (-978.893) [-978.528] (-977.877) (-980.917) * (-980.082) (-977.825) [-980.424] (-981.967) -- 0:00:22
Average standard deviation of split frequencies: 0.008239
625500 -- (-980.628) [-978.247] (-977.796) (-977.200) * (-978.858) (-980.226) (-980.621) [-978.491] -- 0:00:22
626000 -- [-978.125] (-980.499) (-979.425) (-978.761) * (-979.995) (-978.564) (-980.866) [-978.962] -- 0:00:22
626500 -- [-977.493] (-978.027) (-978.249) (-976.744) * [-977.911] (-982.010) (-980.108) (-978.502) -- 0:00:22
627000 -- [-980.403] (-977.659) (-980.437) (-978.032) * (-978.091) (-978.394) [-978.193] (-978.624) -- 0:00:22
627500 -- [-981.138] (-984.303) (-984.368) (-984.811) * [-978.189] (-981.764) (-978.647) (-979.615) -- 0:00:22
628000 -- (-985.535) (-983.413) (-980.293) [-978.524] * (-978.699) (-983.147) [-977.453] (-979.827) -- 0:00:22
628500 -- [-982.119] (-979.472) (-980.941) (-979.976) * (-978.314) (-977.359) [-978.115] (-977.876) -- 0:00:22
629000 -- (-981.003) (-980.997) [-980.778] (-981.032) * (-979.512) (-980.014) [-976.948] (-979.640) -- 0:00:23
629500 -- [-977.616] (-981.898) (-980.185) (-978.434) * (-982.729) [-984.204] (-977.616) (-978.156) -- 0:00:22
630000 -- (-977.972) [-978.495] (-978.234) (-978.408) * (-981.631) [-981.147] (-983.495) (-977.858) -- 0:00:22
Average standard deviation of split frequencies: 0.008662
630500 -- (-979.852) [-979.916] (-978.215) (-983.417) * [-980.233] (-977.929) (-979.425) (-977.120) -- 0:00:22
631000 -- (-980.567) [-978.378] (-978.090) (-979.752) * (-981.273) (-978.747) (-982.774) [-976.865] -- 0:00:22
631500 -- (-977.952) [-982.833] (-977.119) (-981.020) * (-979.249) [-978.993] (-983.870) (-980.043) -- 0:00:22
632000 -- (-978.817) [-979.607] (-978.338) (-977.945) * (-977.995) (-980.999) (-978.093) [-980.199] -- 0:00:22
632500 -- (-978.415) (-977.434) (-977.743) [-978.776] * (-977.856) (-983.000) (-981.374) [-977.750] -- 0:00:22
633000 -- (-978.182) (-977.582) (-977.481) [-978.859] * (-977.760) [-981.860] (-980.325) (-978.517) -- 0:00:22
633500 -- [-979.400] (-977.595) (-978.015) (-979.524) * [-977.665] (-981.486) (-978.404) (-979.221) -- 0:00:22
634000 -- (-977.817) (-980.353) (-981.825) [-977.935] * (-981.585) (-980.136) (-978.414) [-978.435] -- 0:00:22
634500 -- (-977.863) [-979.410] (-978.806) (-979.370) * (-977.484) (-981.399) [-980.262] (-981.614) -- 0:00:22
635000 -- [-978.567] (-977.780) (-978.824) (-978.629) * (-977.160) (-981.710) (-978.810) [-982.223] -- 0:00:22
Average standard deviation of split frequencies: 0.008153
635500 -- [-981.476] (-978.209) (-978.512) (-981.932) * (-977.567) [-978.875] (-976.912) (-983.044) -- 0:00:22
636000 -- (-978.906) [-979.474] (-977.667) (-978.668) * (-979.029) [-979.435] (-979.878) (-977.663) -- 0:00:22
636500 -- (-982.385) (-981.394) [-977.754] (-981.536) * [-979.403] (-981.046) (-979.750) (-978.901) -- 0:00:22
637000 -- (-977.929) [-979.800] (-978.888) (-981.930) * (-979.960) [-977.239] (-978.073) (-978.583) -- 0:00:22
637500 -- (-977.434) (-977.948) (-983.313) [-979.712] * [-980.915] (-976.981) (-977.391) (-982.385) -- 0:00:22
638000 -- (-977.934) (-978.985) (-978.987) [-981.581] * (-978.905) (-979.879) [-980.011] (-977.878) -- 0:00:22
638500 -- (-978.280) (-978.720) (-979.040) [-980.847] * (-977.875) (-979.621) [-981.371] (-978.866) -- 0:00:22
639000 -- (-977.649) (-981.306) [-979.110] (-978.538) * [-977.431] (-977.308) (-978.142) (-978.154) -- 0:00:22
639500 -- (-978.430) [-980.625] (-979.388) (-987.956) * (-978.643) (-980.279) [-980.215] (-986.376) -- 0:00:21
640000 -- [-978.081] (-979.860) (-981.843) (-981.303) * (-978.412) (-979.389) (-978.395) [-982.165] -- 0:00:21
Average standard deviation of split frequencies: 0.008397
640500 -- (-977.625) (-978.938) (-986.422) [-978.642] * (-978.491) [-979.456] (-978.588) (-980.025) -- 0:00:21
641000 -- [-977.078] (-976.764) (-978.386) (-978.728) * (-978.290) (-982.779) (-978.382) [-985.036] -- 0:00:21
641500 -- (-979.056) (-983.778) (-983.722) [-977.206] * (-980.282) (-980.322) (-981.356) [-980.588] -- 0:00:21
642000 -- (-979.814) [-979.097] (-982.634) (-977.394) * (-981.252) (-977.414) [-977.126] (-979.463) -- 0:00:21
642500 -- (-983.759) [-978.838] (-979.115) (-979.035) * (-980.105) [-976.822] (-979.395) (-980.582) -- 0:00:21
643000 -- (-979.054) (-981.090) [-979.640] (-977.251) * [-979.895] (-979.912) (-979.697) (-981.139) -- 0:00:21
643500 -- [-978.719] (-981.489) (-978.998) (-978.079) * [-980.645] (-981.576) (-979.144) (-977.557) -- 0:00:21
644000 -- (-977.651) (-982.185) [-979.139] (-977.079) * (-981.540) [-978.491] (-978.982) (-977.552) -- 0:00:21
644500 -- (-979.778) (-979.741) [-981.979] (-979.514) * (-980.220) (-980.573) [-980.233] (-977.330) -- 0:00:21
645000 -- (-981.241) (-977.824) [-981.321] (-977.309) * (-980.207) (-979.730) (-978.510) [-980.920] -- 0:00:22
Average standard deviation of split frequencies: 0.008255
645500 -- [-978.749] (-983.926) (-981.714) (-978.280) * (-978.617) (-980.416) (-978.585) [-979.186] -- 0:00:21
646000 -- [-981.717] (-978.210) (-982.469) (-981.228) * (-981.612) (-980.426) (-978.753) [-978.655] -- 0:00:21
646500 -- (-979.519) [-977.360] (-980.469) (-980.992) * [-980.850] (-983.885) (-980.305) (-981.302) -- 0:00:21
647000 -- (-978.451) (-978.866) (-982.647) [-978.544] * (-984.254) (-978.863) [-978.244] (-982.299) -- 0:00:21
647500 -- [-978.216] (-979.806) (-980.227) (-977.327) * [-979.694] (-978.334) (-978.975) (-978.229) -- 0:00:21
648000 -- (-978.210) (-977.886) (-978.660) [-978.733] * (-980.138) (-977.822) [-977.422] (-977.600) -- 0:00:21
648500 -- (-977.596) [-978.139] (-981.790) (-978.247) * (-979.468) (-978.094) [-981.112] (-981.021) -- 0:00:21
649000 -- (-978.369) (-979.934) [-979.474] (-978.835) * (-978.363) (-982.162) [-977.171] (-977.296) -- 0:00:21
649500 -- (-980.305) (-979.809) [-977.636] (-979.466) * [-979.550] (-986.102) (-977.065) (-981.503) -- 0:00:21
650000 -- (-979.282) (-977.233) [-980.625] (-978.123) * [-979.212] (-980.058) (-978.571) (-980.780) -- 0:00:21
Average standard deviation of split frequencies: 0.007562
650500 -- (-979.682) (-977.217) [-977.954] (-977.999) * (-981.231) (-979.730) (-981.473) [-980.272] -- 0:00:21
651000 -- (-978.422) [-978.543] (-977.708) (-984.537) * (-979.578) (-978.114) [-979.389] (-979.216) -- 0:00:21
651500 -- (-979.604) [-980.720] (-977.431) (-979.367) * (-980.308) (-977.421) [-978.069] (-978.545) -- 0:00:21
652000 -- (-979.357) (-977.727) (-977.407) [-978.985] * (-980.275) (-977.456) [-977.302] (-979.334) -- 0:00:21
652500 -- (-979.277) (-980.629) (-979.446) [-978.112] * (-977.825) (-979.228) [-978.655] (-977.933) -- 0:00:21
653000 -- (-979.578) (-980.243) [-978.743] (-979.199) * (-978.266) (-979.547) [-979.113] (-979.375) -- 0:00:21
653500 -- (-978.249) (-984.367) [-983.545] (-977.442) * [-981.385] (-978.705) (-978.622) (-977.033) -- 0:00:21
654000 -- [-981.033] (-983.725) (-982.808) (-978.159) * (-979.485) (-978.913) [-978.495] (-978.196) -- 0:00:21
654500 -- (-979.291) (-987.029) (-980.006) [-977.783] * (-981.705) [-978.773] (-980.878) (-977.607) -- 0:00:21
655000 -- [-981.415] (-980.353) (-981.728) (-979.451) * (-980.222) (-978.574) [-978.281] (-979.197) -- 0:00:21
Average standard deviation of split frequencies: 0.007411
655500 -- [-978.406] (-981.379) (-979.476) (-979.715) * [-978.006] (-982.396) (-980.886) (-977.526) -- 0:00:21
656000 -- (-978.832) (-978.449) [-980.961] (-978.666) * (-978.119) (-983.861) [-977.835] (-977.685) -- 0:00:20
656500 -- (-978.999) (-984.466) (-978.433) [-979.224] * (-980.276) (-977.753) (-978.754) [-977.829] -- 0:00:20
657000 -- (-978.567) (-980.792) [-978.259] (-979.383) * [-980.820] (-977.807) (-979.408) (-978.481) -- 0:00:20
657500 -- (-978.570) (-980.163) [-979.544] (-977.530) * (-977.146) (-981.868) [-978.431] (-980.333) -- 0:00:20
658000 -- (-979.891) (-980.111) (-979.286) [-978.779] * (-977.703) (-980.019) [-978.029] (-980.890) -- 0:00:20
658500 -- (-979.478) (-981.506) [-978.148] (-978.285) * (-978.948) (-979.291) [-977.172] (-977.275) -- 0:00:20
659000 -- (-980.765) [-980.846] (-979.531) (-979.469) * [-979.707] (-981.776) (-977.358) (-978.332) -- 0:00:20
659500 -- (-978.169) [-979.675] (-977.924) (-988.921) * [-979.776] (-979.693) (-979.630) (-978.257) -- 0:00:20
660000 -- (-978.851) (-979.603) (-980.270) [-981.880] * (-979.452) (-978.741) [-978.949] (-982.286) -- 0:00:20
Average standard deviation of split frequencies: 0.007983
660500 -- (-980.726) [-978.902] (-979.201) (-979.469) * [-981.074] (-980.715) (-978.256) (-982.163) -- 0:00:20
661000 -- (-978.724) [-978.648] (-978.831) (-983.440) * [-978.489] (-978.108) (-978.802) (-978.357) -- 0:00:20
661500 -- (-978.826) (-979.838) (-977.969) [-982.845] * (-979.158) [-980.386] (-978.103) (-978.610) -- 0:00:20
662000 -- [-979.397] (-980.059) (-977.859) (-977.539) * [-982.099] (-980.547) (-979.351) (-984.592) -- 0:00:20
662500 -- (-979.880) (-978.164) (-978.200) [-978.715] * (-981.837) (-978.220) (-977.214) [-982.580] -- 0:00:20
663000 -- (-980.373) [-978.801] (-979.483) (-982.896) * (-980.861) (-978.656) (-980.770) [-978.016] -- 0:00:20
663500 -- (-985.195) [-978.197] (-977.155) (-980.733) * (-980.677) (-979.633) [-980.053] (-977.566) -- 0:00:20
664000 -- (-981.545) [-982.651] (-977.301) (-980.387) * (-978.409) (-980.450) (-979.168) [-977.567] -- 0:00:20
664500 -- (-981.326) (-984.873) (-977.250) [-980.351] * [-979.040] (-977.824) (-981.970) (-977.527) -- 0:00:20
665000 -- (-979.963) [-978.397] (-977.417) (-980.917) * (-979.981) [-979.037] (-977.548) (-979.255) -- 0:00:20
Average standard deviation of split frequencies: 0.007828
665500 -- (-978.036) [-979.175] (-978.288) (-978.470) * (-981.380) (-978.186) [-977.593] (-979.610) -- 0:00:20
666000 -- [-977.857] (-981.453) (-981.785) (-979.971) * [-981.312] (-977.843) (-980.655) (-979.734) -- 0:00:20
666500 -- [-977.503] (-978.510) (-977.448) (-980.023) * (-977.721) (-978.486) [-979.584] (-977.936) -- 0:00:20
667000 -- (-980.895) [-978.838] (-978.306) (-979.118) * (-977.437) (-980.170) [-977.756] (-977.534) -- 0:00:20
667500 -- (-977.843) (-978.395) [-980.358] (-977.495) * (-981.531) [-977.352] (-983.354) (-977.385) -- 0:00:20
668000 -- (-981.523) (-977.848) (-987.025) [-978.829] * (-978.880) (-978.038) [-978.082] (-977.621) -- 0:00:20
668500 -- (-979.625) [-980.211] (-978.503) (-978.036) * (-980.017) (-978.231) (-978.641) [-979.574] -- 0:00:20
669000 -- (-980.033) (-979.255) (-981.692) [-978.664] * (-979.240) (-979.062) [-977.982] (-979.026) -- 0:00:20
669500 -- [-980.873] (-978.589) (-978.762) (-980.812) * (-981.598) (-981.057) [-980.865] (-979.955) -- 0:00:20
670000 -- (-979.580) (-977.950) (-980.812) [-980.749] * [-979.404] (-980.154) (-980.131) (-981.282) -- 0:00:20
Average standard deviation of split frequencies: 0.007908
670500 -- [-979.701] (-984.761) (-978.954) (-981.517) * (-982.299) (-977.497) (-981.532) [-979.677] -- 0:00:20
671000 -- (-978.721) (-980.602) (-981.786) [-980.877] * [-977.208] (-978.243) (-980.185) (-977.902) -- 0:00:20
671500 -- (-978.929) (-978.485) (-980.685) [-981.815] * [-977.103] (-981.433) (-979.501) (-978.041) -- 0:00:20
672000 -- (-979.062) (-977.711) [-985.334] (-981.223) * [-978.625] (-978.607) (-978.437) (-979.429) -- 0:00:20
672500 -- (-979.524) (-977.974) [-978.958] (-978.831) * (-987.400) (-978.688) [-977.783] (-979.253) -- 0:00:19
673000 -- (-979.658) (-978.712) (-977.560) [-978.307] * (-981.093) (-978.240) (-978.605) [-980.290] -- 0:00:19
673500 -- (-978.551) (-979.798) (-983.709) [-977.254] * (-983.506) [-978.481] (-978.174) (-979.375) -- 0:00:19
674000 -- [-980.555] (-981.774) (-983.020) (-978.376) * (-976.864) [-977.396] (-978.870) (-978.226) -- 0:00:19
674500 -- (-980.467) (-979.047) [-977.157] (-980.084) * (-977.906) [-977.381] (-980.762) (-978.372) -- 0:00:19
675000 -- (-978.449) (-980.163) (-981.281) [-978.112] * [-977.863] (-977.974) (-984.778) (-979.324) -- 0:00:19
Average standard deviation of split frequencies: 0.008532
675500 -- (-979.291) [-977.799] (-977.886) (-978.126) * (-979.291) (-977.494) (-984.243) [-984.717] -- 0:00:19
676000 -- (-981.038) [-978.457] (-978.714) (-979.269) * [-978.825] (-977.954) (-984.254) (-977.264) -- 0:00:19
676500 -- [-980.757] (-978.695) (-978.851) (-978.456) * (-979.372) (-980.983) (-979.639) [-980.163] -- 0:00:19
677000 -- (-979.769) [-979.665] (-978.489) (-979.082) * [-979.335] (-979.054) (-979.864) (-977.638) -- 0:00:19
677500 -- (-979.369) (-980.585) (-980.006) [-977.415] * (-979.916) (-978.260) (-979.385) [-976.879] -- 0:00:19
678000 -- [-980.411] (-979.226) (-979.625) (-981.446) * [-976.717] (-979.576) (-978.413) (-977.642) -- 0:00:19
678500 -- (-981.186) (-980.086) (-979.587) [-980.035] * (-976.899) (-979.522) (-977.891) [-978.790] -- 0:00:19
679000 -- (-977.853) (-977.161) [-978.275] (-979.617) * (-977.460) (-978.832) [-979.319] (-979.518) -- 0:00:19
679500 -- (-977.735) (-977.633) (-981.816) [-979.376] * [-976.773] (-980.886) (-979.023) (-979.348) -- 0:00:19
680000 -- (-979.698) (-979.856) [-979.802] (-981.236) * (-978.841) [-979.623] (-977.809) (-982.489) -- 0:00:19
Average standard deviation of split frequencies: 0.008527
680500 -- (-978.191) (-978.526) [-981.476] (-979.391) * (-979.290) (-980.489) [-977.808] (-980.802) -- 0:00:19
681000 -- [-977.368] (-977.771) (-980.811) (-979.219) * (-979.118) (-981.750) [-977.570] (-983.010) -- 0:00:19
681500 -- (-979.721) (-977.306) (-979.358) [-977.778] * (-978.815) [-979.277] (-978.995) (-979.479) -- 0:00:19
682000 -- [-980.500] (-977.605) (-982.052) (-980.778) * (-978.557) (-980.481) [-980.177] (-978.162) -- 0:00:19
682500 -- (-977.046) (-978.353) [-980.169] (-984.269) * (-980.801) [-982.727] (-981.568) (-977.562) -- 0:00:19
683000 -- [-977.517] (-979.092) (-981.402) (-978.344) * [-978.956] (-977.465) (-981.148) (-978.214) -- 0:00:19
683500 -- (-981.604) (-980.575) (-980.989) [-977.156] * (-978.764) (-979.108) [-977.756] (-977.783) -- 0:00:19
684000 -- (-979.444) (-980.259) (-980.793) [-978.525] * [-979.779] (-978.050) (-978.186) (-977.624) -- 0:00:19
684500 -- (-979.109) (-981.150) [-977.311] (-978.044) * [-977.561] (-979.110) (-979.615) (-979.301) -- 0:00:19
685000 -- (-976.809) (-979.743) [-978.373] (-977.135) * (-978.707) (-980.194) (-978.374) [-978.828] -- 0:00:19
Average standard deviation of split frequencies: 0.008812
685500 -- (-981.523) (-977.677) (-980.150) [-977.135] * (-979.475) (-978.225) [-978.731] (-980.294) -- 0:00:19
686000 -- (-982.365) (-978.269) (-978.989) [-977.499] * (-978.266) (-977.592) [-976.981] (-979.312) -- 0:00:19
686500 -- [-977.745] (-978.228) (-980.673) (-981.484) * (-981.105) (-980.530) [-977.201] (-978.198) -- 0:00:19
687000 -- (-978.286) (-977.330) [-979.609] (-982.767) * (-979.264) (-978.452) [-979.119] (-980.311) -- 0:00:19
687500 -- (-979.443) (-977.196) (-980.068) [-977.075] * (-981.745) [-979.854] (-980.170) (-979.397) -- 0:00:19
688000 -- (-982.010) [-978.475] (-978.228) (-977.949) * (-979.627) (-978.186) [-979.341] (-979.214) -- 0:00:19
688500 -- [-978.394] (-978.100) (-977.796) (-982.183) * (-979.792) (-980.147) [-977.985] (-979.703) -- 0:00:19
689000 -- (-982.352) (-978.771) [-980.501] (-981.987) * (-980.973) (-979.217) (-978.141) [-979.357] -- 0:00:18
689500 -- (-984.325) (-978.915) [-983.500] (-978.543) * (-978.136) [-977.798] (-977.516) (-983.929) -- 0:00:18
690000 -- (-978.364) (-978.367) [-980.403] (-979.595) * (-982.470) (-977.792) (-979.104) [-978.459] -- 0:00:18
Average standard deviation of split frequencies: 0.008351
690500 -- (-977.540) (-977.682) [-981.094] (-977.098) * (-981.077) [-978.500] (-980.998) (-977.631) -- 0:00:18
691000 -- (-980.147) (-983.057) (-980.584) [-979.146] * (-978.395) (-979.972) [-978.529] (-977.268) -- 0:00:18
691500 -- (-978.269) [-981.656] (-978.263) (-980.102) * (-979.635) (-981.623) [-979.924] (-981.115) -- 0:00:18
692000 -- (-977.356) (-982.337) [-977.656] (-981.357) * (-980.908) (-978.853) [-977.624] (-979.716) -- 0:00:18
692500 -- (-978.068) [-981.406] (-979.068) (-977.230) * (-979.906) (-978.382) [-977.732] (-979.776) -- 0:00:18
693000 -- (-984.087) [-982.218] (-977.942) (-978.488) * (-977.694) [-982.032] (-980.293) (-982.736) -- 0:00:18
693500 -- (-979.416) (-980.826) [-978.462] (-981.064) * (-978.361) (-978.326) [-980.617] (-978.394) -- 0:00:18
694000 -- [-977.267] (-980.570) (-980.117) (-978.823) * [-978.646] (-981.595) (-981.002) (-979.884) -- 0:00:18
694500 -- (-977.626) [-981.592] (-979.093) (-979.532) * (-979.329) (-979.864) (-981.082) [-978.594] -- 0:00:18
695000 -- (-979.017) (-980.329) [-978.380] (-978.484) * (-982.207) [-981.198] (-978.319) (-977.880) -- 0:00:18
Average standard deviation of split frequencies: 0.008606
695500 -- (-977.729) (-981.403) (-979.288) [-979.842] * (-982.378) (-977.929) (-978.978) [-977.467] -- 0:00:18
696000 -- (-977.324) (-979.300) [-978.993] (-979.916) * [-977.801] (-977.010) (-978.272) (-978.411) -- 0:00:18
696500 -- [-977.552] (-980.354) (-979.489) (-979.653) * (-980.164) (-978.148) [-977.398] (-979.182) -- 0:00:18
697000 -- (-978.749) (-978.764) (-980.272) [-977.978] * (-981.687) (-977.178) (-977.367) [-978.233] -- 0:00:18
697500 -- (-978.374) [-979.360] (-978.116) (-981.569) * (-980.012) (-979.007) (-978.379) [-976.840] -- 0:00:18
698000 -- (-978.654) (-978.096) [-981.263] (-977.891) * (-978.958) [-978.773] (-978.852) (-976.858) -- 0:00:18
698500 -- (-979.859) (-980.316) [-984.068] (-977.657) * (-977.879) [-978.019] (-980.259) (-981.157) -- 0:00:18
699000 -- (-979.362) (-977.123) (-981.547) [-977.233] * (-979.556) (-979.617) [-979.219] (-980.138) -- 0:00:18
699500 -- (-978.477) [-978.837] (-982.021) (-977.424) * (-979.746) (-980.743) [-977.155] (-978.722) -- 0:00:18
700000 -- (-977.648) (-979.112) [-980.434] (-978.718) * (-981.980) [-977.634] (-977.672) (-980.940) -- 0:00:18
Average standard deviation of split frequencies: 0.008232
700500 -- (-978.383) [-977.965] (-978.027) (-979.100) * (-980.280) [-977.447] (-979.947) (-977.558) -- 0:00:18
701000 -- [-977.951] (-979.817) (-981.892) (-980.334) * (-981.187) [-979.633] (-979.451) (-979.320) -- 0:00:18
701500 -- [-980.227] (-980.650) (-979.812) (-980.641) * (-978.951) [-982.714] (-980.114) (-979.331) -- 0:00:18
702000 -- (-981.356) (-978.157) [-977.905] (-978.465) * [-978.622] (-979.291) (-980.571) (-978.988) -- 0:00:18
702500 -- (-977.863) (-980.920) (-977.433) [-979.398] * (-977.582) (-977.777) (-978.024) [-982.094] -- 0:00:18
703000 -- (-977.736) (-981.776) (-980.525) [-981.180] * (-977.418) (-979.060) [-978.689] (-985.096) -- 0:00:18
703500 -- (-978.523) (-984.599) [-978.272] (-978.277) * (-979.506) (-977.472) (-977.250) [-986.588] -- 0:00:18
704000 -- [-980.851] (-983.484) (-980.574) (-977.768) * (-982.028) [-977.237] (-978.260) (-979.622) -- 0:00:18
704500 -- (-979.690) (-982.629) (-979.358) [-978.024] * (-978.680) (-977.237) (-978.377) [-979.308] -- 0:00:18
705000 -- (-979.336) [-978.134] (-979.201) (-978.771) * (-980.284) [-977.692] (-978.972) (-977.519) -- 0:00:17
Average standard deviation of split frequencies: 0.008287
705500 -- (-977.701) (-977.131) [-978.896] (-979.475) * [-979.846] (-981.388) (-978.538) (-978.619) -- 0:00:17
706000 -- (-984.084) [-978.149] (-978.385) (-979.073) * [-979.968] (-983.194) (-980.268) (-978.680) -- 0:00:17
706500 -- (-980.436) (-978.731) [-979.711] (-978.129) * (-985.583) (-979.667) [-980.171] (-980.682) -- 0:00:17
707000 -- (-980.390) (-979.311) (-977.586) [-979.291] * (-991.601) (-979.478) (-979.230) [-981.223] -- 0:00:17
707500 -- (-981.232) [-978.932] (-979.038) (-978.229) * [-979.535] (-978.455) (-977.691) (-981.491) -- 0:00:17
708000 -- (-977.079) [-980.549] (-981.439) (-979.584) * (-977.977) [-980.522] (-978.138) (-980.140) -- 0:00:17
708500 -- [-977.262] (-977.991) (-981.647) (-977.018) * [-979.105] (-979.766) (-979.077) (-980.975) -- 0:00:17
709000 -- (-977.756) (-978.164) (-979.437) [-981.515] * [-980.102] (-982.175) (-981.234) (-980.203) -- 0:00:17
709500 -- (-983.955) (-980.337) (-978.039) [-977.708] * (-981.770) [-978.848] (-979.037) (-978.713) -- 0:00:17
710000 -- (-979.179) [-980.291] (-978.713) (-980.566) * (-980.889) [-977.573] (-978.875) (-980.382) -- 0:00:17
Average standard deviation of split frequencies: 0.008540
710500 -- [-977.499] (-979.483) (-978.674) (-978.207) * (-979.268) (-978.786) (-978.106) [-978.715] -- 0:00:17
711000 -- (-977.497) (-980.635) [-980.034] (-978.102) * (-980.854) (-980.159) [-981.401] (-979.391) -- 0:00:17
711500 -- (-979.999) (-979.996) (-977.775) [-977.760] * (-980.012) (-979.806) (-980.202) [-978.849] -- 0:00:17
712000 -- (-979.042) (-983.645) [-981.294] (-978.785) * (-980.103) [-977.677] (-979.150) (-980.809) -- 0:00:17
712500 -- (-981.752) [-980.708] (-981.848) (-979.070) * (-977.131) [-978.217] (-981.642) (-979.223) -- 0:00:17
713000 -- (-978.248) [-980.960] (-979.149) (-980.554) * (-978.442) (-980.478) [-977.667] (-977.191) -- 0:00:17
713500 -- (-979.351) (-979.293) [-979.794] (-980.105) * (-979.728) [-978.384] (-977.574) (-977.417) -- 0:00:17
714000 -- (-980.002) [-978.256] (-981.326) (-977.247) * (-977.468) (-980.137) (-978.540) [-977.780] -- 0:00:17
714500 -- (-982.177) [-977.528] (-979.631) (-978.848) * [-977.204] (-977.839) (-981.029) (-977.160) -- 0:00:17
715000 -- (-979.792) [-977.536] (-981.788) (-977.979) * [-977.589] (-978.684) (-979.265) (-979.403) -- 0:00:17
Average standard deviation of split frequencies: 0.008765
715500 -- [-983.054] (-978.934) (-977.633) (-977.089) * [-977.990] (-979.171) (-978.348) (-979.487) -- 0:00:17
716000 -- [-981.786] (-977.146) (-977.533) (-980.085) * (-979.273) [-977.648] (-980.490) (-977.290) -- 0:00:17
716500 -- [-979.326] (-977.679) (-978.516) (-980.334) * (-983.248) (-979.602) (-982.294) [-979.599] -- 0:00:17
717000 -- [-982.212] (-979.144) (-981.248) (-981.247) * (-979.815) (-981.663) [-980.625] (-977.567) -- 0:00:17
717500 -- (-977.759) (-979.390) [-978.858] (-979.949) * (-978.965) (-981.324) [-977.806] (-979.122) -- 0:00:17
718000 -- (-978.724) (-978.558) (-979.512) [-978.502] * (-981.008) [-979.541] (-977.718) (-984.465) -- 0:00:17
718500 -- (-979.675) [-980.485] (-982.051) (-980.351) * (-979.500) (-981.552) [-978.732] (-978.536) -- 0:00:17
719000 -- (-979.625) (-977.863) (-979.549) [-977.417] * [-978.673] (-981.634) (-979.556) (-977.398) -- 0:00:17
719500 -- (-978.048) [-978.254] (-978.885) (-979.318) * (-978.928) [-981.894] (-981.974) (-978.355) -- 0:00:17
720000 -- (-978.567) (-981.512) [-978.885] (-977.438) * (-977.775) (-977.410) (-980.453) [-978.516] -- 0:00:17
Average standard deviation of split frequencies: 0.008667
720500 -- (-980.976) (-978.476) [-976.901] (-977.619) * [-980.916] (-977.449) (-978.910) (-981.543) -- 0:00:17
721000 -- (-978.756) [-978.625] (-977.888) (-976.839) * (-977.219) (-976.914) (-979.090) [-980.944] -- 0:00:17
721500 -- (-978.710) (-979.923) (-979.370) [-979.580] * (-978.118) (-976.908) (-981.838) [-980.821] -- 0:00:16
722000 -- [-978.878] (-977.286) (-980.943) (-981.997) * (-978.472) (-976.755) (-977.614) [-977.600] -- 0:00:16
722500 -- (-978.187) (-977.553) (-980.110) [-980.444] * (-977.270) [-977.223] (-977.629) (-977.138) -- 0:00:16
723000 -- (-982.671) (-977.410) (-979.490) [-978.128] * (-978.682) [-977.590] (-979.810) (-977.967) -- 0:00:16
723500 -- (-981.926) (-980.237) (-980.914) [-977.384] * (-977.638) (-982.065) (-980.562) [-981.332] -- 0:00:16
724000 -- (-978.430) (-979.683) (-978.536) [-978.522] * (-978.685) [-977.189] (-978.570) (-977.668) -- 0:00:16
724500 -- (-979.289) [-978.161] (-978.255) (-980.815) * (-980.154) [-980.453] (-976.850) (-980.535) -- 0:00:16
725000 -- [-980.070] (-978.555) (-978.029) (-980.392) * (-979.303) (-977.662) (-976.838) [-979.703] -- 0:00:16
Average standard deviation of split frequencies: 0.008725
725500 -- [-979.824] (-978.745) (-977.741) (-987.099) * (-980.330) (-978.767) (-979.115) [-977.121] -- 0:00:16
726000 -- (-977.445) [-978.385] (-978.236) (-977.756) * (-979.150) (-979.082) (-978.472) [-977.620] -- 0:00:16
726500 -- [-980.498] (-979.822) (-978.587) (-982.086) * (-980.534) (-977.546) [-979.607] (-977.100) -- 0:00:16
727000 -- (-984.001) (-978.999) [-978.666] (-978.474) * [-980.456] (-981.728) (-976.868) (-977.227) -- 0:00:16
727500 -- (-980.694) [-982.791] (-983.792) (-980.110) * (-977.478) (-979.676) (-980.661) [-977.227] -- 0:00:16
728000 -- (-983.533) (-977.976) [-981.994] (-980.494) * [-977.550] (-980.105) (-984.741) (-977.478) -- 0:00:16
728500 -- (-981.107) (-977.534) [-977.716] (-981.994) * (-977.516) (-981.310) (-986.069) [-977.862] -- 0:00:16
729000 -- (-978.687) (-980.600) (-977.608) [-980.324] * (-978.643) (-981.243) (-986.269) [-978.625] -- 0:00:16
729500 -- [-980.695] (-978.995) (-977.645) (-979.832) * (-978.510) (-978.139) [-979.995] (-979.835) -- 0:00:16
730000 -- (-977.723) [-980.040] (-979.836) (-978.137) * (-978.501) (-977.488) [-979.132] (-977.009) -- 0:00:16
Average standard deviation of split frequencies: 0.008508
730500 -- (-977.508) (-980.912) [-980.567] (-980.281) * (-981.146) [-977.049] (-978.663) (-977.320) -- 0:00:16
731000 -- (-980.837) (-977.765) (-977.712) [-978.801] * (-980.464) [-978.184] (-979.097) (-978.621) -- 0:00:16
731500 -- [-980.430] (-980.899) (-979.944) (-978.628) * (-979.381) [-979.495] (-978.583) (-978.613) -- 0:00:16
732000 -- (-979.471) [-977.126] (-978.189) (-978.241) * (-977.769) (-978.128) [-977.237] (-978.828) -- 0:00:16
732500 -- (-979.772) (-976.870) (-980.994) [-978.116] * (-977.419) (-977.772) [-976.801] (-979.816) -- 0:00:16
733000 -- (-980.334) (-984.199) (-979.370) [-980.195] * (-977.928) (-978.659) (-980.980) [-977.494] -- 0:00:16
733500 -- (-980.400) (-979.951) (-980.422) [-980.903] * (-978.042) [-977.448] (-980.042) (-979.838) -- 0:00:16
734000 -- (-978.170) (-980.681) (-982.522) [-982.233] * (-978.358) (-977.242) [-979.270] (-977.665) -- 0:00:16
734500 -- (-979.538) (-978.993) (-980.578) [-979.645] * (-977.691) (-978.970) [-978.066] (-977.284) -- 0:00:16
735000 -- (-978.032) [-977.756] (-980.856) (-977.725) * (-977.820) [-978.333] (-978.041) (-978.941) -- 0:00:16
Average standard deviation of split frequencies: 0.008687
735500 -- (-981.342) (-978.762) [-978.915] (-980.441) * [-979.529] (-978.737) (-978.598) (-982.067) -- 0:00:16
736000 -- (-978.127) (-981.934) [-978.944] (-978.501) * (-980.881) [-978.247] (-978.600) (-982.710) -- 0:00:16
736500 -- (-980.227) [-980.345] (-980.983) (-978.039) * (-981.081) [-977.123] (-978.546) (-986.084) -- 0:00:16
737000 -- (-983.239) (-982.384) (-985.563) [-982.811] * (-979.242) (-980.600) (-978.667) [-980.763] -- 0:00:16
737500 -- [-982.159] (-980.667) (-983.593) (-979.371) * (-982.097) (-979.374) (-977.707) [-981.318] -- 0:00:16
738000 -- [-979.467] (-978.592) (-980.575) (-978.022) * (-977.419) [-980.017] (-977.688) (-978.697) -- 0:00:15
738500 -- (-982.209) (-978.774) [-979.801] (-980.290) * (-977.835) [-978.836] (-977.576) (-977.583) -- 0:00:15
739000 -- [-979.284] (-979.991) (-978.157) (-978.568) * (-982.234) (-979.843) (-982.303) [-978.026] -- 0:00:15
739500 -- (-978.445) [-979.046] (-984.675) (-980.619) * (-979.600) (-978.291) (-980.980) [-979.376] -- 0:00:15
740000 -- (-980.741) (-979.549) [-979.716] (-980.494) * (-980.478) (-978.623) (-980.789) [-978.377] -- 0:00:15
Average standard deviation of split frequencies: 0.008393
740500 -- [-978.297] (-980.770) (-981.234) (-979.566) * [-980.088] (-980.054) (-983.402) (-979.480) -- 0:00:15
741000 -- [-979.195] (-979.836) (-977.756) (-978.057) * (-982.837) [-980.170] (-987.923) (-978.982) -- 0:00:15
741500 -- (-978.966) [-981.062] (-977.460) (-978.237) * [-980.609] (-981.349) (-979.561) (-979.162) -- 0:00:15
742000 -- [-977.651] (-978.925) (-978.904) (-977.895) * (-983.411) [-978.518] (-977.492) (-979.321) -- 0:00:15
742500 -- (-977.851) (-978.700) [-980.818] (-977.630) * (-980.854) [-979.695] (-977.988) (-978.804) -- 0:00:15
743000 -- (-980.134) (-976.979) (-978.263) [-978.691] * [-980.528] (-977.917) (-977.988) (-979.471) -- 0:00:15
743500 -- [-981.722] (-981.666) (-978.758) (-981.602) * (-978.621) [-978.299] (-978.530) (-981.774) -- 0:00:15
744000 -- [-976.812] (-977.043) (-977.895) (-980.806) * (-977.415) (-978.692) (-979.217) [-978.356] -- 0:00:15
744500 -- (-980.722) (-983.277) (-980.751) [-978.886] * (-977.416) [-978.568] (-978.694) (-977.563) -- 0:00:15
745000 -- (-977.112) (-979.594) [-977.332] (-977.342) * (-977.498) [-981.146] (-981.557) (-980.295) -- 0:00:15
Average standard deviation of split frequencies: 0.008570
745500 -- (-978.903) [-979.461] (-977.588) (-977.341) * [-979.819] (-980.737) (-980.174) (-980.158) -- 0:00:15
746000 -- [-978.339] (-980.688) (-980.349) (-977.345) * [-979.859] (-979.044) (-979.626) (-979.810) -- 0:00:15
746500 -- (-977.516) [-981.416] (-978.038) (-987.566) * [-978.575] (-978.605) (-978.922) (-976.737) -- 0:00:15
747000 -- (-978.707) (-979.598) [-977.511] (-981.046) * (-977.004) [-976.841] (-982.134) (-976.765) -- 0:00:15
747500 -- (-984.732) [-978.630] (-980.297) (-980.231) * [-978.687] (-977.753) (-983.006) (-977.542) -- 0:00:15
748000 -- (-984.996) (-977.748) (-980.243) [-978.388] * (-979.576) (-978.793) (-983.207) [-977.607] -- 0:00:15
748500 -- (-977.745) (-977.128) [-982.622] (-986.331) * (-981.159) (-979.487) (-980.970) [-978.643] -- 0:00:15
749000 -- (-977.049) (-978.168) (-978.860) [-977.931] * [-978.737] (-981.913) (-979.515) (-978.139) -- 0:00:15
749500 -- (-982.936) (-977.061) (-979.397) [-978.074] * [-979.054] (-980.403) (-979.118) (-978.798) -- 0:00:15
750000 -- (-984.726) (-977.899) [-977.700] (-979.730) * (-981.207) [-978.067] (-979.986) (-977.984) -- 0:00:15
Average standard deviation of split frequencies: 0.008085
750500 -- (-981.754) (-979.297) (-979.105) [-979.733] * [-982.505] (-978.471) (-979.826) (-979.387) -- 0:00:15
751000 -- [-979.769] (-978.748) (-979.203) (-978.848) * (-979.624) [-978.659] (-979.357) (-980.614) -- 0:00:15
751500 -- [-978.461] (-979.170) (-979.781) (-977.134) * (-980.290) [-977.118] (-980.933) (-980.112) -- 0:00:15
752000 -- (-979.759) (-976.905) [-978.340] (-977.655) * (-978.524) (-979.272) (-977.853) [-977.414] -- 0:00:15
752500 -- (-980.789) (-981.612) (-979.942) [-978.418] * (-981.347) (-982.983) (-977.257) [-978.470] -- 0:00:15
753000 -- (-978.508) (-978.305) [-977.979] (-977.864) * (-979.617) (-977.342) [-977.094] (-977.591) -- 0:00:15
753500 -- [-978.838] (-978.223) (-977.477) (-978.177) * [-980.393] (-978.099) (-978.646) (-977.951) -- 0:00:15
754000 -- (-978.155) (-979.979) [-978.441] (-977.903) * (-980.904) (-978.293) [-978.018] (-978.390) -- 0:00:15
754500 -- [-978.480] (-978.165) (-980.595) (-976.944) * (-981.240) (-980.785) (-979.524) [-979.734] -- 0:00:14
755000 -- (-982.008) [-978.698] (-977.828) (-977.812) * (-978.806) (-978.422) [-979.366] (-980.611) -- 0:00:14
Average standard deviation of split frequencies: 0.008067
755500 -- [-977.852] (-979.543) (-979.763) (-977.687) * [-980.685] (-983.333) (-977.004) (-978.646) -- 0:00:14
756000 -- (-978.320) (-979.095) [-978.953] (-979.832) * (-977.970) [-981.879] (-976.778) (-978.067) -- 0:00:14
756500 -- (-986.805) (-979.156) (-980.532) [-979.333] * [-978.471] (-981.915) (-977.882) (-980.454) -- 0:00:14
757000 -- (-982.575) [-980.356] (-978.985) (-978.881) * (-978.426) (-977.810) (-978.919) [-979.169] -- 0:00:14
757500 -- (-979.923) [-978.068] (-979.151) (-981.125) * (-982.018) [-977.408] (-980.715) (-978.491) -- 0:00:14
758000 -- (-977.028) (-984.302) (-980.188) [-978.918] * [-982.433] (-978.748) (-980.528) (-977.805) -- 0:00:14
758500 -- (-978.398) (-979.949) (-981.557) [-978.061] * (-978.595) (-978.927) [-977.799] (-977.299) -- 0:00:14
759000 -- (-979.542) (-979.667) [-978.332] (-978.923) * (-979.466) [-979.111] (-985.139) (-978.183) -- 0:00:14
759500 -- (-982.843) (-978.944) [-978.122] (-980.335) * (-977.845) [-977.019] (-980.408) (-977.103) -- 0:00:14
760000 -- (-978.018) (-982.718) [-977.886] (-980.138) * (-980.764) [-981.081] (-982.148) (-978.724) -- 0:00:14
Average standard deviation of split frequencies: 0.007979
760500 -- [-980.589] (-980.365) (-983.542) (-978.143) * [-977.936] (-979.638) (-981.911) (-979.496) -- 0:00:14
761000 -- (-977.922) (-980.036) [-977.385] (-979.879) * [-976.851] (-979.344) (-978.926) (-983.241) -- 0:00:14
761500 -- (-980.290) (-980.042) (-979.367) [-977.756] * (-979.396) [-980.723] (-977.591) (-982.219) -- 0:00:14
762000 -- [-979.795] (-978.263) (-978.178) (-977.064) * [-982.777] (-981.470) (-978.028) (-979.136) -- 0:00:14
762500 -- [-982.622] (-979.957) (-978.959) (-978.026) * [-982.140] (-977.934) (-981.244) (-978.297) -- 0:00:14
763000 -- (-980.501) (-977.104) (-981.476) [-980.597] * [-978.076] (-979.286) (-978.050) (-981.309) -- 0:00:14
763500 -- (-982.634) (-978.900) (-978.872) [-977.457] * (-977.587) (-977.902) [-978.432] (-983.877) -- 0:00:14
764000 -- [-982.267] (-980.160) (-977.329) (-980.557) * (-978.304) (-976.874) [-980.240] (-981.311) -- 0:00:14
764500 -- [-983.876] (-982.399) (-979.177) (-981.466) * [-980.845] (-980.933) (-982.149) (-983.650) -- 0:00:14
765000 -- (-980.701) [-982.057] (-977.742) (-977.988) * [-978.340] (-978.536) (-980.549) (-980.959) -- 0:00:14
Average standard deviation of split frequencies: 0.007770
765500 -- (-979.290) (-981.203) (-978.557) [-976.745] * (-977.101) [-977.410] (-980.790) (-979.307) -- 0:00:14
766000 -- (-981.756) (-984.040) [-978.949] (-982.928) * (-979.125) [-978.093] (-980.039) (-979.715) -- 0:00:14
766500 -- (-978.346) (-978.207) [-977.439] (-980.650) * [-978.162] (-979.702) (-979.160) (-982.384) -- 0:00:14
767000 -- [-978.714] (-977.906) (-980.393) (-977.440) * [-981.596] (-979.311) (-985.698) (-982.304) -- 0:00:14
767500 -- (-986.118) (-977.526) [-976.979] (-976.831) * (-980.002) [-978.016] (-978.536) (-984.103) -- 0:00:14
768000 -- (-981.442) (-978.057) [-978.572] (-977.212) * (-978.054) [-978.130] (-978.612) (-979.993) -- 0:00:14
768500 -- (-980.927) [-981.409] (-979.032) (-977.758) * (-980.721) (-978.445) [-977.973] (-978.543) -- 0:00:14
769000 -- (-981.680) [-977.645] (-979.992) (-982.862) * (-979.514) (-980.352) [-983.285] (-978.116) -- 0:00:14
769500 -- (-981.771) (-979.658) [-979.591] (-979.065) * (-982.035) (-978.299) (-977.138) [-977.560] -- 0:00:14
770000 -- (-980.904) (-979.167) [-977.945] (-979.043) * (-978.702) (-980.600) [-979.648] (-978.159) -- 0:00:14
Average standard deviation of split frequencies: 0.007646
770500 -- (-980.878) (-978.827) (-977.791) [-982.247] * (-981.553) [-978.161] (-981.499) (-978.089) -- 0:00:13
771000 -- (-978.841) (-980.898) (-977.726) [-979.138] * (-981.054) (-981.865) (-979.177) [-979.399] -- 0:00:13
771500 -- [-981.022] (-981.132) (-980.149) (-983.991) * (-979.291) (-978.111) (-979.361) [-980.727] -- 0:00:13
772000 -- [-977.442] (-978.195) (-979.180) (-978.185) * [-978.182] (-980.802) (-982.313) (-980.620) -- 0:00:13
772500 -- (-978.902) [-977.546] (-978.417) (-977.935) * (-977.783) (-978.579) (-976.803) [-982.841] -- 0:00:13
773000 -- (-979.784) (-977.710) (-977.358) [-981.153] * (-977.907) (-978.768) (-979.344) [-978.891] -- 0:00:13
773500 -- (-981.396) [-977.457] (-977.828) (-977.499) * [-978.236] (-980.765) (-979.584) (-978.868) -- 0:00:13
774000 -- (-979.954) (-977.153) [-977.252] (-979.204) * [-978.541] (-981.213) (-980.104) (-978.094) -- 0:00:13
774500 -- (-978.170) (-978.881) (-977.614) [-977.827] * [-980.541] (-979.319) (-978.556) (-978.348) -- 0:00:13
775000 -- (-979.961) (-980.774) (-977.666) [-983.617] * (-980.021) (-979.415) (-982.271) [-977.911] -- 0:00:13
Average standard deviation of split frequencies: 0.007669
775500 -- [-978.795] (-978.030) (-979.485) (-980.017) * (-978.069) (-980.770) [-981.490] (-978.853) -- 0:00:13
776000 -- [-982.291] (-977.670) (-978.710) (-979.856) * (-978.175) [-979.096] (-978.809) (-978.473) -- 0:00:13
776500 -- (-977.905) [-977.247] (-979.743) (-977.666) * (-978.982) (-978.457) (-979.608) [-979.566] -- 0:00:13
777000 -- (-979.075) [-980.850] (-977.657) (-982.087) * (-980.315) (-977.975) (-978.419) [-980.221] -- 0:00:13
777500 -- (-978.261) [-981.239] (-978.006) (-986.969) * [-978.430] (-977.960) (-978.246) (-981.787) -- 0:00:13
778000 -- [-977.374] (-977.546) (-977.091) (-979.166) * [-980.816] (-977.223) (-977.808) (-984.381) -- 0:00:13
778500 -- (-977.481) (-977.505) (-979.012) [-978.063] * (-982.411) [-978.213] (-979.466) (-980.137) -- 0:00:13
779000 -- [-977.888] (-978.384) (-981.449) (-979.130) * [-979.894] (-979.612) (-986.389) (-977.620) -- 0:00:13
779500 -- (-979.322) (-982.673) (-982.398) [-979.334] * [-977.334] (-982.841) (-980.020) (-978.625) -- 0:00:13
780000 -- (-979.996) [-979.062] (-979.947) (-980.674) * (-978.019) (-977.216) (-981.921) [-977.643] -- 0:00:13
Average standard deviation of split frequencies: 0.008076
780500 -- (-980.002) [-978.455] (-979.249) (-978.560) * (-979.025) (-977.305) (-979.297) [-977.813] -- 0:00:13
781000 -- (-982.382) [-977.092] (-979.554) (-980.755) * (-983.778) (-977.305) [-979.328] (-979.976) -- 0:00:13
781500 -- (-978.718) (-978.591) (-981.189) [-978.437] * [-979.047] (-977.360) (-980.622) (-978.036) -- 0:00:13
782000 -- (-978.833) [-977.397] (-979.424) (-981.155) * (-978.174) (-979.397) [-977.000] (-978.788) -- 0:00:13
782500 -- (-979.178) (-977.202) [-977.891] (-977.674) * (-982.502) (-980.199) [-979.034] (-978.953) -- 0:00:13
783000 -- (-977.350) (-980.128) (-978.449) [-976.744] * (-980.097) [-978.601] (-979.094) (-980.156) -- 0:00:13
783500 -- [-978.250] (-980.406) (-977.385) (-977.405) * (-978.352) (-979.408) (-978.707) [-984.807] -- 0:00:13
784000 -- (-979.443) (-979.737) [-977.626] (-978.621) * (-977.709) (-977.491) (-982.938) [-979.598] -- 0:00:13
784500 -- [-980.827] (-978.133) (-977.375) (-984.163) * (-977.513) [-978.211] (-978.227) (-979.320) -- 0:00:13
785000 -- [-981.019] (-977.880) (-978.486) (-982.887) * (-978.806) (-978.407) (-984.202) [-977.234] -- 0:00:13
Average standard deviation of split frequencies: 0.008247
785500 -- (-980.099) [-977.823] (-979.332) (-979.108) * [-978.970] (-980.501) (-980.443) (-977.431) -- 0:00:13
786000 -- [-979.837] (-978.639) (-980.074) (-978.484) * (-981.524) (-978.692) [-978.279] (-979.329) -- 0:00:13
786500 -- [-977.989] (-979.251) (-977.765) (-980.618) * [-979.662] (-980.397) (-978.115) (-983.477) -- 0:00:13
787000 -- (-977.089) (-977.291) [-977.170] (-977.479) * [-976.822] (-981.128) (-978.293) (-982.331) -- 0:00:12
787500 -- (-977.886) (-977.426) (-979.457) [-979.694] * (-980.383) [-979.071] (-977.207) (-980.741) -- 0:00:12
788000 -- (-977.267) [-979.949] (-981.423) (-978.540) * [-980.180] (-977.704) (-979.637) (-980.039) -- 0:00:12
788500 -- [-977.620] (-977.095) (-978.942) (-977.914) * (-978.056) (-982.362) [-978.775] (-977.869) -- 0:00:12
789000 -- (-977.959) (-977.083) (-978.939) [-978.330] * [-979.641] (-977.092) (-979.113) (-978.312) -- 0:00:12
789500 -- (-978.758) (-977.179) [-978.809] (-979.611) * (-981.680) (-978.151) (-977.985) [-980.750] -- 0:00:12
790000 -- (-980.152) [-978.053] (-978.426) (-978.021) * (-979.488) (-978.449) [-978.791] (-977.297) -- 0:00:12
Average standard deviation of split frequencies: 0.007974
790500 -- (-979.178) (-978.421) [-977.694] (-978.342) * [-978.687] (-978.675) (-979.078) (-981.468) -- 0:00:12
791000 -- [-980.508] (-978.588) (-978.317) (-981.138) * (-980.015) (-977.273) (-977.426) [-980.308] -- 0:00:12
791500 -- (-977.511) [-980.382] (-977.226) (-981.663) * (-978.694) (-980.545) (-978.238) [-977.316] -- 0:00:12
792000 -- [-977.544] (-983.011) (-978.424) (-981.810) * (-979.053) (-982.457) (-980.094) [-977.659] -- 0:00:12
792500 -- (-980.955) (-984.931) (-978.777) [-978.498] * (-982.701) (-983.192) (-979.952) [-977.475] -- 0:00:12
793000 -- (-983.776) (-980.737) (-977.721) [-978.477] * (-978.700) [-979.750] (-977.999) (-978.012) -- 0:00:12
793500 -- (-980.336) [-979.565] (-980.663) (-977.210) * (-982.531) (-978.262) (-979.983) [-978.042] -- 0:00:12
794000 -- [-979.976] (-978.277) (-978.461) (-977.108) * (-979.345) (-978.988) (-981.011) [-979.964] -- 0:00:12
794500 -- (-977.943) (-978.270) [-978.369] (-977.690) * (-978.617) (-979.362) (-979.202) [-976.892] -- 0:00:12
795000 -- (-977.982) (-980.015) (-977.842) [-978.851] * (-980.402) (-979.648) (-979.163) [-976.920] -- 0:00:12
Average standard deviation of split frequencies: 0.008032
795500 -- (-977.531) [-978.922] (-978.127) (-979.744) * (-979.696) (-979.472) (-979.371) [-980.828] -- 0:00:12
796000 -- (-979.952) [-979.057] (-981.739) (-981.019) * [-980.762] (-977.939) (-979.271) (-978.525) -- 0:00:12
796500 -- (-979.372) (-977.825) [-980.707] (-977.437) * (-977.369) [-979.145] (-978.707) (-980.688) -- 0:00:12
797000 -- [-978.955] (-978.344) (-979.876) (-978.473) * (-978.933) [-979.717] (-980.739) (-980.186) -- 0:00:12
797500 -- (-981.945) [-982.050] (-981.874) (-977.953) * (-980.211) [-977.918] (-978.493) (-980.301) -- 0:00:12
798000 -- [-983.804] (-981.269) (-978.413) (-980.508) * (-978.903) (-977.246) [-979.788] (-979.779) -- 0:00:12
798500 -- (-980.294) (-983.968) (-978.102) [-978.534] * (-982.158) (-976.963) [-981.958] (-982.562) -- 0:00:12
799000 -- (-980.420) [-976.870] (-977.880) (-979.578) * (-977.431) [-976.963] (-980.718) (-985.175) -- 0:00:12
799500 -- [-980.286] (-980.318) (-979.182) (-979.127) * (-977.622) (-977.728) [-981.046] (-981.262) -- 0:00:12
800000 -- (-977.643) (-978.720) (-979.239) [-982.135] * [-978.970] (-978.770) (-981.781) (-982.305) -- 0:00:12
Average standard deviation of split frequencies: 0.008243
800500 -- [-978.915] (-978.714) (-978.621) (-978.833) * (-977.329) [-978.301] (-977.034) (-983.015) -- 0:00:12
801000 -- (-980.510) (-981.884) [-981.407] (-978.308) * (-978.737) (-977.474) [-976.905] (-978.141) -- 0:00:12
801500 -- (-985.212) [-980.863] (-980.872) (-979.471) * [-976.938] (-977.521) (-979.775) (-981.944) -- 0:00:12
802000 -- (-981.955) [-980.992] (-980.640) (-977.347) * (-981.868) (-978.593) (-977.184) [-979.005] -- 0:00:12
802500 -- (-977.408) [-981.013] (-980.511) (-979.627) * (-980.647) [-979.024] (-979.298) (-980.838) -- 0:00:12
803000 -- (-977.317) (-984.295) [-979.300] (-981.342) * (-980.967) (-980.399) (-986.199) [-980.129] -- 0:00:12
803500 -- [-977.438] (-977.995) (-979.660) (-978.551) * (-978.093) [-980.995] (-983.600) (-977.321) -- 0:00:11
804000 -- [-980.577] (-981.161) (-983.732) (-978.235) * [-978.353] (-982.230) (-980.506) (-979.272) -- 0:00:11
804500 -- (-977.907) [-981.337] (-983.321) (-979.707) * (-977.177) [-982.266] (-978.363) (-982.318) -- 0:00:11
805000 -- (-981.122) (-978.284) (-982.041) [-977.863] * [-980.561] (-978.303) (-978.123) (-977.377) -- 0:00:11
Average standard deviation of split frequencies: 0.008016
805500 -- [-978.336] (-985.054) (-978.280) (-978.231) * (-981.745) (-977.067) (-978.682) [-982.001] -- 0:00:11
806000 -- (-979.642) [-978.799] (-979.868) (-978.662) * (-978.761) (-978.288) [-978.898] (-977.771) -- 0:00:11
806500 -- (-977.878) (-979.202) [-977.710] (-977.692) * (-978.662) [-977.872] (-978.150) (-977.540) -- 0:00:11
807000 -- (-977.454) [-979.193] (-980.818) (-980.426) * (-979.692) [-980.068] (-982.276) (-982.282) -- 0:00:11
807500 -- [-976.711] (-978.587) (-985.072) (-977.719) * (-978.448) (-978.472) [-983.372] (-980.459) -- 0:00:11
808000 -- (-976.694) [-980.319] (-983.640) (-979.612) * (-981.081) (-979.988) [-986.364] (-979.948) -- 0:00:11
808500 -- (-978.935) (-981.321) [-979.526] (-980.232) * [-977.387] (-979.784) (-980.531) (-981.785) -- 0:00:11
809000 -- (-981.023) (-978.871) (-979.671) [-979.694] * [-977.500] (-979.477) (-980.821) (-979.076) -- 0:00:11
809500 -- (-983.946) (-978.639) (-985.009) [-977.025] * [-980.486] (-977.973) (-980.862) (-977.341) -- 0:00:11
810000 -- (-981.204) (-979.603) (-980.220) [-978.543] * (-981.519) [-978.914] (-978.074) (-977.600) -- 0:00:11
Average standard deviation of split frequencies: 0.008795
810500 -- (-981.644) [-977.245] (-979.532) (-977.819) * (-980.496) (-980.857) [-979.262] (-978.391) -- 0:00:11
811000 -- [-979.827] (-977.957) (-982.964) (-977.622) * (-977.494) (-978.878) (-980.343) [-979.785] -- 0:00:11
811500 -- (-978.510) [-979.468] (-980.235) (-979.289) * (-982.001) (-978.508) (-981.462) [-978.803] -- 0:00:11
812000 -- (-978.432) (-978.750) [-978.152] (-977.251) * (-978.554) (-977.579) (-977.525) [-976.990] -- 0:00:11
812500 -- (-981.752) (-980.547) [-980.761] (-977.636) * (-979.734) (-978.373) (-981.274) [-977.278] -- 0:00:11
813000 -- (-978.575) (-978.030) (-977.006) [-980.424] * (-977.342) [-980.430] (-981.169) (-980.428) -- 0:00:11
813500 -- (-980.687) (-977.760) [-977.977] (-977.297) * (-977.110) (-981.498) [-978.162] (-979.780) -- 0:00:11
814000 -- (-978.607) (-981.436) [-978.533] (-978.159) * (-982.419) (-979.619) (-983.758) [-978.576] -- 0:00:11
814500 -- [-977.862] (-978.564) (-978.753) (-978.487) * (-978.957) [-978.992] (-978.292) (-977.009) -- 0:00:11
815000 -- (-976.905) (-977.464) [-978.507] (-978.827) * (-979.160) [-978.714] (-979.409) (-977.256) -- 0:00:11
Average standard deviation of split frequencies: 0.008704
815500 -- [-980.179] (-978.645) (-977.535) (-978.947) * (-980.828) [-979.401] (-979.517) (-982.492) -- 0:00:11
816000 -- (-984.256) (-978.356) [-978.386] (-979.004) * [-976.930] (-982.568) (-977.252) (-980.972) -- 0:00:11
816500 -- (-980.963) [-978.213] (-978.121) (-977.313) * (-978.903) [-978.568] (-978.943) (-983.534) -- 0:00:11
817000 -- (-977.757) [-980.575] (-978.124) (-977.976) * (-977.784) (-981.956) (-978.559) [-979.849] -- 0:00:11
817500 -- (-980.551) (-980.149) (-977.950) [-980.084] * (-978.484) [-979.809] (-977.088) (-978.137) -- 0:00:11
818000 -- (-979.269) [-977.532] (-977.815) (-978.279) * (-983.925) (-978.812) (-976.860) [-978.261] -- 0:00:11
818500 -- (-980.644) [-977.451] (-983.884) (-979.004) * (-979.775) (-982.968) [-980.983] (-981.035) -- 0:00:11
819000 -- (-988.403) [-981.148] (-979.205) (-979.025) * [-979.378] (-978.917) (-979.234) (-980.215) -- 0:00:11
819500 -- (-977.193) [-979.074] (-982.865) (-977.438) * (-979.013) [-979.284] (-980.136) (-978.201) -- 0:00:11
820000 -- (-980.793) (-981.167) [-978.260] (-980.695) * (-982.248) (-981.921) [-980.987] (-979.810) -- 0:00:10
Average standard deviation of split frequencies: 0.008808
820500 -- (-982.540) (-978.053) [-978.984] (-979.753) * (-980.208) (-981.083) [-983.882] (-988.035) -- 0:00:10
821000 -- [-986.303] (-978.996) (-977.684) (-979.434) * (-980.367) (-978.722) (-981.405) [-979.446] -- 0:00:10
821500 -- [-979.972] (-979.071) (-979.734) (-982.188) * [-979.353] (-979.343) (-979.770) (-982.194) -- 0:00:10
822000 -- (-977.459) (-979.167) (-978.887) [-977.002] * [-978.285] (-979.327) (-980.074) (-979.815) -- 0:00:10
822500 -- (-978.797) (-978.515) [-979.338] (-983.244) * (-977.928) (-982.387) [-979.633] (-980.266) -- 0:00:10
823000 -- (-976.826) (-978.561) [-978.699] (-979.543) * (-977.284) (-978.540) [-977.636] (-979.136) -- 0:00:10
823500 -- (-982.538) [-979.582] (-980.403) (-979.719) * (-978.303) [-978.673] (-978.762) (-980.248) -- 0:00:10
824000 -- (-978.233) [-979.214] (-979.563) (-980.041) * [-980.499] (-978.196) (-977.545) (-978.365) -- 0:00:10
824500 -- (-978.048) (-978.901) (-978.139) [-977.388] * (-979.565) (-978.206) [-977.315] (-979.488) -- 0:00:10
825000 -- (-977.601) (-981.727) [-978.009] (-977.413) * [-977.565] (-980.445) (-977.419) (-985.756) -- 0:00:10
Average standard deviation of split frequencies: 0.008751
825500 -- [-980.981] (-982.004) (-977.795) (-980.204) * [-978.626] (-977.663) (-977.988) (-981.949) -- 0:00:10
826000 -- [-981.413] (-982.730) (-982.983) (-981.155) * (-981.066) (-977.663) (-977.271) [-977.933] -- 0:00:10
826500 -- (-980.422) (-977.738) (-979.767) [-979.547] * [-978.834] (-977.918) (-977.278) (-979.787) -- 0:00:10
827000 -- (-979.671) [-977.732] (-978.686) (-980.246) * [-979.791] (-978.973) (-978.810) (-978.523) -- 0:00:10
827500 -- (-978.023) (-980.187) [-979.461] (-979.741) * [-977.720] (-977.267) (-979.541) (-980.577) -- 0:00:10
828000 -- (-977.604) (-983.787) (-977.577) [-979.810] * (-977.322) [-978.413] (-979.981) (-980.466) -- 0:00:10
828500 -- (-978.558) (-987.995) [-977.968] (-981.604) * (-977.117) [-978.092] (-979.652) (-982.611) -- 0:00:10
829000 -- [-977.243] (-984.422) (-979.186) (-981.003) * (-978.395) [-978.367] (-979.611) (-977.460) -- 0:00:10
829500 -- [-978.616] (-977.560) (-980.526) (-981.207) * [-978.576] (-980.336) (-979.496) (-978.158) -- 0:00:10
830000 -- (-978.577) [-977.316] (-980.060) (-981.869) * (-978.542) (-979.020) [-978.271] (-981.324) -- 0:00:10
Average standard deviation of split frequencies: 0.008475
830500 -- (-984.671) (-978.600) (-980.194) [-978.339] * (-981.282) (-977.957) (-979.746) [-978.783] -- 0:00:10
831000 -- (-982.832) [-978.001] (-981.981) (-980.672) * (-978.851) [-982.667] (-981.673) (-976.977) -- 0:00:10
831500 -- [-977.593] (-978.115) (-981.081) (-981.951) * (-979.082) (-979.895) (-981.369) [-979.761] -- 0:00:10
832000 -- (-977.318) (-983.158) (-979.983) [-978.136] * (-981.122) (-978.865) (-978.195) [-978.336] -- 0:00:10
832500 -- (-976.888) (-979.437) (-980.313) [-978.255] * (-979.549) (-977.570) (-980.729) [-977.002] -- 0:00:10
833000 -- [-976.808] (-981.479) (-980.921) (-980.436) * [-985.139] (-979.978) (-980.855) (-981.463) -- 0:00:10
833500 -- [-976.837] (-977.673) (-978.154) (-979.238) * (-977.341) [-979.835] (-977.385) (-977.429) -- 0:00:10
834000 -- (-977.138) (-978.340) [-977.958] (-979.627) * (-978.626) (-978.122) (-982.204) [-980.455] -- 0:00:10
834500 -- [-978.205] (-979.044) (-977.185) (-983.054) * (-980.753) (-979.107) [-977.920] (-978.760) -- 0:00:10
835000 -- (-978.111) [-978.654] (-977.783) (-981.260) * (-978.366) (-977.866) [-979.420] (-979.948) -- 0:00:10
Average standard deviation of split frequencies: 0.008421
835500 -- [-977.573] (-977.896) (-977.683) (-980.067) * (-978.113) [-980.646] (-977.154) (-978.707) -- 0:00:10
836000 -- (-978.371) [-977.894] (-980.027) (-978.165) * [-977.266] (-982.057) (-977.303) (-980.096) -- 0:00:10
836500 -- (-977.842) (-977.607) [-980.571] (-979.625) * (-981.592) (-982.520) [-987.671] (-977.083) -- 0:00:09
837000 -- (-978.068) [-978.610] (-978.212) (-978.503) * [-978.061] (-977.095) (-978.036) (-979.204) -- 0:00:09
837500 -- (-979.361) (-979.414) (-979.116) [-977.799] * (-978.061) [-976.963] (-977.714) (-979.325) -- 0:00:09
838000 -- (-983.538) [-978.728] (-978.332) (-978.278) * [-978.457] (-980.594) (-984.113) (-978.987) -- 0:00:09
838500 -- (-978.993) [-978.260] (-985.233) (-979.896) * (-977.958) (-979.222) [-978.113] (-980.165) -- 0:00:09
839000 -- (-981.984) (-979.105) [-977.522] (-977.769) * (-978.737) [-978.651] (-983.780) (-979.558) -- 0:00:09
839500 -- (-977.491) (-982.448) (-978.287) [-977.249] * (-978.586) (-979.024) [-979.828] (-980.689) -- 0:00:09
840000 -- [-977.936] (-977.799) (-979.290) (-978.970) * [-977.619] (-987.514) (-977.950) (-979.955) -- 0:00:09
Average standard deviation of split frequencies: 0.008411
840500 -- [-977.826] (-980.399) (-977.594) (-978.938) * (-981.737) (-984.949) (-979.986) [-978.357] -- 0:00:09
841000 -- [-977.259] (-980.370) (-977.488) (-978.814) * (-978.554) (-979.447) (-977.361) [-977.685] -- 0:00:09
841500 -- (-978.614) (-979.028) [-978.957] (-979.129) * (-978.215) [-977.559] (-979.452) (-976.934) -- 0:00:09
842000 -- [-978.339] (-978.365) (-979.806) (-978.059) * (-978.866) (-979.039) [-978.053] (-979.036) -- 0:00:09
842500 -- (-980.454) (-978.390) (-979.347) [-977.800] * [-980.543] (-979.237) (-979.306) (-978.921) -- 0:00:09
843000 -- (-981.548) (-977.832) (-979.508) [-981.036] * [-977.340] (-978.499) (-982.327) (-979.024) -- 0:00:09
843500 -- [-977.717] (-979.251) (-979.249) (-981.613) * (-980.310) (-979.092) [-983.011] (-978.205) -- 0:00:09
844000 -- [-982.305] (-980.578) (-978.202) (-980.423) * (-977.604) [-978.647] (-979.369) (-982.298) -- 0:00:09
844500 -- (-980.929) (-980.636) (-980.866) [-981.216] * (-978.431) (-977.789) [-978.010] (-977.182) -- 0:00:09
845000 -- [-982.808] (-978.622) (-978.397) (-980.890) * (-981.870) (-977.082) (-978.710) [-978.962] -- 0:00:09
Average standard deviation of split frequencies: 0.008321
845500 -- [-983.832] (-981.697) (-977.487) (-979.696) * (-983.576) [-977.163] (-978.275) (-980.050) -- 0:00:09
846000 -- [-978.671] (-980.604) (-978.843) (-978.941) * [-981.904] (-984.018) (-978.246) (-979.249) -- 0:00:09
846500 -- [-978.314] (-979.270) (-977.720) (-978.051) * (-979.163) (-980.874) [-978.679] (-979.859) -- 0:00:09
847000 -- (-980.488) (-979.227) (-977.973) [-977.605] * (-979.524) [-980.219] (-978.130) (-979.634) -- 0:00:09
847500 -- (-984.542) (-978.562) (-977.749) [-977.914] * (-980.123) (-977.107) [-978.358] (-978.771) -- 0:00:09
848000 -- [-979.277] (-980.019) (-980.324) (-977.766) * (-978.531) [-979.091] (-982.880) (-980.945) -- 0:00:09
848500 -- (-981.999) [-978.501] (-979.574) (-978.271) * (-978.210) [-978.034] (-981.314) (-980.962) -- 0:00:09
849000 -- (-980.141) (-978.306) [-978.394] (-981.402) * [-982.334] (-978.263) (-977.353) (-977.261) -- 0:00:09
849500 -- (-980.367) (-981.846) (-982.495) [-977.698] * [-980.742] (-979.433) (-977.345) (-977.710) -- 0:00:09
850000 -- (-978.403) (-979.092) (-982.053) [-980.290] * (-979.977) [-978.582] (-978.971) (-978.431) -- 0:00:09
Average standard deviation of split frequencies: 0.008349
850500 -- (-979.003) (-978.781) (-979.071) [-980.143] * (-979.988) (-978.474) (-978.189) [-980.577] -- 0:00:09
851000 -- (-977.825) [-979.435] (-979.102) (-977.610) * (-979.576) (-979.242) [-977.150] (-977.832) -- 0:00:09
851500 -- (-979.908) (-979.122) [-978.278] (-980.569) * (-980.519) (-978.402) (-979.246) [-980.431] -- 0:00:09
852000 -- [-979.088] (-978.221) (-979.109) (-979.700) * (-978.072) (-979.613) (-981.037) [-979.021] -- 0:00:09
852500 -- [-979.507] (-979.857) (-981.974) (-978.176) * (-977.715) (-979.155) (-979.191) [-977.874] -- 0:00:08
853000 -- (-981.891) (-979.143) [-979.428] (-980.923) * [-978.558] (-979.158) (-977.753) (-977.981) -- 0:00:08
853500 -- (-979.598) [-978.577] (-981.156) (-979.170) * (-979.838) [-983.277] (-978.639) (-979.911) -- 0:00:08
854000 -- [-979.540] (-977.762) (-980.613) (-979.041) * [-984.515] (-980.908) (-977.208) (-977.440) -- 0:00:08
854500 -- (-979.583) [-977.475] (-980.177) (-978.134) * (-977.054) (-978.668) [-979.076] (-979.604) -- 0:00:08
855000 -- (-980.541) (-977.780) (-978.713) [-978.838] * (-977.314) [-978.194] (-980.482) (-979.452) -- 0:00:08
Average standard deviation of split frequencies: 0.008958
855500 -- (-979.831) (-977.267) [-978.087] (-980.128) * (-980.831) [-978.034] (-980.377) (-979.533) -- 0:00:08
856000 -- [-978.804] (-977.552) (-979.544) (-979.100) * (-980.457) [-979.571] (-979.202) (-979.616) -- 0:00:08
856500 -- (-979.127) (-979.596) (-978.767) [-981.090] * [-981.877] (-978.322) (-977.085) (-977.208) -- 0:00:08
857000 -- [-979.547] (-980.389) (-978.897) (-984.256) * (-978.064) (-978.293) (-983.183) [-976.743] -- 0:00:08
857500 -- [-977.964] (-979.340) (-980.187) (-984.193) * [-977.626] (-982.440) (-981.373) (-980.136) -- 0:00:08
858000 -- (-977.953) (-978.327) (-979.147) [-979.415] * (-978.256) (-978.084) [-981.969] (-977.671) -- 0:00:08
858500 -- (-977.942) (-977.927) (-979.363) [-977.130] * (-977.269) [-977.355] (-977.637) (-977.656) -- 0:00:08
859000 -- (-978.458) [-977.875] (-980.578) (-977.102) * (-980.061) [-977.374] (-978.840) (-979.407) -- 0:00:08
859500 -- (-981.577) (-979.452) [-979.330] (-981.140) * (-977.937) (-978.306) (-984.718) [-977.646] -- 0:00:08
860000 -- (-977.487) (-979.616) [-978.868] (-981.114) * (-977.609) (-977.755) (-978.713) [-977.676] -- 0:00:08
Average standard deviation of split frequencies: 0.008654
860500 -- [-977.120] (-977.590) (-978.976) (-979.708) * (-978.088) [-979.622] (-980.117) (-979.900) -- 0:00:08
861000 -- (-977.164) (-982.345) (-981.341) [-981.359] * (-976.830) [-977.682] (-977.062) (-978.124) -- 0:00:08
861500 -- (-978.647) [-978.604] (-979.000) (-979.612) * (-977.321) [-980.234] (-981.407) (-977.388) -- 0:00:08
862000 -- (-978.480) (-978.953) (-979.075) [-978.576] * [-977.203] (-977.583) (-982.598) (-979.019) -- 0:00:08
862500 -- (-978.807) (-981.828) (-978.657) [-977.931] * (-981.040) [-978.006] (-979.555) (-982.048) -- 0:00:08
863000 -- (-986.126) [-984.857] (-979.424) (-978.678) * [-979.432] (-978.985) (-982.621) (-978.218) -- 0:00:08
863500 -- (-978.918) (-985.098) (-981.598) [-977.873] * (-978.868) (-979.176) [-980.123] (-977.925) -- 0:00:08
864000 -- (-979.967) (-978.551) (-978.278) [-977.563] * (-981.929) (-979.016) [-978.870] (-977.882) -- 0:00:08
864500 -- (-979.593) [-981.936] (-979.620) (-983.730) * (-983.906) (-978.929) [-979.767] (-981.724) -- 0:00:08
865000 -- (-981.409) [-978.350] (-977.982) (-980.832) * (-981.191) [-982.392] (-980.720) (-983.766) -- 0:00:08
Average standard deviation of split frequencies: 0.008131
865500 -- (-982.804) (-980.205) (-977.982) [-979.542] * (-981.191) [-983.668] (-984.459) (-980.009) -- 0:00:08
866000 -- [-979.358] (-981.177) (-977.385) (-981.411) * (-980.271) [-981.391] (-979.668) (-978.969) -- 0:00:08
866500 -- (-981.219) (-979.877) [-977.127] (-978.272) * (-978.117) [-978.215] (-979.198) (-979.091) -- 0:00:08
867000 -- (-979.191) (-981.677) [-977.663] (-979.034) * [-977.927] (-977.908) (-979.442) (-978.532) -- 0:00:08
867500 -- (-978.858) (-981.914) [-980.289] (-979.091) * (-978.699) (-977.331) [-977.714] (-985.071) -- 0:00:08
868000 -- (-981.259) (-979.413) [-982.400] (-984.578) * (-978.428) [-978.307] (-979.314) (-980.247) -- 0:00:08
868500 -- (-976.932) (-980.043) [-980.042] (-980.072) * [-980.234] (-977.873) (-980.333) (-978.548) -- 0:00:08
869000 -- (-976.954) (-978.406) (-979.419) [-978.223] * [-977.708] (-978.594) (-982.003) (-979.336) -- 0:00:07
869500 -- (-979.494) (-979.697) [-981.212] (-978.849) * [-977.157] (-978.245) (-982.006) (-978.425) -- 0:00:07
870000 -- [-978.536] (-979.537) (-980.895) (-979.181) * [-979.101] (-979.164) (-985.069) (-977.887) -- 0:00:07
Average standard deviation of split frequencies: 0.008266
870500 -- (-978.365) (-984.041) [-978.971] (-979.177) * [-979.319] (-983.762) (-979.949) (-977.869) -- 0:00:07
871000 -- (-977.635) [-977.094] (-978.399) (-980.212) * (-977.742) (-983.788) [-978.159] (-981.962) -- 0:00:07
871500 -- (-977.499) [-978.361] (-978.857) (-981.061) * (-978.438) (-977.659) (-979.232) [-978.357] -- 0:00:07
872000 -- (-977.220) (-979.366) [-976.855] (-979.175) * (-977.892) [-983.806] (-978.628) (-982.218) -- 0:00:07
872500 -- [-977.310] (-979.465) (-977.233) (-979.794) * [-978.550] (-978.952) (-981.971) (-981.943) -- 0:00:07
873000 -- (-977.671) [-977.362] (-979.881) (-979.338) * (-980.921) [-979.084] (-977.104) (-978.974) -- 0:00:07
873500 -- (-978.808) (-977.347) (-978.110) [-978.313] * [-978.994] (-980.420) (-984.120) (-977.449) -- 0:00:07
874000 -- (-978.363) [-977.385] (-978.522) (-979.570) * [-977.383] (-978.350) (-981.388) (-978.303) -- 0:00:07
874500 -- (-978.038) [-979.263] (-979.802) (-979.938) * [-977.299] (-979.510) (-982.242) (-979.961) -- 0:00:07
875000 -- (-980.862) [-980.807] (-979.334) (-981.910) * (-978.291) [-980.037] (-980.236) (-977.317) -- 0:00:07
Average standard deviation of split frequencies: 0.008072
875500 -- (-979.621) [-977.242] (-980.122) (-980.093) * (-979.953) (-980.998) [-978.475] (-977.018) -- 0:00:07
876000 -- [-979.419] (-978.902) (-978.353) (-978.836) * (-979.109) (-977.490) (-979.276) [-978.281] -- 0:00:07
876500 -- (-977.595) (-979.399) [-977.986] (-980.574) * (-977.920) [-978.995] (-978.042) (-977.584) -- 0:00:07
877000 -- (-979.853) [-978.898] (-980.398) (-977.853) * (-977.552) (-979.742) [-979.592] (-980.869) -- 0:00:07
877500 -- (-979.439) [-977.454] (-977.535) (-983.022) * (-977.823) (-978.357) [-979.422] (-977.971) -- 0:00:07
878000 -- (-978.694) (-977.249) (-980.196) [-979.643] * (-977.757) [-980.130] (-981.063) (-977.577) -- 0:00:07
878500 -- (-981.091) (-982.857) (-980.288) [-978.829] * [-980.584] (-979.041) (-977.663) (-976.737) -- 0:00:07
879000 -- [-979.812] (-979.271) (-981.620) (-978.886) * (-977.857) (-981.024) (-981.121) [-977.625] -- 0:00:07
879500 -- (-979.426) [-978.619] (-980.639) (-979.359) * (-977.762) (-978.886) (-983.264) [-977.100] -- 0:00:07
880000 -- (-979.600) (-978.967) (-983.144) [-977.565] * (-979.438) (-978.909) (-977.343) [-978.960] -- 0:00:07
Average standard deviation of split frequencies: 0.008243
880500 -- (-979.411) (-979.480) [-978.323] (-980.094) * (-981.307) (-979.056) (-980.089) [-978.303] -- 0:00:07
881000 -- (-978.526) (-979.752) [-978.379] (-977.477) * (-978.145) (-982.750) [-981.476] (-978.499) -- 0:00:07
881500 -- (-978.877) (-980.618) [-978.758] (-979.834) * (-980.194) [-980.443] (-978.952) (-978.430) -- 0:00:07
882000 -- (-978.706) (-980.489) (-979.027) [-979.868] * (-979.917) [-978.095] (-979.981) (-978.564) -- 0:00:07
882500 -- [-977.034] (-982.534) (-977.062) (-979.420) * (-980.754) [-977.844] (-978.885) (-979.036) -- 0:00:07
883000 -- [-977.260] (-980.911) (-978.277) (-977.724) * (-980.107) (-977.627) [-977.980] (-978.435) -- 0:00:07
883500 -- (-979.725) [-980.118] (-979.257) (-980.682) * (-977.389) [-977.934] (-977.364) (-982.426) -- 0:00:07
884000 -- [-980.627] (-982.894) (-981.378) (-980.639) * (-977.293) (-979.260) [-978.441] (-980.583) -- 0:00:07
884500 -- (-983.324) (-981.509) [-977.443] (-981.801) * (-977.651) (-978.784) [-980.821] (-981.176) -- 0:00:07
885000 -- (-980.395) [-979.244] (-981.384) (-979.339) * (-977.751) (-979.660) (-979.365) [-977.398] -- 0:00:07
Average standard deviation of split frequencies: 0.008480
885500 -- (-978.405) (-982.313) [-977.703] (-987.712) * [-982.221] (-980.437) (-977.784) (-980.317) -- 0:00:06
886000 -- (-980.350) (-978.757) (-980.949) [-978.004] * (-981.575) (-980.160) (-978.533) [-979.927] -- 0:00:06
886500 -- (-979.925) (-979.373) (-980.780) [-977.678] * (-977.656) (-977.169) [-979.269] (-978.727) -- 0:00:06
887000 -- (-981.870) (-981.402) (-978.821) [-977.812] * (-977.251) (-979.929) (-979.281) [-980.606] -- 0:00:06
887500 -- (-977.912) [-978.418] (-978.193) (-982.214) * (-978.752) (-986.275) [-977.377] (-979.377) -- 0:00:06
888000 -- (-977.315) (-979.794) [-979.224] (-980.201) * (-982.722) [-977.190] (-977.434) (-978.244) -- 0:00:06
888500 -- (-978.206) [-980.868] (-978.356) (-976.925) * (-978.314) [-977.888] (-978.316) (-980.587) -- 0:00:06
889000 -- (-979.338) [-979.848] (-981.804) (-978.441) * (-979.730) (-978.204) [-979.070] (-981.323) -- 0:00:06
889500 -- (-978.082) [-978.961] (-979.812) (-979.053) * (-979.267) (-979.090) (-979.819) [-978.976] -- 0:00:06
890000 -- [-977.892] (-977.755) (-980.201) (-978.260) * (-979.642) (-979.864) [-979.350] (-979.765) -- 0:00:06
Average standard deviation of split frequencies: 0.008336
890500 -- (-980.467) (-977.412) [-978.282] (-979.710) * [-980.180] (-982.272) (-978.857) (-978.022) -- 0:00:06
891000 -- (-978.633) (-978.472) [-977.911] (-981.875) * (-978.027) [-979.542] (-980.044) (-977.742) -- 0:00:06
891500 -- (-978.736) (-976.855) [-980.104] (-979.274) * (-983.053) (-979.071) [-977.740] (-977.400) -- 0:00:06
892000 -- (-978.207) (-978.003) (-981.266) [-980.133] * (-977.946) (-978.512) (-978.172) [-979.273] -- 0:00:06
892500 -- [-979.085] (-977.993) (-980.194) (-978.787) * (-977.022) [-982.121] (-977.882) (-978.843) -- 0:00:06
893000 -- (-980.148) [-979.033] (-979.157) (-978.636) * (-981.464) [-977.607] (-981.487) (-986.435) -- 0:00:06
893500 -- (-980.238) (-976.822) (-978.364) [-982.037] * (-981.041) [-982.193] (-980.973) (-979.829) -- 0:00:06
894000 -- [-978.806] (-978.671) (-979.404) (-982.925) * (-977.030) [-980.892] (-978.570) (-978.372) -- 0:00:06
894500 -- (-979.498) [-978.671] (-980.861) (-983.161) * [-981.081] (-979.836) (-979.122) (-981.770) -- 0:00:06
895000 -- (-980.549) (-978.841) (-977.078) [-979.288] * (-978.927) (-977.621) (-980.065) [-979.005] -- 0:00:06
Average standard deviation of split frequencies: 0.008582
895500 -- (-979.262) (-977.472) [-979.855] (-978.037) * (-978.824) [-978.719] (-981.812) (-983.705) -- 0:00:06
896000 -- (-978.921) (-977.791) (-980.382) [-977.381] * (-980.266) [-978.076] (-978.087) (-981.180) -- 0:00:06
896500 -- (-977.222) (-977.683) (-978.868) [-977.858] * (-982.832) [-980.317] (-979.527) (-981.299) -- 0:00:06
897000 -- [-976.953] (-978.362) (-979.159) (-978.771) * (-977.635) [-979.756] (-978.780) (-978.763) -- 0:00:06
897500 -- (-977.217) (-977.724) (-978.500) [-977.515] * (-977.327) (-978.666) (-978.973) [-977.839] -- 0:00:06
898000 -- (-977.600) (-978.618) [-976.962] (-978.128) * (-977.329) (-978.723) (-977.545) [-981.776] -- 0:00:06
898500 -- (-977.130) (-982.457) [-977.017] (-979.659) * (-979.086) (-977.943) [-978.058] (-977.244) -- 0:00:06
899000 -- (-980.382) [-983.195] (-978.790) (-979.726) * (-977.915) (-978.237) (-979.303) [-979.089] -- 0:00:06
899500 -- (-978.524) (-978.156) (-979.396) [-978.248] * (-978.886) (-979.451) [-979.449] (-982.198) -- 0:00:06
900000 -- (-979.666) (-979.548) [-979.349] (-983.158) * (-978.300) (-978.236) [-978.585] (-982.850) -- 0:00:06
Average standard deviation of split frequencies: 0.008688
900500 -- (-981.302) [-977.425] (-978.524) (-978.916) * (-978.930) [-979.805] (-978.743) (-978.721) -- 0:00:06
901000 -- (-981.961) (-978.045) [-978.747] (-977.804) * (-979.925) (-980.654) [-978.969] (-980.775) -- 0:00:06
901500 -- [-980.186] (-977.452) (-979.008) (-980.417) * (-985.454) (-978.379) (-978.389) [-978.478] -- 0:00:06
902000 -- (-980.093) (-979.180) [-983.430] (-977.777) * (-983.784) [-979.688] (-979.176) (-980.983) -- 0:00:05
902500 -- (-983.276) [-978.501] (-986.902) (-977.785) * (-978.688) [-977.683] (-979.563) (-981.916) -- 0:00:05
903000 -- (-982.328) [-979.396] (-983.995) (-979.953) * (-977.051) [-980.003] (-977.952) (-980.262) -- 0:00:05
903500 -- [-979.697] (-979.896) (-979.969) (-978.597) * (-979.658) (-979.897) [-977.732] (-979.233) -- 0:00:05
904000 -- (-979.525) (-980.250) [-977.501] (-978.987) * (-977.950) [-979.546] (-978.261) (-977.999) -- 0:00:05
904500 -- (-979.223) (-979.958) [-978.016] (-982.541) * (-978.346) (-978.835) [-981.333] (-978.955) -- 0:00:05
905000 -- (-979.317) (-978.788) (-979.363) [-981.046] * (-978.509) (-977.649) (-980.758) [-976.813] -- 0:00:05
Average standard deviation of split frequencies: 0.007837
905500 -- (-977.277) [-979.445] (-979.806) (-982.562) * (-980.879) (-977.769) (-977.622) [-977.974] -- 0:00:05
906000 -- (-980.247) (-982.125) (-978.076) [-978.814] * (-977.498) (-977.166) (-981.256) [-977.843] -- 0:00:05
906500 -- (-981.136) (-979.376) [-978.571] (-978.083) * (-977.574) (-977.156) (-978.684) [-977.563] -- 0:00:05
907000 -- (-980.199) [-978.087] (-978.605) (-978.947) * (-977.978) (-980.339) [-978.127] (-980.575) -- 0:00:05
907500 -- (-979.149) (-979.956) [-980.433] (-978.297) * (-977.058) [-978.053] (-981.194) (-978.549) -- 0:00:05
908000 -- [-978.342] (-977.303) (-980.482) (-980.700) * (-978.435) (-977.514) [-977.749] (-976.945) -- 0:00:05
908500 -- [-979.138] (-978.616) (-983.744) (-980.125) * (-980.087) (-979.401) (-977.543) [-977.719] -- 0:00:05
909000 -- (-981.285) (-983.730) [-978.550] (-981.679) * (-982.134) (-979.713) (-980.756) [-977.389] -- 0:00:05
909500 -- (-982.817) (-981.497) [-977.081] (-982.888) * (-980.129) (-980.853) (-979.403) [-979.800] -- 0:00:05
910000 -- (-982.050) (-979.766) (-979.189) [-979.897] * (-980.892) (-980.746) (-982.180) [-985.378] -- 0:00:05
Average standard deviation of split frequencies: 0.008110
910500 -- (-980.446) (-977.426) (-979.069) [-981.431] * (-979.317) (-978.735) [-982.208] (-981.504) -- 0:00:05
911000 -- (-980.150) (-979.797) (-980.586) [-983.492] * [-980.015] (-984.661) (-980.458) (-986.803) -- 0:00:05
911500 -- (-979.926) (-977.185) [-977.255] (-985.766) * [-978.766] (-984.443) (-979.151) (-979.568) -- 0:00:05
912000 -- [-979.631] (-980.239) (-979.863) (-981.782) * (-979.357) (-977.725) (-978.628) [-980.000] -- 0:00:05
912500 -- [-978.534] (-978.968) (-978.107) (-982.094) * (-981.986) [-981.779] (-979.369) (-977.236) -- 0:00:05
913000 -- (-978.615) (-979.173) [-977.324] (-979.787) * [-978.666] (-980.370) (-978.296) (-977.538) -- 0:00:05
913500 -- [-977.790] (-980.077) (-980.923) (-978.586) * [-980.076] (-979.321) (-977.669) (-978.691) -- 0:00:05
914000 -- (-979.180) (-977.203) (-981.778) [-980.868] * [-977.808] (-979.394) (-978.260) (-978.483) -- 0:00:05
914500 -- (-982.022) (-978.752) [-981.001] (-979.257) * (-979.630) [-978.395] (-982.524) (-977.722) -- 0:00:05
915000 -- (-978.441) (-985.360) (-979.156) [-978.410] * (-981.643) [-977.713] (-979.234) (-979.535) -- 0:00:05
Average standard deviation of split frequencies: 0.007857
915500 -- (-979.856) (-981.630) (-977.872) [-979.051] * (-982.938) (-981.014) (-979.019) [-978.027] -- 0:00:05
916000 -- (-979.149) (-983.542) [-978.790] (-982.680) * (-980.921) (-978.873) [-978.846] (-980.466) -- 0:00:05
916500 -- (-979.609) [-978.692] (-977.609) (-979.248) * [-979.728] (-979.729) (-978.710) (-984.156) -- 0:00:05
917000 -- (-978.051) (-978.969) (-978.157) [-977.581] * (-978.808) (-979.027) [-979.614] (-978.799) -- 0:00:05
917500 -- (-981.039) (-980.586) (-980.274) [-977.747] * [-977.401] (-978.138) (-979.815) (-978.985) -- 0:00:05
918000 -- [-977.866] (-986.548) (-978.196) (-979.153) * [-977.082] (-977.999) (-977.720) (-983.107) -- 0:00:05
918500 -- [-977.353] (-980.666) (-977.215) (-980.432) * (-978.884) (-978.159) [-977.615] (-979.148) -- 0:00:04
919000 -- (-979.372) (-980.448) (-977.535) [-979.284] * [-977.611] (-979.171) (-977.778) (-980.134) -- 0:00:04
919500 -- (-978.756) (-979.048) [-979.998] (-981.101) * (-980.067) [-978.382] (-978.567) (-980.410) -- 0:00:04
920000 -- (-979.238) [-979.805] (-977.290) (-978.720) * (-979.741) (-980.976) (-982.716) [-977.566] -- 0:00:04
Average standard deviation of split frequencies: 0.007953
920500 -- [-977.737] (-978.394) (-977.519) (-979.128) * (-977.895) (-981.612) (-979.529) [-978.481] -- 0:00:04
921000 -- (-979.189) [-978.877] (-979.267) (-979.211) * (-977.677) (-980.106) (-979.621) [-979.812] -- 0:00:04
921500 -- (-978.238) (-980.488) (-982.834) [-978.418] * (-978.134) (-980.743) [-978.027] (-979.067) -- 0:00:04
922000 -- (-980.413) (-978.723) [-979.062] (-979.262) * (-981.517) (-977.578) (-978.420) [-980.234] -- 0:00:04
922500 -- (-978.845) (-978.867) (-978.846) [-978.453] * [-980.022] (-977.229) (-980.975) (-978.553) -- 0:00:04
923000 -- (-977.513) (-977.855) [-978.492] (-981.804) * (-985.634) [-977.410] (-979.045) (-979.356) -- 0:00:04
923500 -- (-979.002) [-977.896] (-979.177) (-980.278) * (-984.220) [-980.124] (-979.262) (-979.880) -- 0:00:04
924000 -- [-979.251] (-981.560) (-978.729) (-979.835) * (-982.396) [-979.112] (-980.033) (-978.825) -- 0:00:04
924500 -- (-979.938) [-978.564] (-979.369) (-980.391) * (-981.117) (-980.696) [-979.358] (-979.615) -- 0:00:04
925000 -- (-980.542) [-979.152] (-978.033) (-981.455) * (-984.473) (-978.024) [-981.252] (-978.428) -- 0:00:04
Average standard deviation of split frequencies: 0.007509
925500 -- (-978.713) (-978.397) [-978.359] (-982.299) * (-982.875) (-978.667) [-977.970] (-977.471) -- 0:00:04
926000 -- [-982.615] (-979.113) (-977.547) (-982.620) * (-982.216) [-979.560] (-978.376) (-977.361) -- 0:00:04
926500 -- (-984.219) (-979.173) [-978.634] (-983.250) * (-979.274) (-982.070) [-979.197] (-977.374) -- 0:00:04
927000 -- (-983.841) [-979.599] (-978.726) (-978.761) * (-983.961) (-984.156) [-978.642] (-978.101) -- 0:00:04
927500 -- (-981.053) [-977.207] (-978.109) (-979.007) * (-980.785) (-978.549) [-978.611] (-977.047) -- 0:00:04
928000 -- (-979.863) [-977.707] (-978.412) (-978.415) * [-977.848] (-979.114) (-979.379) (-977.029) -- 0:00:04
928500 -- (-979.347) (-978.082) (-979.556) [-980.116] * (-979.255) (-980.099) (-978.581) [-977.198] -- 0:00:04
929000 -- (-985.603) (-979.208) (-978.639) [-978.922] * (-980.029) (-978.769) [-979.137] (-979.464) -- 0:00:04
929500 -- [-981.672] (-981.533) (-978.073) (-980.005) * (-980.661) [-977.402] (-979.891) (-980.091) -- 0:00:04
930000 -- (-979.933) (-979.402) [-977.688] (-979.726) * (-978.930) (-977.788) [-978.782] (-978.734) -- 0:00:04
Average standard deviation of split frequencies: 0.007902
930500 -- (-980.501) (-979.577) [-979.569] (-979.247) * (-980.382) (-979.563) (-977.099) [-981.033] -- 0:00:04
931000 -- (-983.655) (-977.956) (-977.450) [-979.564] * (-977.954) (-977.679) (-980.543) [-979.963] -- 0:00:04
931500 -- (-980.794) [-979.284] (-977.546) (-981.104) * [-978.987] (-979.066) (-979.406) (-978.642) -- 0:00:04
932000 -- (-978.200) (-981.190) [-979.827] (-982.929) * (-979.190) (-981.155) [-979.169] (-984.546) -- 0:00:04
932500 -- (-977.708) (-985.108) (-980.400) [-978.031] * [-978.944] (-979.947) (-979.181) (-979.271) -- 0:00:04
933000 -- (-979.703) (-981.050) (-978.051) [-978.485] * (-979.089) (-981.224) [-978.547] (-980.639) -- 0:00:04
933500 -- (-976.958) (-981.021) [-978.225] (-979.089) * [-977.692] (-980.181) (-978.325) (-981.682) -- 0:00:04
934000 -- (-981.310) [-977.310] (-980.143) (-978.338) * (-977.106) (-977.184) (-978.445) [-979.715] -- 0:00:04
934500 -- (-980.337) (-977.546) (-978.315) [-978.243] * (-979.704) [-978.202] (-979.388) (-981.651) -- 0:00:03
935000 -- (-978.486) (-980.506) [-979.311] (-979.007) * [-980.473] (-979.184) (-979.776) (-987.855) -- 0:00:03
Average standard deviation of split frequencies: 0.007890
935500 -- [-978.337] (-979.936) (-980.933) (-979.937) * (-982.165) (-978.233) (-978.585) [-977.973] -- 0:00:03
936000 -- (-979.450) (-978.343) [-977.211] (-979.416) * (-979.154) (-980.724) [-978.528] (-978.609) -- 0:00:03
936500 -- (-979.698) [-980.107] (-980.178) (-980.033) * (-977.881) [-983.652] (-978.877) (-978.863) -- 0:00:03
937000 -- (-979.833) (-979.006) (-978.376) [-979.016] * (-979.605) (-985.836) [-979.703] (-980.338) -- 0:00:03
937500 -- [-978.831] (-980.538) (-979.725) (-979.011) * (-981.166) (-988.209) (-980.432) [-977.876] -- 0:00:03
938000 -- (-979.359) (-979.760) [-980.049] (-979.096) * [-981.074] (-981.659) (-980.960) (-976.715) -- 0:00:03
938500 -- (-986.103) (-977.470) (-983.383) [-980.533] * [-979.043] (-980.785) (-980.270) (-983.399) -- 0:00:03
939000 -- (-979.239) (-979.390) (-979.495) [-980.437] * (-979.914) (-979.877) (-978.441) [-982.723] -- 0:00:03
939500 -- (-979.079) [-978.334] (-980.101) (-977.333) * (-980.051) (-980.962) [-978.655] (-978.110) -- 0:00:03
940000 -- (-978.003) (-978.773) (-981.702) [-980.512] * [-981.609] (-977.754) (-977.567) (-978.808) -- 0:00:03
Average standard deviation of split frequencies: 0.008085
940500 -- [-978.856] (-979.009) (-983.959) (-984.449) * (-983.678) (-980.982) (-982.450) [-977.992] -- 0:00:03
941000 -- [-980.175] (-980.255) (-983.392) (-977.317) * (-979.170) [-977.675] (-980.345) (-977.381) -- 0:00:03
941500 -- (-982.498) (-977.183) [-980.267] (-978.426) * (-984.392) [-978.300] (-980.604) (-979.178) -- 0:00:03
942000 -- (-983.374) (-978.242) [-978.152] (-978.341) * [-982.670] (-977.853) (-980.734) (-981.451) -- 0:00:03
942500 -- (-982.558) [-978.449] (-978.082) (-977.754) * (-982.906) [-981.681] (-978.043) (-978.401) -- 0:00:03
943000 -- [-983.556] (-980.441) (-978.254) (-979.519) * (-984.330) (-980.993) (-981.177) [-977.983] -- 0:00:03
943500 -- [-977.102] (-977.544) (-979.995) (-980.879) * (-983.134) [-979.513] (-978.305) (-982.706) -- 0:00:03
944000 -- (-978.354) [-977.381] (-981.084) (-984.503) * [-981.615] (-978.802) (-980.556) (-977.850) -- 0:00:03
944500 -- (-978.512) (-979.192) (-978.372) [-978.212] * (-981.234) (-977.925) (-986.759) [-978.376] -- 0:00:03
945000 -- (-981.035) (-979.308) (-976.708) [-977.232] * (-977.239) [-981.353] (-978.057) (-977.977) -- 0:00:03
Average standard deviation of split frequencies: 0.008438
945500 -- (-979.743) (-979.471) [-980.633] (-980.584) * (-977.726) [-978.260] (-977.782) (-979.226) -- 0:00:03
946000 -- (-978.995) (-980.495) [-978.679] (-978.874) * (-978.753) (-980.185) (-977.389) [-979.108] -- 0:00:03
946500 -- (-977.857) (-982.891) (-983.348) [-978.856] * (-982.514) (-980.230) (-977.078) [-978.341] -- 0:00:03
947000 -- (-978.087) (-977.430) (-979.373) [-978.807] * (-982.191) (-981.108) (-980.160) [-977.803] -- 0:00:03
947500 -- (-978.226) [-979.021] (-980.745) (-979.670) * [-977.884] (-980.095) (-979.154) (-982.476) -- 0:00:03
948000 -- [-977.868] (-978.913) (-976.918) (-978.851) * (-978.070) (-986.175) (-979.224) [-981.342] -- 0:00:03
948500 -- [-981.957] (-980.252) (-976.983) (-978.854) * (-979.999) (-980.922) [-978.928] (-981.900) -- 0:00:03
949000 -- (-979.333) (-978.709) [-978.248] (-980.779) * (-978.743) (-978.966) [-982.635] (-977.810) -- 0:00:03
949500 -- [-980.934] (-979.464) (-979.812) (-981.415) * (-980.990) (-978.891) (-977.872) [-979.118] -- 0:00:03
950000 -- (-980.224) (-981.364) (-980.112) [-980.250] * (-978.178) [-978.702] (-978.511) (-976.703) -- 0:00:03
Average standard deviation of split frequencies: 0.008430
950500 -- (-980.718) (-981.847) (-978.336) [-980.476] * [-977.775] (-981.685) (-983.329) (-977.440) -- 0:00:03
951000 -- (-979.004) (-977.559) [-979.438] (-979.756) * (-978.682) (-979.050) (-982.166) [-978.682] -- 0:00:02
951500 -- (-978.818) (-978.652) [-979.033] (-977.918) * (-980.249) (-979.928) [-982.398] (-982.210) -- 0:00:02
952000 -- [-980.083] (-979.039) (-978.810) (-978.857) * (-981.167) [-977.529] (-979.561) (-977.871) -- 0:00:02
952500 -- [-977.440] (-980.574) (-977.332) (-979.792) * (-982.611) (-978.757) [-978.166] (-978.867) -- 0:00:02
953000 -- [-982.761] (-978.328) (-981.034) (-976.873) * (-981.701) (-979.842) (-980.461) [-977.508] -- 0:00:02
953500 -- [-978.245] (-980.225) (-977.289) (-978.195) * (-978.345) (-981.703) (-978.504) [-978.070] -- 0:00:02
954000 -- (-979.943) (-986.511) (-977.289) [-978.424] * (-978.331) [-979.065] (-980.529) (-977.325) -- 0:00:02
954500 -- (-978.149) [-977.785] (-980.393) (-978.026) * (-978.714) (-978.447) (-978.452) [-976.849] -- 0:00:02
955000 -- (-977.461) [-978.482] (-979.804) (-976.851) * [-978.338] (-979.442) (-979.352) (-979.566) -- 0:00:02
Average standard deviation of split frequencies: 0.008481
955500 -- (-979.899) (-978.184) (-979.434) [-976.877] * (-978.939) (-978.384) (-978.898) [-980.480] -- 0:00:02
956000 -- [-979.075] (-977.630) (-978.905) (-985.166) * (-982.379) (-978.577) [-980.257] (-977.224) -- 0:00:02
956500 -- (-978.199) [-979.090] (-983.759) (-985.605) * (-978.653) [-978.434] (-978.303) (-977.879) -- 0:00:02
957000 -- (-982.700) [-977.826] (-981.907) (-978.811) * [-978.208] (-977.437) (-978.996) (-976.957) -- 0:00:02
957500 -- (-980.925) (-977.674) (-982.156) [-978.578] * [-980.553] (-977.535) (-978.663) (-980.680) -- 0:00:02
958000 -- [-980.511] (-980.561) (-982.280) (-977.392) * [-977.558] (-982.002) (-980.931) (-977.266) -- 0:00:02
958500 -- [-979.538] (-978.187) (-986.035) (-986.533) * [-980.239] (-978.480) (-980.782) (-978.418) -- 0:00:02
959000 -- (-980.182) [-979.121] (-982.188) (-978.652) * (-978.664) (-977.803) [-980.617] (-983.931) -- 0:00:02
959500 -- (-981.142) [-980.252] (-978.204) (-978.773) * (-977.199) (-976.877) (-979.117) [-978.364] -- 0:00:02
960000 -- [-983.970] (-977.824) (-981.042) (-979.300) * [-978.196] (-979.107) (-986.938) (-979.901) -- 0:00:02
Average standard deviation of split frequencies: 0.008146
960500 -- (-977.400) [-980.150] (-980.749) (-977.921) * (-978.552) [-979.220] (-978.709) (-979.485) -- 0:00:02
961000 -- (-981.394) [-980.744] (-977.434) (-977.911) * (-978.585) [-978.824] (-984.337) (-979.763) -- 0:00:02
961500 -- (-978.877) (-981.933) [-977.594] (-977.341) * [-978.625] (-978.860) (-979.461) (-978.519) -- 0:00:02
962000 -- (-979.517) [-981.213] (-978.923) (-978.350) * (-977.791) (-980.849) (-977.896) [-978.687] -- 0:00:02
962500 -- (-980.122) (-977.273) [-980.556] (-982.738) * (-978.339) (-978.334) [-981.120] (-978.980) -- 0:00:02
963000 -- (-978.919) (-978.624) [-979.501] (-978.049) * (-980.947) (-979.227) [-979.352] (-982.696) -- 0:00:02
963500 -- (-980.823) (-982.578) (-978.477) [-978.737] * (-979.600) (-978.085) (-983.859) [-978.405] -- 0:00:02
964000 -- (-979.470) [-983.506] (-978.885) (-980.090) * (-980.096) (-979.794) (-979.526) [-977.260] -- 0:00:02
964500 -- (-977.345) [-978.433] (-987.621) (-979.559) * (-977.557) (-979.578) (-980.079) [-980.325] -- 0:00:02
965000 -- (-978.212) (-978.025) [-979.745] (-976.959) * (-982.119) [-979.300] (-979.612) (-979.417) -- 0:00:02
Average standard deviation of split frequencies: 0.008068
965500 -- (-977.136) (-977.985) (-978.757) [-978.202] * (-978.460) (-978.292) [-978.518] (-984.759) -- 0:00:02
966000 -- [-978.533] (-978.330) (-980.833) (-979.168) * (-979.944) (-979.331) [-978.797] (-981.717) -- 0:00:02
966500 -- [-978.267] (-978.837) (-977.995) (-978.651) * (-981.730) (-977.759) (-979.386) [-978.733] -- 0:00:02
967000 -- (-978.319) (-979.439) [-977.760] (-979.590) * [-977.501] (-977.054) (-979.424) (-977.807) -- 0:00:02
967500 -- (-977.818) (-978.395) (-978.750) [-979.135] * (-980.447) [-977.481] (-980.427) (-978.375) -- 0:00:01
968000 -- (-977.943) [-978.422] (-981.701) (-980.624) * (-977.335) (-981.273) (-978.203) [-979.848] -- 0:00:01
968500 -- (-978.823) (-979.291) (-978.507) [-977.857] * [-979.445] (-977.507) (-977.541) (-980.224) -- 0:00:01
969000 -- [-978.486] (-982.922) (-981.327) (-978.980) * (-978.413) [-979.642] (-977.993) (-980.507) -- 0:00:01
969500 -- (-979.180) [-978.716] (-978.071) (-985.173) * (-976.916) (-981.248) (-980.139) [-978.969] -- 0:00:01
970000 -- (-977.946) [-977.953] (-983.360) (-979.643) * [-976.912] (-980.904) (-979.555) (-980.105) -- 0:00:01
Average standard deviation of split frequencies: 0.008256
970500 -- [-977.493] (-979.585) (-978.745) (-981.063) * (-976.902) [-979.272] (-977.082) (-982.797) -- 0:00:01
971000 -- (-986.557) [-979.381] (-978.854) (-980.622) * (-978.883) (-979.535) [-978.217] (-979.028) -- 0:00:01
971500 -- [-978.652] (-977.882) (-977.618) (-979.039) * (-979.802) (-980.199) (-982.070) [-978.482] -- 0:00:01
972000 -- (-977.461) [-978.760] (-980.490) (-980.985) * [-984.338] (-978.593) (-978.150) (-977.180) -- 0:00:01
972500 -- [-977.721] (-984.811) (-977.767) (-978.425) * (-978.557) (-980.799) (-979.771) [-979.330] -- 0:00:01
973000 -- [-978.232] (-984.914) (-977.565) (-979.983) * (-979.284) (-979.228) (-977.691) [-977.644] -- 0:00:01
973500 -- (-980.657) (-977.759) [-976.951] (-981.393) * (-978.206) [-978.218] (-978.305) (-979.678) -- 0:00:01
974000 -- (-981.330) (-983.245) [-976.758] (-981.564) * (-981.397) (-978.072) (-980.918) [-979.538] -- 0:00:01
974500 -- (-985.895) [-978.658] (-980.181) (-979.132) * (-980.666) (-978.443) (-977.774) [-981.500] -- 0:00:01
975000 -- [-977.536] (-978.623) (-980.663) (-979.932) * (-980.029) [-979.367] (-978.254) (-981.685) -- 0:00:01
Average standard deviation of split frequencies: 0.008147
975500 -- (-979.631) (-978.638) (-978.813) [-985.565] * (-980.317) (-980.431) [-978.728] (-980.303) -- 0:00:01
976000 -- (-979.557) (-978.530) [-976.741] (-979.580) * (-981.638) [-979.653] (-985.895) (-977.361) -- 0:00:01
976500 -- (-979.797) (-978.584) (-978.137) [-982.174] * (-977.986) (-987.304) (-982.993) [-977.295] -- 0:00:01
977000 -- [-978.777] (-981.803) (-978.632) (-982.260) * (-978.094) (-979.747) [-981.535] (-977.750) -- 0:00:01
977500 -- (-978.121) (-979.926) [-980.415] (-986.077) * (-977.605) (-978.094) [-977.475] (-977.062) -- 0:00:01
978000 -- (-976.838) (-982.238) [-978.223] (-980.515) * (-978.279) (-979.997) [-978.161] (-978.710) -- 0:00:01
978500 -- (-980.360) [-983.069] (-981.023) (-977.145) * (-978.699) (-978.792) (-979.488) [-979.967] -- 0:00:01
979000 -- [-978.958] (-984.433) (-979.608) (-981.378) * (-979.202) [-977.540] (-978.409) (-979.734) -- 0:00:01
979500 -- [-979.183] (-988.643) (-979.516) (-980.247) * (-980.533) (-978.382) (-978.074) [-977.783] -- 0:00:01
980000 -- (-978.323) (-982.417) [-978.276] (-979.938) * [-982.099] (-978.250) (-977.516) (-978.708) -- 0:00:01
Average standard deviation of split frequencies: 0.008172
980500 -- (-980.018) (-978.559) (-984.305) [-979.679] * (-981.706) (-977.728) (-978.832) [-979.634] -- 0:00:01
981000 -- (-982.614) [-977.492] (-982.364) (-981.377) * (-983.517) [-977.361] (-978.203) (-980.272) -- 0:00:01
981500 -- (-978.303) (-979.592) (-981.463) [-978.815] * [-979.294] (-978.190) (-977.430) (-979.132) -- 0:00:01
982000 -- (-979.044) (-979.279) (-977.154) [-979.579] * (-978.298) [-980.173] (-979.860) (-979.010) -- 0:00:01
982500 -- [-979.691] (-981.013) (-981.695) (-979.572) * [-979.300] (-980.628) (-980.325) (-978.587) -- 0:00:01
983000 -- [-978.934] (-980.338) (-980.605) (-982.231) * (-980.382) (-977.731) [-978.317] (-979.307) -- 0:00:01
983500 -- (-979.622) (-979.497) [-978.896] (-978.632) * (-980.724) [-977.377] (-977.550) (-978.700) -- 0:00:01
984000 -- (-980.190) (-981.485) (-979.558) [-978.273] * (-979.958) (-979.514) (-980.556) [-980.422] -- 0:00:00
984500 -- (-979.928) (-981.501) [-979.445] (-981.168) * (-978.019) [-977.716] (-978.073) (-978.309) -- 0:00:00
985000 -- [-978.589] (-979.455) (-977.647) (-979.435) * (-980.286) (-981.615) [-978.601] (-978.891) -- 0:00:00
Average standard deviation of split frequencies: 0.007679
985500 -- [-979.470] (-989.544) (-979.552) (-978.261) * (-977.862) [-981.720] (-978.838) (-980.191) -- 0:00:00
986000 -- (-980.101) [-977.979] (-978.441) (-977.044) * (-978.472) (-977.962) [-979.615] (-979.886) -- 0:00:00
986500 -- (-979.571) (-977.299) [-980.491] (-978.974) * (-978.946) (-977.377) [-981.685] (-978.644) -- 0:00:00
987000 -- (-979.904) (-977.846) [-978.972] (-978.887) * [-982.027] (-977.607) (-978.729) (-977.747) -- 0:00:00
987500 -- (-981.617) [-979.377] (-978.053) (-979.000) * (-982.202) (-977.550) (-981.049) [-978.825] -- 0:00:00
988000 -- (-979.957) [-978.796] (-979.049) (-978.011) * (-977.728) (-979.760) (-976.993) [-980.698] -- 0:00:00
988500 -- (-982.432) (-981.197) (-979.136) [-978.056] * (-977.694) (-980.254) (-981.502) [-980.114] -- 0:00:00
989000 -- (-978.920) (-978.619) (-980.203) [-979.668] * (-977.527) [-980.277] (-979.420) (-978.360) -- 0:00:00
989500 -- (-981.692) [-978.733] (-978.553) (-978.486) * (-978.202) [-980.480] (-979.676) (-980.158) -- 0:00:00
990000 -- (-982.345) (-983.085) [-978.766] (-978.306) * (-977.758) (-980.348) (-982.486) [-977.113] -- 0:00:00
Average standard deviation of split frequencies: 0.007703
990500 -- (-981.594) (-980.455) [-977.802] (-980.154) * (-977.216) [-981.892] (-979.900) (-978.044) -- 0:00:00
991000 -- (-983.343) (-978.253) [-978.974] (-979.633) * (-980.350) (-978.205) [-979.738] (-978.171) -- 0:00:00
991500 -- (-978.338) (-978.541) (-979.643) [-977.733] * (-978.192) [-978.175] (-978.674) (-978.173) -- 0:00:00
992000 -- (-978.590) (-978.540) [-980.207] (-982.734) * (-979.852) (-983.742) (-977.636) [-978.317] -- 0:00:00
992500 -- (-980.188) (-977.350) (-981.221) [-978.764] * (-979.490) [-981.778] (-979.201) (-981.280) -- 0:00:00
993000 -- (-982.331) (-977.905) [-978.784] (-977.820) * (-981.850) (-980.714) [-978.003] (-982.093) -- 0:00:00
993500 -- (-986.896) (-980.767) [-979.435] (-976.951) * (-979.211) [-979.644] (-978.624) (-978.763) -- 0:00:00
994000 -- (-985.435) [-978.469] (-978.179) (-979.613) * [-977.721] (-978.775) (-978.515) (-982.377) -- 0:00:00
994500 -- (-978.678) (-978.240) (-976.955) [-977.594] * (-976.811) (-977.649) (-978.335) [-979.981] -- 0:00:00
995000 -- (-979.540) (-982.256) (-976.926) [-977.180] * (-981.687) (-979.575) (-980.678) [-978.171] -- 0:00:00
Average standard deviation of split frequencies: 0.007721
995500 -- (-978.310) (-981.256) [-978.189] (-978.519) * (-980.005) (-978.001) (-978.248) [-977.702] -- 0:00:00
996000 -- (-980.090) (-979.178) [-978.285] (-977.422) * (-979.444) [-978.101] (-977.923) (-978.626) -- 0:00:00
996500 -- (-985.550) (-979.158) [-977.511] (-980.108) * (-982.107) [-978.921] (-979.934) (-977.784) -- 0:00:00
997000 -- (-980.230) (-981.864) (-979.991) [-977.439] * [-978.119] (-982.822) (-979.635) (-982.453) -- 0:00:00
997500 -- (-980.474) (-981.419) (-976.846) [-977.114] * (-977.953) (-980.733) [-979.202] (-978.464) -- 0:00:00
998000 -- (-981.693) [-977.288] (-978.811) (-978.852) * (-980.157) (-980.244) [-979.208] (-980.912) -- 0:00:00
998500 -- (-980.768) (-979.677) [-979.977] (-979.212) * (-981.701) (-979.775) [-977.100] (-978.788) -- 0:00:00
999000 -- (-981.908) [-978.406] (-979.056) (-978.924) * [-980.869] (-977.037) (-977.333) (-979.216) -- 0:00:00
999500 -- (-978.061) (-977.880) [-979.473] (-980.330) * (-979.737) (-977.046) (-977.550) [-979.563] -- 0:00:00
1000000 -- (-977.919) (-978.453) [-980.854] (-980.778) * [-978.330] (-977.539) (-980.896) (-979.837) -- 0:00:00
Average standard deviation of split frequencies: 0.007773
Analysis completed in 1 mins 1 seconds
Analysis used 59.99 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -976.64
Likelihood of best state for "cold" chain of run 2 was -976.64
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 62 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.1 % ( 25 %) Dirichlet(Pi{all})
29.3 % ( 19 %) Slider(Pi{all})
78.3 % ( 55 %) Multiplier(Alpha{1,2})
77.8 % ( 39 %) Multiplier(Alpha{3})
21.4 % ( 35 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.4 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 86 %) ParsSPR(Tau{all},V{all})
28.2 % ( 30 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.6 % ( 30 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 74 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
27.7 % ( 30 %) Dirichlet(Pi{all})
29.7 % ( 26 %) Slider(Pi{all})
78.8 % ( 54 %) Multiplier(Alpha{1,2})
77.6 % ( 43 %) Multiplier(Alpha{3})
21.7 % ( 32 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.0 % ( 60 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 93 %) ParsSPR(Tau{all},V{all})
28.1 % ( 24 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.5 % ( 28 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166837 0.82 0.67
3 | 166002 166371 0.84
4 | 166923 167160 166707
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167197 0.82 0.67
3 | 166619 166334 0.84
4 | 166288 166368 167194
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -978.40
| 21 2 1 |
| 1 22 12 2 1 1 1 1 1|
| 2 2 1 2 222 1 1 21 2 |
| 1 22 * 11 2 2 2 1 *11 1 1 2 |
|2 * 1 2 2*1 2 2 22 2 2 2 2 |
|1 1 11 12 1 2 121 21 11 *2 11* 22 2|
| 2 1 * 2 1 1 2 1 * 2 21 1 * |
| 12 1 2 2 1 |
| 2 211 12 2 |
| |
| 1 |
| 1 |
| |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -980.65
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -978.37 -982.21
2 -978.32 -981.88
--------------------------------------
TOTAL -978.34 -982.06
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.883088 0.088960 0.332389 1.450201 0.850294 1266.61 1310.46 1.000
r(A<->C){all} 0.165139 0.019800 0.000070 0.450294 0.127356 145.06 148.87 1.001
r(A<->G){all} 0.162869 0.019262 0.000104 0.444349 0.128510 187.16 260.24 1.000
r(A<->T){all} 0.166939 0.021235 0.000006 0.468323 0.124780 142.27 193.55 1.003
r(C<->G){all} 0.176239 0.022359 0.000019 0.481182 0.135307 210.88 230.67 1.006
r(C<->T){all} 0.168691 0.019481 0.000037 0.452433 0.132259 232.97 257.73 1.000
r(G<->T){all} 0.160124 0.019889 0.000086 0.451582 0.122541 270.32 275.16 1.000
pi(A){all} 0.205712 0.000222 0.175887 0.234366 0.205620 1328.57 1357.39 1.000
pi(C){all} 0.328606 0.000299 0.295388 0.361722 0.328137 1183.03 1275.15 1.000
pi(G){all} 0.287117 0.000276 0.252763 0.317856 0.287100 1265.03 1314.02 1.000
pi(T){all} 0.178565 0.000195 0.149597 0.204997 0.178471 1130.25 1219.72 1.001
alpha{1,2} 0.419459 0.227917 0.000122 1.395508 0.240716 1264.03 1272.21 1.000
alpha{3} 0.449759 0.224121 0.000254 1.400428 0.295382 973.32 994.98 1.000
pinvar{all} 0.997805 0.000007 0.992905 0.999999 0.998662 1344.74 1349.05 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...**.
8 -- .*.***
9 -- ..*..*
10 -- .**...
11 -- .*.*..
12 -- ....**
13 -- ...*.*
14 -- .***.*
15 -- .*..*.
16 -- .****.
17 -- ..*.*.
18 -- .**.**
19 -- .*...*
20 -- ..****
21 -- ..**..
22 -- .*.**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 457 0.152232 0.008009 0.146569 0.157895 2
8 456 0.151899 0.007537 0.146569 0.157229 2
9 449 0.149567 0.003298 0.147235 0.151899 2
10 448 0.149234 0.003769 0.146569 0.151899 2
11 440 0.146569 0.001884 0.145237 0.147901 2
12 435 0.144903 0.013662 0.135243 0.154564 2
13 432 0.143904 0.008480 0.137908 0.149900 2
14 422 0.140573 0.014133 0.130580 0.150566 2
15 422 0.140573 0.029208 0.119920 0.161226 2
16 417 0.138907 0.004240 0.135909 0.141905 2
17 412 0.137242 0.005653 0.133245 0.141239 2
18 408 0.135909 0.006595 0.131246 0.140573 2
19 407 0.135576 0.000471 0.135243 0.135909 2
20 407 0.135576 0.011777 0.127249 0.143904 2
21 403 0.134244 0.002355 0.132578 0.135909 2
22 301 0.100266 0.003298 0.097935 0.102598 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098056 0.009288 0.000003 0.291850 0.068725 1.000 2
length{all}[2] 0.098109 0.010136 0.000026 0.304055 0.066161 1.000 2
length{all}[3] 0.099244 0.010115 0.000033 0.294185 0.067817 1.000 2
length{all}[4] 0.096546 0.009991 0.000012 0.287439 0.066748 1.002 2
length{all}[5] 0.096123 0.009210 0.000031 0.291797 0.066462 1.000 2
length{all}[6] 0.095668 0.008992 0.000053 0.290000 0.067862 1.000 2
length{all}[7] 0.092475 0.008664 0.000088 0.265429 0.065826 0.999 2
length{all}[8] 0.101453 0.010986 0.000125 0.287933 0.070085 0.998 2
length{all}[9] 0.093948 0.008320 0.000143 0.269561 0.069829 1.000 2
length{all}[10] 0.096307 0.010317 0.000233 0.306752 0.062912 0.998 2
length{all}[11] 0.103035 0.010655 0.000161 0.315743 0.070282 0.998 2
length{all}[12] 0.106185 0.010735 0.000051 0.308791 0.071864 1.001 2
length{all}[13] 0.103712 0.009864 0.000183 0.318529 0.074054 0.999 2
length{all}[14] 0.101112 0.010731 0.000273 0.310533 0.069673 1.004 2
length{all}[15] 0.085744 0.006284 0.000140 0.250553 0.062362 1.003 2
length{all}[16] 0.101883 0.010289 0.000006 0.271242 0.073755 0.999 2
length{all}[17] 0.099202 0.010456 0.000179 0.313696 0.064755 0.998 2
length{all}[18] 0.100219 0.009706 0.000056 0.314548 0.072975 0.998 2
length{all}[19] 0.098863 0.010729 0.000002 0.301938 0.065587 1.000 2
length{all}[20] 0.108013 0.010671 0.000636 0.343191 0.072468 0.998 2
length{all}[21] 0.095004 0.009738 0.000302 0.292268 0.064599 0.998 2
length{all}[22] 0.100343 0.010994 0.000041 0.306185 0.064967 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007773
Maximum standard deviation of split frequencies = 0.029208
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 720
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 57 patterns at 240 / 240 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 57 patterns at 240 / 240 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
55632 bytes for conP
5016 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.037114 0.061226 0.014215 0.104728 0.074136 0.107196 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1039.590212
Iterating by ming2
Initial: fx= 1039.590212
x= 0.03711 0.06123 0.01421 0.10473 0.07414 0.10720 0.30000 1.30000
1 h-m-p 0.0000 0.0001 575.8197 ++ 1019.717964 m 0.0001 13 | 1/8
2 h-m-p 0.0007 0.0073 42.3183 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 526.0130 ++ 992.856932 m 0.0001 44 | 2/8
4 h-m-p 0.0015 0.0103 30.8509 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 471.6323 ++ 970.012528 m 0.0001 75 | 3/8
6 h-m-p 0.0022 0.0185 18.9715 ------------.. | 3/8
7 h-m-p 0.0000 0.0001 409.6541 ++ 960.771129 m 0.0001 107 | 4/8
8 h-m-p 0.0016 0.0366 11.6223 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 334.6241 ++ 946.048133 m 0.0001 138 | 5/8
10 h-m-p 0.0048 0.1233 6.5036 ------------.. | 5/8
11 h-m-p 0.0000 0.0000 237.9439 ++ 945.448834 m 0.0000 170 | 6/8
12 h-m-p 0.0160 8.0000 0.0000 +Y 945.448834 0 0.0640 182 | 6/8
13 h-m-p 1.3950 8.0000 0.0000 Y 945.448834 0 1.3950 195 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 ---Y 945.448834 0 0.0001 211
Out..
lnL = -945.448834
212 lfun, 212 eigenQcodon, 1272 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.039318 0.065557 0.087626 0.075479 0.081893 0.086604 0.299942 0.661316 0.480016
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.044481
np = 9
lnL0 = -1046.881949
Iterating by ming2
Initial: fx= 1046.881949
x= 0.03932 0.06556 0.08763 0.07548 0.08189 0.08660 0.29994 0.66132 0.48002
1 h-m-p 0.0000 0.0002 557.2681 +++ 992.978411 m 0.0002 15 | 1/9
2 h-m-p 0.0001 0.0004 321.6909 ++ 961.987921 m 0.0004 27 | 2/9
3 h-m-p 0.0000 0.0001 1342.6821 ++ 952.112514 m 0.0001 39 | 3/9
4 h-m-p 0.0000 0.0002 513.6309 ++ 947.719807 m 0.0002 51 | 4/9
5 h-m-p 0.0000 0.0000 6804.4410 ++ 945.651774 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 10487.5199 ++ 945.448820 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0007 ++ 945.448820 m 8.0000 87 | 6/9
8 h-m-p 0.0204 3.2236 0.2886 ---------Y 945.448820 0 0.0000 111 | 6/9
9 h-m-p 0.0160 8.0000 0.0001 +++++ 945.448820 m 8.0000 129 | 6/9
10 h-m-p 0.0077 3.8326 0.2916 ----------Y 945.448820 0 0.0000 154 | 6/9
11 h-m-p 0.0160 8.0000 0.0001 +++++ 945.448820 m 8.0000 172 | 6/9
12 h-m-p 0.0047 2.3327 0.2887 --------Y 945.448820 0 0.0000 195 | 6/9
13 h-m-p 0.0160 8.0000 0.0000 --C 945.448820 0 0.0003 212 | 6/9
14 h-m-p 0.0160 8.0000 0.0000 +++++ 945.448820 m 8.0000 230 | 6/9
15 h-m-p 0.0010 0.5223 0.2301 +++++ 945.448819 m 0.5223 248 | 7/9
16 h-m-p 0.1064 5.0375 0.9108 +++ 945.448788 m 5.0375 264 | 8/9
17 h-m-p 1.6000 8.0000 0.0476 ++ 945.448788 m 8.0000 278 | 8/9
18 h-m-p 0.1503 8.0000 2.5329 -------Y 945.448788 0 0.0000 298 | 8/9
19 h-m-p 0.9101 8.0000 0.0000 ++ 945.448788 m 8.0000 310 | 8/9
20 h-m-p 1.6000 8.0000 0.0000 C 945.448788 0 0.4000 323 | 8/9
21 h-m-p 0.0370 8.0000 0.0000 --------------.. | 8/9
22 h-m-p 0.0160 8.0000 0.0000 ----------Y 945.448788 0 0.0000 371
Out..
lnL = -945.448788
372 lfun, 1116 eigenQcodon, 4464 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.072189 0.042608 0.079617 0.011666 0.054857 0.066951 4.372105 1.207460 0.515852 0.101428 1.470605
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 3.760150
np = 11
lnL0 = -1017.514258
Iterating by ming2
Initial: fx= 1017.514258
x= 0.07219 0.04261 0.07962 0.01167 0.05486 0.06695 4.37210 1.20746 0.51585 0.10143 1.47061
1 h-m-p 0.0000 0.0001 500.5690 ++ 1003.214019 m 0.0001 16 | 1/11
2 h-m-p 0.0001 0.0005 212.3858 ++ 983.635850 m 0.0005 30 | 2/11
3 h-m-p 0.0006 0.0029 83.2772 ++ 969.659781 m 0.0029 44 | 3/11
4 h-m-p 0.0001 0.0005 136.3474 ++ 960.568070 m 0.0005 58 | 4/11
5 h-m-p 0.0000 0.0001 2570.9168 ++ 954.531031 m 0.0001 72 | 5/11
6 h-m-p 0.0000 0.0001 3198.7164 ++ 950.987340 m 0.0001 86 | 6/11
7 h-m-p 0.0001 0.0003 1867.2430 ++ 945.448817 m 0.0003 100 | 7/11
8 h-m-p 1.6000 8.0000 0.0000 ++ 945.448817 m 8.0000 114 | 7/11
9 h-m-p 0.0160 8.0000 0.0143 +++++ 945.448816 m 8.0000 135 | 7/11
10 h-m-p 0.0354 8.0000 3.2282 --------------.. | 7/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 945.448816 m 8.0000 182 | 7/11
12 h-m-p 0.0160 8.0000 0.0127 +++++ 945.448816 m 8.0000 203 | 7/11
13 h-m-p 0.0437 8.0000 2.3323 --------------.. | 7/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 945.448816 m 8.0000 250 | 7/11
15 h-m-p 0.0189 8.0000 0.0040 ------C 945.448816 0 0.0000 274 | 7/11
16 h-m-p 0.0160 8.0000 0.0000 -----------C 945.448816 0 0.0000 303 | 7/11
17 h-m-p 0.0160 8.0000 0.0000 -----------Y 945.448816 0 0.0000 332
Out..
lnL = -945.448816
333 lfun, 1332 eigenQcodon, 5994 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -945.462834 S = -945.446016 -0.006445
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:03
did 20 / 57 patterns 0:03
did 30 / 57 patterns 0:03
did 40 / 57 patterns 0:03
did 50 / 57 patterns 0:03
did 57 / 57 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.077581 0.062362 0.093059 0.089547 0.028000 0.047492 4.397809 0.507353 1.561280
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 5.785139
np = 9
lnL0 = -1035.199798
Iterating by ming2
Initial: fx= 1035.199798
x= 0.07758 0.06236 0.09306 0.08955 0.02800 0.04749 4.39781 0.50735 1.56128
1 h-m-p 0.0000 0.0001 528.0335 ++ 998.883373 m 0.0001 14 | 1/9
2 h-m-p 0.0018 0.0157 35.0601 ++ 993.244101 m 0.0157 26 | 2/9
3 h-m-p 0.0001 0.0003 2406.7141 ++ 975.137993 m 0.0003 38 | 3/9
4 h-m-p 0.0001 0.0003 734.6908 ++ 969.452717 m 0.0003 50 | 4/9
5 h-m-p 0.0001 0.0007 192.8613 ++ 969.350439 m 0.0007 62 | 5/9
6 h-m-p 0.0113 0.0641 12.6837 -------------.. | 5/9
7 h-m-p 0.0000 0.0002 319.6465 +++ 950.388869 m 0.0002 98 | 6/9
8 h-m-p 0.0249 8.0000 1.6433 -------------.. | 6/9
9 h-m-p 0.0000 0.0001 231.9913 ++ 945.448788 m 0.0001 133 | 7/9
10 h-m-p 1.6000 8.0000 0.0000 C 945.448788 0 1.6000 145 | 7/9
11 h-m-p 1.6000 8.0000 0.0000 Y 945.448788 0 0.4000 159
Out..
lnL = -945.448788
160 lfun, 1760 eigenQcodon, 9600 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.016146 0.108859 0.085128 0.026092 0.088726 0.028254 4.502813 0.900000 0.782725 1.264198 1.299979
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 4.141913
np = 11
lnL0 = -1024.818291
Iterating by ming2
Initial: fx= 1024.818291
x= 0.01615 0.10886 0.08513 0.02609 0.08873 0.02825 4.50281 0.90000 0.78273 1.26420 1.29998
1 h-m-p 0.0000 0.0001 526.1186 ++ 1004.042831 m 0.0001 16 | 1/11
2 h-m-p 0.0001 0.0007 144.7005 ++ 991.686485 m 0.0007 30 | 2/11
3 h-m-p 0.0000 0.0000 368.6820 ++ 989.621047 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0028 199.9132 ++++ 950.898807 m 0.0028 60 | 4/11
5 h-m-p 0.0000 0.0000 3537.3592 ++ 949.412414 m 0.0000 74 | 5/11
6 h-m-p 0.0006 0.0065 81.5055 -----------.. | 5/11
7 h-m-p 0.0000 0.0001 234.1495 ++ 945.448823 m 0.0001 111 | 6/11
8 h-m-p 0.4930 8.0000 0.0000 +++ 945.448823 m 8.0000 126 | 6/11
9 h-m-p 0.0263 8.0000 0.0026 -----C 945.448823 0 0.0000 150 | 6/11
10 h-m-p 0.0160 8.0000 0.0001 ------C 945.448823 0 0.0000 175 | 6/11
11 h-m-p 0.0160 8.0000 0.0005 +++++ 945.448823 m 8.0000 197 | 6/11
12 h-m-p 0.0011 0.2233 3.6402 -----------.. | 6/11
13 h-m-p 0.0160 8.0000 0.0000 +++++ 945.448823 m 8.0000 242 | 6/11
14 h-m-p 0.0160 8.0000 0.0263 +++++ 945.448817 m 8.0000 264 | 6/11
15 h-m-p 0.3309 1.6544 0.4903 ------------Y 945.448817 0 0.0000 295 | 6/11
16 h-m-p 0.0160 8.0000 0.0002 +++++ 945.448817 m 8.0000 317 | 6/11
17 h-m-p 0.0049 2.4654 0.3161 --------C 945.448817 0 0.0000 344 | 6/11
18 h-m-p 0.0160 8.0000 0.0002 +++++ 945.448817 m 8.0000 366 | 6/11
19 h-m-p 0.0038 1.9099 0.5034 --------Y 945.448817 0 0.0000 393 | 6/11
20 h-m-p 0.0160 8.0000 0.0002 +++++ 945.448817 m 8.0000 415 | 6/11
21 h-m-p 0.0034 1.6855 0.5896 -----------Y 945.448817 0 0.0000 445 | 6/11
22 h-m-p 0.0160 8.0000 0.0000 +++++ 945.448817 m 8.0000 467 | 6/11
23 h-m-p 0.0160 8.0000 0.1542 -------Y 945.448817 0 0.0000 493 | 6/11
24 h-m-p 0.0160 8.0000 0.0001 --Y 945.448817 0 0.0003 514 | 6/11
25 h-m-p 0.0160 8.0000 0.0018 +++++ 945.448817 m 8.0000 536 | 6/11
26 h-m-p 0.0002 0.0144 62.9324 +++ 945.448813 m 0.0144 556 | 7/11
27 h-m-p 0.8277 5.7729 1.0628 +
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
+ 945.448788 m 5.7729 570
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.97694) = 3.887026e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755906e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
| 7/11
28 h-m-p 0.0000 0.0000 0.1244
h-m-p: 1.12206168e-16 5.61030842e-16 1.24376935e-01 945.448788
..
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.97715) = 3.755768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.97674) = 3.756049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
| 8/11
29 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
N 945.448788 0 0.0010 600
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
Out..
lnL = -945.448788
601 lfun, 7212 eigenQcodon, 39666 P(t)
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -945.499451 S = -945.449577 -0.022105
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:16
did 20 / 57 patterns 0:17
did 30 / 57 patterns 0:17
did 40 / 57 patterns 0:17
did 50 / 57 patterns 0:17
did 57 / 57 patterns 0:17
QuantileBeta(0.15, 0.00500, 5.97694) = 3.755908e-161 2000 rounds
Time used: 0:17
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=240
NC_011896_1_WP_010908619_1_2054_MLBR_RS09755 MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
NC_002677_1_NP_302298_1_1170_sodC MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
NZ_LVXE01000051_1_WP_010908619_1_2128_A3216_RS11500 MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
NZ_LYPH01000057_1_WP_010908619_1_2141_A8144_RS10230 MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
NZ_CP029543_1_WP_010908619_1_2079_DIJ64_RS10590 MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
NZ_AP014567_1_WP_010908619_1_2135_JK2ML_RS10870 MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW
**************************************************
NC_011896_1_WP_010908619_1_2054_MLBR_RS09755 TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
NC_002677_1_NP_302298_1_1170_sodC TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
NZ_LVXE01000051_1_WP_010908619_1_2128_A3216_RS11500 TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
NZ_LYPH01000057_1_WP_010908619_1_2141_A8144_RS10230 TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
NZ_CP029543_1_WP_010908619_1_2079_DIJ64_RS10590 TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
NZ_AP014567_1_WP_010908619_1_2135_JK2ML_RS10870 TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI
**************************************************
NC_011896_1_WP_010908619_1_2054_MLBR_RS09755 ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
NC_002677_1_NP_302298_1_1170_sodC ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
NZ_LVXE01000051_1_WP_010908619_1_2128_A3216_RS11500 ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
NZ_LYPH01000057_1_WP_010908619_1_2141_A8144_RS10230 ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
NZ_CP029543_1_WP_010908619_1_2079_DIJ64_RS10590 ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
NZ_AP014567_1_WP_010908619_1_2135_JK2ML_RS10870 ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH
**************************************************
NC_011896_1_WP_010908619_1_2054_MLBR_RS09755 TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
NC_002677_1_NP_302298_1_1170_sodC TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
NZ_LVXE01000051_1_WP_010908619_1_2128_A3216_RS11500 TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
NZ_LYPH01000057_1_WP_010908619_1_2141_A8144_RS10230 TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
NZ_CP029543_1_WP_010908619_1_2079_DIJ64_RS10590 TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
NZ_AP014567_1_WP_010908619_1_2135_JK2ML_RS10870 TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN
**************************************************
NC_011896_1_WP_010908619_1_2054_MLBR_RS09755 FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
NC_002677_1_NP_302298_1_1170_sodC FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
NZ_LVXE01000051_1_WP_010908619_1_2128_A3216_RS11500 FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
NZ_LYPH01000057_1_WP_010908619_1_2141_A8144_RS10230 FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
NZ_CP029543_1_WP_010908619_1_2079_DIJ64_RS10590 FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
NZ_AP014567_1_WP_010908619_1_2135_JK2ML_RS10870 FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
****************************************
>NC_011896_1_WP_010908619_1_2054_MLBR_RS09755 ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT GCGGTGTCATCGGCGCCGAC >NC_002677_1_NP_302298_1_1170_sodC ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT GCGGTGTCATCGGCGCCGAC >NZ_LVXE01000051_1_WP_010908619_1_2128_A3216_RS11500 ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT GCGGTGTCATCGGCGCCGAC >NZ_LYPH01000057_1_WP_010908619_1_2141_A8144_RS10230 ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT GCGGTGTCATCGGCGCCGAC >NZ_CP029543_1_WP_010908619_1_2079_DIJ64_RS10590 ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT GCGGTGTCATCGGCGCCGAC >NZ_AP014567_1_WP_010908619_1_2135_JK2ML_RS10870 ATGTCTAAACTCGCCGGTCACCGCAATGTCGCTGCCGTTACCAGGTCAGC GCTGTCCCTGTCGTTTGTGGCCGCCTGCGTCGCACTGTTGAGCGCGTGTA TCCAGAACCAACCCCCAGCGACCTTGCCGGGTACCACTCCAACGGTTTGG ACTGGATCACCCGCGCCGTCAGGAATGTTGGGTGCCGAGGCCGAATCGAT GGGGCCACCGAACATAATCACTCGTCTGAATGCTCCCGACGGCACCCAGG TCGCTACGGCGAAGTTCGAGTTCAACAACGGATTTGCCACCATCACGATC GCGACGACCGGCGTAGGTCATCTGGCTCCGGGATTCCACGGAGTGCACAT TCACAAGGTGGGTAAATGTGAGCCCAGCTCAGCCGGGCCAACCGGTGGCG CGCCCGGCGACTTCTTATCCGCCGGCGGGCATTTCCAGGTGCCTGGACAC ACCGTCGAGCCTGCCAGCGGCAATCTTACCTCACTTCAAGTGCGTAAAGA CGGTATCGGGACGCTGGTGACCACCACGGACGCGTTCACCATGAATGATC TACTAGCCGGCCAGAAAACCGCCATCATCATTCACGCAGGTGCCGACAAC TTCGGCAACATTCCGCCGGAGCGCTACAGCCAGGTCAACGGCACACCGGG TCCCGACGCGACGACGATCAGCACTGGTGACGCCGGCAAACGGGTAGCGT GCGGTGTCATCGGCGCCGAC
>NC_011896_1_WP_010908619_1_2054_MLBR_RS09755 MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD >NC_002677_1_NP_302298_1_1170_sodC MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD >NZ_LVXE01000051_1_WP_010908619_1_2128_A3216_RS11500 MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD >NZ_LYPH01000057_1_WP_010908619_1_2141_A8144_RS10230 MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD >NZ_CP029543_1_WP_010908619_1_2079_DIJ64_RS10590 MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD >NZ_AP014567_1_WP_010908619_1_2135_JK2ML_RS10870 MSKLAGHRNVAAVTRSALSLSFVAACVALLSACIQNQPPATLPGTTPTVW TGSPAPSGMLGAEAESMGPPNIITRLNAPDGTQVATAKFEFNNGFATITI ATTGVGHLAPGFHGVHIHKVGKCEPSSAGPTGGAPGDFLSAGGHFQVPGH TVEPASGNLTSLQVRKDGIGTLVTTTDAFTMNDLLAGQKTAIIIHAGADN FGNIPPERYSQVNGTPGPDATTISTGDAGKRVACGVIGAD
#NEXUS
[ID: 0962090388]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908619_1_2054_MLBR_RS09755
NC_002677_1_NP_302298_1_1170_sodC
NZ_LVXE01000051_1_WP_010908619_1_2128_A3216_RS11500
NZ_LYPH01000057_1_WP_010908619_1_2141_A8144_RS10230
NZ_CP029543_1_WP_010908619_1_2079_DIJ64_RS10590
NZ_AP014567_1_WP_010908619_1_2135_JK2ML_RS10870
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908619_1_2054_MLBR_RS09755,
2 NC_002677_1_NP_302298_1_1170_sodC,
3 NZ_LVXE01000051_1_WP_010908619_1_2128_A3216_RS11500,
4 NZ_LYPH01000057_1_WP_010908619_1_2141_A8144_RS10230,
5 NZ_CP029543_1_WP_010908619_1_2079_DIJ64_RS10590,
6 NZ_AP014567_1_WP_010908619_1_2135_JK2ML_RS10870
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06872538,2:0.06616142,3:0.06781671,4:0.06674818,5:0.06646224,6:0.06786226);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06872538,2:0.06616142,3:0.06781671,4:0.06674818,5:0.06646224,6:0.06786226);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -978.37 -982.21
2 -978.32 -981.88
--------------------------------------
TOTAL -978.34 -982.06
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/sodC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.883088 0.088960 0.332389 1.450201 0.850294 1266.61 1310.46 1.000
r(A<->C){all} 0.165139 0.019800 0.000070 0.450294 0.127356 145.06 148.87 1.001
r(A<->G){all} 0.162869 0.019262 0.000104 0.444349 0.128510 187.16 260.24 1.000
r(A<->T){all} 0.166939 0.021235 0.000006 0.468323 0.124780 142.27 193.55 1.003
r(C<->G){all} 0.176239 0.022359 0.000019 0.481182 0.135307 210.88 230.67 1.006
r(C<->T){all} 0.168691 0.019481 0.000037 0.452433 0.132259 232.97 257.73 1.000
r(G<->T){all} 0.160124 0.019889 0.000086 0.451582 0.122541 270.32 275.16 1.000
pi(A){all} 0.205712 0.000222 0.175887 0.234366 0.205620 1328.57 1357.39 1.000
pi(C){all} 0.328606 0.000299 0.295388 0.361722 0.328137 1183.03 1275.15 1.000
pi(G){all} 0.287117 0.000276 0.252763 0.317856 0.287100 1265.03 1314.02 1.000
pi(T){all} 0.178565 0.000195 0.149597 0.204997 0.178471 1130.25 1219.72 1.001
alpha{1,2} 0.419459 0.227917 0.000122 1.395508 0.240716 1264.03 1272.21 1.000
alpha{3} 0.449759 0.224121 0.000254 1.400428 0.295382 973.32 994.98 1.000
pinvar{all} 0.997805 0.000007 0.992905 0.999999 0.998662 1344.74 1349.05 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/12res/sodC/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 240
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 2 2 2 2 2 2
TTC 7 7 7 7 7 7 | TCC 2 2 2 2 2 2 | TAC 1 1 1 1 1 1 | TGC 2 2 2 2 2 2
Leu TTA 1 1 1 1 1 1 | TCA 5 5 5 5 5 5 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 2 2 2 2 2 2 | His CAT 2 2 2 2 2 2 | Arg CGT 2 2 2 2 2 2
CTC 1 1 1 1 1 1 | CCC 6 6 6 6 6 6 | CAC 6 6 6 6 6 6 | CGC 2 2 2 2 2 2
CTA 2 2 2 2 2 2 | CCA 4 4 4 4 4 4 | Gln CAA 2 2 2 2 2 2 | CGA 0 0 0 0 0 0
CTG 6 6 6 6 6 6 | CCG 7 7 7 7 7 7 | CAG 5 5 5 5 5 5 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 4 4 4 4 4 4 | Asn AAT 4 4 4 4 4 4 | Ser AGT 0 0 0 0 0 0
ATC 9 9 9 9 9 9 | ACC 13 13 13 13 13 13 | AAC 7 7 7 7 7 7 | AGC 5 5 5 5 5 5
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 5 5 5 5 5 5 | Arg AGA 0 0 0 0 0 0
Met ATG 4 4 4 4 4 4 | ACG 8 8 8 8 8 8 | AAG 2 2 2 2 2 2 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 4 4 4 4 4 4 | Asp GAT 1 1 1 1 1 1 | Gly GGT 11 11 11 11 11 11
GTC 6 6 6 6 6 6 | GCC 15 15 15 15 15 15 | GAC 8 8 8 8 8 8 | GGC 11 11 11 11 11 11
GTA 2 2 2 2 2 2 | GCA 2 2 2 2 2 2 | Glu GAA 1 1 1 1 1 1 | GGA 6 6 6 6 6 6
GTG 6 6 6 6 6 6 | GCG 10 10 10 10 10 10 | GAG 5 5 5 5 5 5 | GGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908619_1_2054_MLBR_RS09755
position 1: T:0.12083 C:0.20833 A:0.27917 G:0.39167
position 2: T:0.23750 C:0.35833 A:0.20417 G:0.20000
position 3: T:0.17500 C:0.42083 A:0.13333 G:0.27083
Average T:0.17778 C:0.32917 A:0.20556 G:0.28750
#2: NC_002677_1_NP_302298_1_1170_sodC
position 1: T:0.12083 C:0.20833 A:0.27917 G:0.39167
position 2: T:0.23750 C:0.35833 A:0.20417 G:0.20000
position 3: T:0.17500 C:0.42083 A:0.13333 G:0.27083
Average T:0.17778 C:0.32917 A:0.20556 G:0.28750
#3: NZ_LVXE01000051_1_WP_010908619_1_2128_A3216_RS11500
position 1: T:0.12083 C:0.20833 A:0.27917 G:0.39167
position 2: T:0.23750 C:0.35833 A:0.20417 G:0.20000
position 3: T:0.17500 C:0.42083 A:0.13333 G:0.27083
Average T:0.17778 C:0.32917 A:0.20556 G:0.28750
#4: NZ_LYPH01000057_1_WP_010908619_1_2141_A8144_RS10230
position 1: T:0.12083 C:0.20833 A:0.27917 G:0.39167
position 2: T:0.23750 C:0.35833 A:0.20417 G:0.20000
position 3: T:0.17500 C:0.42083 A:0.13333 G:0.27083
Average T:0.17778 C:0.32917 A:0.20556 G:0.28750
#5: NZ_CP029543_1_WP_010908619_1_2079_DIJ64_RS10590
position 1: T:0.12083 C:0.20833 A:0.27917 G:0.39167
position 2: T:0.23750 C:0.35833 A:0.20417 G:0.20000
position 3: T:0.17500 C:0.42083 A:0.13333 G:0.27083
Average T:0.17778 C:0.32917 A:0.20556 G:0.28750
#6: NZ_AP014567_1_WP_010908619_1_2135_JK2ML_RS10870
position 1: T:0.12083 C:0.20833 A:0.27917 G:0.39167
position 2: T:0.23750 C:0.35833 A:0.20417 G:0.20000
position 3: T:0.17500 C:0.42083 A:0.13333 G:0.27083
Average T:0.17778 C:0.32917 A:0.20556 G:0.28750
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 6 | Tyr Y TAT 0 | Cys C TGT 12
TTC 42 | TCC 12 | TAC 6 | TGC 12
Leu L TTA 6 | TCA 30 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 12 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 12 | His H CAT 12 | Arg R CGT 12
CTC 6 | CCC 36 | CAC 36 | CGC 12
CTA 12 | CCA 24 | Gln Q CAA 12 | CGA 0
CTG 36 | CCG 42 | CAG 30 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 24 | Asn N AAT 24 | Ser S AGT 0
ATC 54 | ACC 78 | AAC 42 | AGC 30
ATA 6 | ACA 6 | Lys K AAA 30 | Arg R AGA 0
Met M ATG 24 | ACG 48 | AAG 12 | AGG 6
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 24 | Asp D GAT 6 | Gly G GGT 66
GTC 36 | GCC 90 | GAC 48 | GGC 66
GTA 12 | GCA 12 | Glu E GAA 6 | GGA 36
GTG 36 | GCG 60 | GAG 30 | GGG 24
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12083 C:0.20833 A:0.27917 G:0.39167
position 2: T:0.23750 C:0.35833 A:0.20417 G:0.20000
position 3: T:0.17500 C:0.42083 A:0.13333 G:0.27083
Average T:0.17778 C:0.32917 A:0.20556 G:0.28750
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -945.448834 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299942 1.299979
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908619_1_2054_MLBR_RS09755: 0.000004, NC_002677_1_NP_302298_1_1170_sodC: 0.000004, NZ_LVXE01000051_1_WP_010908619_1_2128_A3216_RS11500: 0.000004, NZ_LYPH01000057_1_WP_010908619_1_2141_A8144_RS10230: 0.000004, NZ_CP029543_1_WP_010908619_1_2079_DIJ64_RS10590: 0.000004, NZ_AP014567_1_WP_010908619_1_2135_JK2ML_RS10870: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29994
omega (dN/dS) = 1.29998
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 536.7 183.3 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 536.7 183.3 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 536.7 183.3 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 536.7 183.3 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 536.7 183.3 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 536.7 183.3 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -945.448788 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 4.372105 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908619_1_2054_MLBR_RS09755: 0.000004, NC_002677_1_NP_302298_1_1170_sodC: 0.000004, NZ_LVXE01000051_1_WP_010908619_1_2128_A3216_RS11500: 0.000004, NZ_LYPH01000057_1_WP_010908619_1_2141_A8144_RS10230: 0.000004, NZ_CP029543_1_WP_010908619_1_2079_DIJ64_RS10590: 0.000004, NZ_AP014567_1_WP_010908619_1_2135_JK2ML_RS10870: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 4.37210
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 524.3 195.7 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 524.3 195.7 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 524.3 195.7 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 524.3 195.7 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 524.3 195.7 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 524.3 195.7 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -945.448816 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 4.397809 0.678178 0.179503 0.000001 1.943865
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908619_1_2054_MLBR_RS09755: 0.000004, NC_002677_1_NP_302298_1_1170_sodC: 0.000004, NZ_LVXE01000051_1_WP_010908619_1_2128_A3216_RS11500: 0.000004, NZ_LYPH01000057_1_WP_010908619_1_2141_A8144_RS10230: 0.000004, NZ_CP029543_1_WP_010908619_1_2079_DIJ64_RS10590: 0.000004, NZ_AP014567_1_WP_010908619_1_2135_JK2ML_RS10870: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 4.39781
MLEs of dN/dS (w) for site classes (K=3)
p: 0.67818 0.17950 0.14232
w: 0.00000 1.00000 1.94386
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 524.3 195.7 0.4562 0.0000 0.0000 0.0 0.0
7..2 0.000 524.3 195.7 0.4562 0.0000 0.0000 0.0 0.0
7..3 0.000 524.3 195.7 0.4562 0.0000 0.0000 0.0 0.0
7..4 0.000 524.3 195.7 0.4562 0.0000 0.0000 0.0 0.0
7..5 0.000 524.3 195.7 0.4562 0.0000 0.0000 0.0 0.0
7..6 0.000 524.3 195.7 0.4562 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908619_1_2054_MLBR_RS09755)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908619_1_2054_MLBR_RS09755)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -945.448788 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 4.502813 0.005000 0.774785
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908619_1_2054_MLBR_RS09755: 0.000004, NC_002677_1_NP_302298_1_1170_sodC: 0.000004, NZ_LVXE01000051_1_WP_010908619_1_2128_A3216_RS11500: 0.000004, NZ_LYPH01000057_1_WP_010908619_1_2141_A8144_RS10230: 0.000004, NZ_CP029543_1_WP_010908619_1_2079_DIJ64_RS10590: 0.000004, NZ_AP014567_1_WP_010908619_1_2135_JK2ML_RS10870: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 4.50281
Parameters in M7 (beta):
p = 0.00500 q = 0.77478
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00005
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 524.2 195.8 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 524.2 195.8 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 524.2 195.8 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 524.2 195.8 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 524.2 195.8 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 524.2 195.8 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -945.448788 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.939227 0.999990 0.005000 5.976941 1.806905
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908619_1_2054_MLBR_RS09755: 0.000004, NC_002677_1_NP_302298_1_1170_sodC: 0.000004, NZ_LVXE01000051_1_WP_010908619_1_2128_A3216_RS11500: 0.000004, NZ_LYPH01000057_1_WP_010908619_1_2141_A8144_RS10230: 0.000004, NZ_CP029543_1_WP_010908619_1_2079_DIJ64_RS10590: 0.000004, NZ_AP014567_1_WP_010908619_1_2135_JK2ML_RS10870: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.93923
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 5.97694
(p1 = 0.00001) w = 1.80691
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.80691
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 528.5 191.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 528.5 191.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 528.5 191.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 528.5 191.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 528.5 191.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 528.5 191.5 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908619_1_2054_MLBR_RS09755)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.096 0.097 0.098 0.099 0.100 0.100 0.101 0.102 0.103 0.104
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.104 0.103 0.102 0.101 0.100 0.100 0.099 0.098 0.097 0.097
Time used: 0:17
Model 1: NearlyNeutral -945.448788 Model 2: PositiveSelection -945.448816 Model 0: one-ratio -945.448834 Model 7: beta -945.448788 Model 8: beta&w>1 -945.448788 Model 0 vs 1 9.1999999995096E-5 Model 2 vs 1 5.599999985861359E-5 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
