--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:21:54 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/ssb/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -681.14          -685.33
2       -681.08          -683.63
--------------------------------------
TOTAL     -681.11          -684.81
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.895974    0.090815    0.371161    1.495268    0.863542   1501.00   1501.00    1.000
r(A<->C){all}   0.166926    0.020006    0.000184    0.452825    0.127294    253.06    353.95    1.000
r(A<->G){all}   0.171694    0.021797    0.000006    0.469840    0.129298    119.21    183.40    1.016
r(A<->T){all}   0.169631    0.020561    0.000018    0.468419    0.131642    162.75    283.84    1.006
r(C<->G){all}   0.165455    0.020089    0.000066    0.459756    0.126715    198.78    232.72    1.009
r(C<->T){all}   0.163064    0.019326    0.000097    0.443348    0.125228    188.71    367.19    1.000
r(G<->T){all}   0.163230    0.019396    0.000044    0.444896    0.127410    254.69    260.11    1.011
pi(A){all}      0.181300    0.000294    0.147552    0.214284    0.181481   1193.84   1255.57    1.000
pi(C){all}      0.281695    0.000405    0.243359    0.322064    0.281318   1161.15   1298.38    1.000
pi(G){all}      0.348193    0.000463    0.306981    0.390400    0.347879   1179.87   1227.40    1.000
pi(T){all}      0.188811    0.000300    0.156388    0.222130    0.188357   1299.30   1372.18    1.000
alpha{1,2}      0.429274    0.221235    0.000213    1.393921    0.272420   1063.30   1177.32    1.000
alpha{3}        0.434938    0.217809    0.000104    1.385263    0.283970   1144.62   1211.69    1.002
pinvar{all}     0.996910    0.000014    0.989744    0.999996    0.998164   1188.53   1206.15    1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-658.410048
Model 2: PositiveSelection	-658.410105
Model 0: one-ratio	-658.410126
Model 7: beta	-658.410085
Model 8: beta&w>1	-658.410005


Model 0 vs 1	1.560000000608852E-4

Model 2 vs 1	1.1400000016692502E-4

Model 8 vs 7	1.6000000005078618E-4
>C1
VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
GSAPTSGSFGVGDEEPPF
>C2
VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
GSAPTSGSFGVGDEEPPF
>C3
VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
GSAPTSGSFGVGDEEPPF
>C4
VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
GSAPTSGSFGVGDEEPPF
>C5
VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
GSAPTSGSFGVGDEEPPF
>C6
VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
GSAPTSGSFGVGDEEPPF
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=168 

C1              VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
C2              VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
C3              VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
C4              VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
C5              VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
C6              VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
                **************************************************

C1              EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
C2              EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
C3              EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
C4              EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
C5              EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
C6              EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
                **************************************************

C1              VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
C2              VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
C3              VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
C4              VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
C5              VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
C6              VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
                **************************************************

C1              GSAPTSGSFGVGDEEPPF
C2              GSAPTSGSFGVGDEEPPF
C3              GSAPTSGSFGVGDEEPPF
C4              GSAPTSGSFGVGDEEPPF
C5              GSAPTSGSFGVGDEEPPF
C6              GSAPTSGSFGVGDEEPPF
                ******************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  168 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  168 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [5040]--->[5040]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.461 Mb, Max= 30.695 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
C2              VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
C3              VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
C4              VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
C5              VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
C6              VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
                **************************************************

C1              EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
C2              EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
C3              EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
C4              EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
C5              EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
C6              EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
                **************************************************

C1              VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
C2              VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
C3              VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
C4              VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
C5              VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
C6              VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
                **************************************************

C1              GSAPTSGSFGVGDEEPPF
C2              GSAPTSGSFGVGDEEPPF
C3              GSAPTSGSFGVGDEEPPF
C4              GSAPTSGSFGVGDEEPPF
C5              GSAPTSGSFGVGDEEPPF
C6              GSAPTSGSFGVGDEEPPF
                ******************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC
C2              GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC
C3              GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC
C4              GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC
C5              GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC
C6              GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC
                **************************************************

C1              TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG
C2              TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG
C3              TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG
C4              TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG
C5              TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG
C6              TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG
                **************************************************

C1              CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC
C2              CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC
C3              CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC
C4              CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC
C5              CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC
C6              CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC
                **************************************************

C1              GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT
C2              GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT
C3              GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT
C4              GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT
C5              GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT
C6              GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT
                **************************************************

C1              GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA
C2              GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA
C3              GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA
C4              GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA
C5              GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA
C6              GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA
                **************************************************

C1              AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG
C2              AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG
C3              AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG
C4              AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG
C5              AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG
C6              AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG
                **************************************************

C1              GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT
C2              GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT
C3              GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT
C4              GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT
C5              GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT
C6              GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT
                **************************************************

C1              CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT
C2              CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT
C3              CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT
C4              CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT
C5              CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT
C6              CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT
                **************************************************

C1              CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG
C2              CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG
C3              CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG
C4              CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG
C5              CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG
C6              CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG
                **************************************************

C1              GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC
C2              GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC
C3              GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC
C4              GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC
C5              GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC
C6              GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC
                **************************************************

C1              CTTC
C2              CTTC
C3              CTTC
C4              CTTC
C5              CTTC
C6              CTTC
                ****



>C1
GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC
TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG
CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC
GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT
GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA
AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG
GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT
CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT
CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG
GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC
CTTC
>C2
GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC
TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG
CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC
GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT
GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA
AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG
GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT
CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT
CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG
GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC
CTTC
>C3
GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC
TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG
CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC
GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT
GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA
AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG
GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT
CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT
CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG
GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC
CTTC
>C4
GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC
TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG
CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC
GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT
GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA
AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG
GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT
CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT
CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG
GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC
CTTC
>C5
GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC
TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG
CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC
GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT
GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA
AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG
GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT
CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT
CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG
GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC
CTTC
>C6
GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC
TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG
CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC
GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT
GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA
AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG
GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT
CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT
CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG
GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC
CTTC
>C1
VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
GSAPTSGSFGVGDEEPPF
>C2
VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
GSAPTSGSFGVGDEEPPF
>C3
VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
GSAPTSGSFGVGDEEPPF
>C4
VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
GSAPTSGSFGVGDEEPPF
>C5
VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
GSAPTSGSFGVGDEEPPF
>C6
VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
GSAPTSGSFGVGDEEPPF


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 504 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579789234
      Setting output file names to "/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 626445359
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0515822061
      Seed = 1770534124
      Swapseed = 1579789234
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1127.976160 -- -24.965149
         Chain 2 -- -1127.976095 -- -24.965149
         Chain 3 -- -1127.976160 -- -24.965149
         Chain 4 -- -1127.976160 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1127.975989 -- -24.965149
         Chain 2 -- -1127.976095 -- -24.965149
         Chain 3 -- -1127.976160 -- -24.965149
         Chain 4 -- -1127.976160 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1127.976] (-1127.976) (-1127.976) (-1127.976) * [-1127.976] (-1127.976) (-1127.976) (-1127.976) 
        500 -- (-708.994) (-692.335) (-693.571) [-691.874] * (-695.002) (-702.618) [-697.280] (-691.146) -- 0:00:00
       1000 -- (-703.404) (-699.811) (-690.229) [-690.313] * (-690.936) (-695.683) [-686.962] (-695.931) -- 0:00:00
       1500 -- (-697.644) [-686.745] (-686.396) (-694.013) * (-696.012) (-692.392) [-692.614] (-693.573) -- 0:00:00
       2000 -- (-695.631) (-691.487) (-693.543) [-689.498] * (-689.226) [-686.576] (-693.311) (-690.972) -- 0:00:00
       2500 -- (-690.345) (-692.438) (-693.841) [-690.582] * [-688.627] (-685.732) (-690.043) (-690.087) -- 0:00:00
       3000 -- [-691.278] (-691.873) (-689.165) (-684.937) * [-689.626] (-690.647) (-692.377) (-693.768) -- 0:00:00
       3500 -- [-688.468] (-696.973) (-687.200) (-698.555) * (-686.831) [-687.531] (-690.502) (-691.828) -- 0:00:00
       4000 -- (-693.021) (-691.049) [-683.077] (-701.917) * (-692.636) (-693.554) [-693.952] (-699.787) -- 0:00:00
       4500 -- (-695.171) (-697.397) [-693.120] (-692.639) * [-687.068] (-686.813) (-693.953) (-695.009) -- 0:00:00
       5000 -- (-694.210) [-688.824] (-700.938) (-691.130) * [-691.959] (-689.611) (-694.804) (-694.470) -- 0:00:00

      Average standard deviation of split frequencies: 0.075151

       5500 -- (-698.503) [-691.910] (-685.305) (-685.677) * (-697.120) [-693.765] (-692.969) (-686.270) -- 0:00:00
       6000 -- (-688.977) [-690.760] (-689.183) (-689.916) * (-711.835) (-690.479) [-688.056] (-694.288) -- 0:00:00
       6500 -- (-691.352) [-690.231] (-690.652) (-690.740) * [-682.055] (-688.970) (-693.655) (-687.802) -- 0:00:00
       7000 -- (-698.065) (-692.473) (-697.243) [-689.306] * (-684.973) (-685.648) [-687.219] (-685.851) -- 0:00:00
       7500 -- (-704.696) [-690.406] (-691.785) (-688.580) * (-682.920) [-689.023] (-688.340) (-692.622) -- 0:00:00
       8000 -- (-695.235) [-687.919] (-693.508) (-691.726) * (-684.569) (-696.279) [-694.877] (-692.674) -- 0:00:00
       8500 -- [-690.370] (-691.936) (-691.222) (-689.334) * [-680.804] (-694.438) (-691.766) (-692.336) -- 0:00:00
       9000 -- (-692.508) [-690.457] (-687.486) (-694.856) * (-682.126) (-688.307) (-687.689) [-689.521] -- 0:00:00
       9500 -- [-691.596] (-689.643) (-694.621) (-691.496) * (-682.393) (-689.792) (-687.336) [-687.488] -- 0:00:00
      10000 -- (-700.798) (-704.257) [-687.719] (-701.676) * [-683.226] (-688.395) (-695.677) (-686.110) -- 0:00:00

      Average standard deviation of split frequencies: 0.065239

      10500 -- (-705.766) (-684.299) (-694.673) [-688.308] * (-682.125) (-700.325) [-693.763] (-687.341) -- 0:00:00
      11000 -- (-702.284) [-681.594] (-691.155) (-697.268) * (-684.570) (-693.755) [-690.121] (-697.622) -- 0:00:00
      11500 -- (-685.796) [-681.352] (-693.971) (-700.268) * (-681.212) (-690.286) [-688.398] (-699.781) -- 0:00:00
      12000 -- (-680.760) [-687.342] (-694.561) (-707.515) * (-680.998) (-691.055) [-687.445] (-693.126) -- 0:00:00
      12500 -- (-683.169) (-681.382) [-690.043] (-685.747) * (-681.996) (-693.640) (-696.628) [-683.051] -- 0:00:00
      13000 -- [-682.177] (-684.548) (-694.720) (-682.916) * (-684.359) (-688.608) (-688.954) [-679.693] -- 0:01:15
      13500 -- (-682.497) (-682.110) [-690.044] (-682.003) * (-682.102) (-687.967) [-689.093] (-680.048) -- 0:01:13
      14000 -- (-681.328) [-680.769] (-693.390) (-679.696) * (-679.635) [-697.036] (-694.732) (-680.443) -- 0:01:10
      14500 -- (-681.902) (-682.341) [-691.926] (-680.008) * (-680.483) [-690.889] (-705.802) (-684.030) -- 0:01:07
      15000 -- (-682.489) (-683.789) (-690.667) [-685.012] * (-680.050) (-691.584) [-682.462] (-681.050) -- 0:01:05

      Average standard deviation of split frequencies: 0.053033

      15500 -- (-680.321) (-682.662) (-687.803) [-679.930] * (-681.916) (-684.153) [-682.084] (-680.841) -- 0:01:03
      16000 -- (-680.305) [-681.087] (-695.291) (-680.764) * (-680.581) [-682.718] (-682.933) (-680.519) -- 0:01:01
      16500 -- [-684.356] (-679.773) (-694.823) (-681.611) * [-682.964] (-684.070) (-686.557) (-682.111) -- 0:00:59
      17000 -- [-682.566] (-685.373) (-688.019) (-682.157) * (-684.472) [-682.259] (-681.216) (-688.337) -- 0:00:57
      17500 -- (-682.384) (-683.483) (-691.266) [-681.865] * (-684.051) [-689.127] (-681.476) (-681.658) -- 0:00:56
      18000 -- (-681.952) (-684.779) (-693.741) [-680.982] * [-681.224] (-682.882) (-682.127) (-682.124) -- 0:00:54
      18500 -- (-682.980) (-681.005) [-691.413] (-681.608) * [-680.340] (-682.735) (-680.061) (-682.737) -- 0:00:53
      19000 -- [-681.893] (-683.932) (-691.746) (-681.258) * (-682.206) (-682.557) (-679.454) [-681.901] -- 0:00:51
      19500 -- [-683.608] (-682.219) (-696.599) (-680.857) * [-686.652] (-682.554) (-679.651) (-681.672) -- 0:00:50
      20000 -- [-682.775] (-686.181) (-691.046) (-679.987) * [-684.014] (-681.503) (-683.631) (-680.317) -- 0:00:49

      Average standard deviation of split frequencies: 0.044278

      20500 -- [-682.076] (-683.613) (-687.725) (-679.993) * (-681.545) (-681.138) (-685.263) [-681.511] -- 0:00:47
      21000 -- (-682.268) (-680.136) [-690.063] (-682.051) * (-681.448) (-682.306) (-687.673) [-680.490] -- 0:00:46
      21500 -- [-681.244] (-682.540) (-687.649) (-681.934) * (-679.563) (-682.061) [-681.589] (-682.011) -- 0:00:45
      22000 -- (-680.943) (-680.946) (-691.117) [-682.589] * (-680.213) (-691.200) [-680.557] (-683.846) -- 0:00:44
      22500 -- (-680.494) (-683.156) (-688.375) [-680.925] * (-682.438) (-686.424) (-680.122) [-680.407] -- 0:00:43
      23000 -- [-684.326] (-681.437) (-691.849) (-684.550) * [-680.027] (-685.552) (-680.791) (-680.441) -- 0:00:42
      23500 -- (-681.187) [-681.722] (-688.803) (-680.993) * (-679.876) (-681.239) (-681.228) [-683.523] -- 0:00:41
      24000 -- [-683.509] (-681.758) (-692.713) (-680.232) * (-681.471) (-685.965) (-680.223) [-681.398] -- 0:00:40
      24500 -- (-683.154) [-680.677] (-688.080) (-680.465) * (-681.103) (-680.699) (-681.353) [-680.226] -- 0:00:39
      25000 -- (-680.131) [-683.028] (-698.428) (-681.945) * (-682.195) (-686.400) [-680.521] (-681.131) -- 0:00:39

      Average standard deviation of split frequencies: 0.039558

      25500 -- [-680.337] (-682.857) (-698.823) (-680.336) * (-681.790) (-682.843) [-680.141] (-682.764) -- 0:00:38
      26000 -- (-682.190) (-683.181) (-689.669) [-680.401] * (-680.726) (-682.122) [-682.071] (-680.259) -- 0:00:37
      26500 -- (-680.683) (-683.660) (-694.446) [-679.945] * [-680.481] (-680.944) (-682.289) (-682.951) -- 0:00:36
      27000 -- (-684.287) [-684.757] (-700.570) (-682.503) * [-685.733] (-681.783) (-681.051) (-680.168) -- 0:00:36
      27500 -- [-679.781] (-685.168) (-692.244) (-681.103) * [-687.097] (-684.885) (-682.424) (-682.629) -- 0:00:35
      28000 -- (-680.858) [-681.999] (-696.335) (-682.205) * [-683.948] (-680.555) (-682.479) (-686.466) -- 0:01:09
      28500 -- (-681.919) (-681.448) [-691.719] (-681.270) * (-680.487) [-681.531] (-682.407) (-683.344) -- 0:01:08
      29000 -- (-680.645) [-682.991] (-690.573) (-681.383) * [-680.154] (-680.725) (-690.696) (-684.397) -- 0:01:06
      29500 -- (-680.816) [-681.346] (-686.873) (-681.031) * (-680.636) (-680.824) [-684.888] (-684.294) -- 0:01:05
      30000 -- (-681.331) [-681.537] (-689.414) (-682.167) * (-683.277) (-681.140) [-685.178] (-684.256) -- 0:01:04

      Average standard deviation of split frequencies: 0.039198

      30500 -- (-686.351) [-682.671] (-690.009) (-685.345) * (-681.080) (-681.955) [-680.593] (-680.276) -- 0:01:03
      31000 -- (-680.170) (-682.756) (-693.462) [-681.052] * (-682.847) (-685.495) [-682.211] (-681.267) -- 0:01:02
      31500 -- (-683.824) [-681.065] (-691.896) (-680.292) * (-681.855) (-682.598) (-680.992) [-680.322] -- 0:01:01
      32000 -- (-682.277) (-683.018) [-697.134] (-681.188) * (-680.507) [-681.836] (-680.573) (-680.891) -- 0:01:00
      32500 -- (-681.128) (-680.750) [-690.738] (-679.917) * (-682.522) (-681.105) (-680.942) [-682.834] -- 0:00:59
      33000 -- [-681.681] (-680.620) (-688.767) (-680.137) * (-684.340) (-684.903) [-680.890] (-682.990) -- 0:00:58
      33500 -- (-680.168) (-681.588) (-691.585) [-679.967] * (-681.987) (-683.277) [-682.080] (-683.321) -- 0:00:57
      34000 -- (-685.304) (-682.515) (-697.942) [-680.708] * (-682.805) [-684.126] (-681.855) (-681.106) -- 0:00:56
      34500 -- (-683.022) [-682.079] (-693.031) (-680.447) * [-681.707] (-681.034) (-688.635) (-682.631) -- 0:00:55
      35000 -- (-680.815) [-682.890] (-689.007) (-681.569) * [-681.945] (-683.304) (-680.694) (-682.687) -- 0:00:55

      Average standard deviation of split frequencies: 0.033391

      35500 -- [-681.566] (-683.834) (-694.257) (-682.626) * (-680.063) [-683.908] (-681.221) (-684.790) -- 0:00:54
      36000 -- (-680.730) [-682.812] (-699.559) (-681.043) * (-679.880) (-686.166) (-680.359) [-681.380] -- 0:00:53
      36500 -- (-682.034) (-684.233) [-694.249] (-681.297) * [-681.486] (-683.942) (-682.319) (-680.943) -- 0:00:52
      37000 -- [-683.204] (-684.129) (-683.941) (-680.697) * (-680.833) (-685.368) [-681.059] (-680.335) -- 0:00:52
      37500 -- (-683.473) [-683.957] (-691.008) (-679.916) * [-680.344] (-683.806) (-681.704) (-684.381) -- 0:00:51
      38000 -- (-682.624) (-681.471) [-698.189] (-680.129) * [-680.961] (-687.119) (-684.391) (-683.684) -- 0:00:50
      38500 -- (-684.629) [-680.121] (-689.317) (-681.709) * [-681.091] (-688.627) (-680.912) (-681.643) -- 0:00:49
      39000 -- (-683.545) [-680.403] (-698.068) (-683.111) * (-682.268) (-685.547) (-680.889) [-681.615] -- 0:00:49
      39500 -- (-681.609) [-681.716] (-692.869) (-682.067) * (-681.505) (-679.997) [-680.681] (-682.365) -- 0:00:48
      40000 -- (-680.574) (-682.057) [-687.041] (-682.217) * (-681.367) (-683.466) (-684.484) [-680.906] -- 0:00:48

      Average standard deviation of split frequencies: 0.028675

      40500 -- (-680.555) (-680.552) (-695.301) [-682.355] * (-682.052) [-687.381] (-684.673) (-681.331) -- 0:00:47
      41000 -- (-680.935) (-685.615) (-686.400) [-685.348] * [-681.875] (-686.935) (-686.968) (-679.732) -- 0:00:46
      41500 -- (-682.608) (-687.997) [-688.941] (-681.059) * (-686.808) [-682.206] (-684.346) (-680.029) -- 0:00:46
      42000 -- (-684.499) (-686.237) [-699.575] (-681.090) * [-681.507] (-681.547) (-683.464) (-680.281) -- 0:00:45
      42500 -- (-682.570) (-680.600) (-690.224) [-681.270] * [-680.626] (-679.812) (-682.796) (-680.017) -- 0:00:45
      43000 -- (-680.420) (-681.089) (-691.465) [-683.516] * (-682.443) (-682.065) (-682.352) [-682.664] -- 0:00:44
      43500 -- [-681.142] (-682.889) (-694.138) (-682.221) * [-682.467] (-683.125) (-682.597) (-685.523) -- 0:00:43
      44000 -- (-679.492) [-683.122] (-696.288) (-681.673) * [-680.299] (-681.728) (-682.883) (-685.097) -- 0:01:05
      44500 -- (-679.950) [-683.050] (-686.540) (-680.177) * (-680.160) (-682.071) (-681.759) [-681.608] -- 0:01:04
      45000 -- (-682.638) (-682.153) (-696.049) [-682.052] * [-680.106] (-682.008) (-683.466) (-680.487) -- 0:01:03

      Average standard deviation of split frequencies: 0.023291

      45500 -- (-679.492) (-680.687) (-694.065) [-680.080] * (-680.429) (-679.954) [-681.996] (-682.130) -- 0:01:02
      46000 -- (-680.721) (-680.148) [-688.986] (-682.661) * (-684.227) (-681.474) (-680.514) [-681.941] -- 0:01:02
      46500 -- [-680.509] (-680.864) (-691.614) (-681.060) * (-681.454) [-683.545] (-680.381) (-683.150) -- 0:01:01
      47000 -- [-682.201] (-683.487) (-691.956) (-681.270) * (-682.586) (-683.007) [-681.303] (-681.208) -- 0:01:00
      47500 -- (-683.521) [-681.790] (-690.673) (-681.891) * [-680.867] (-682.923) (-684.453) (-683.253) -- 0:01:00
      48000 -- [-683.884] (-684.196) (-692.377) (-682.807) * (-683.586) (-682.077) (-684.677) [-685.860] -- 0:00:59
      48500 -- [-682.039] (-682.761) (-689.870) (-683.632) * [-685.002] (-682.315) (-682.474) (-681.024) -- 0:00:58
      49000 -- [-682.616] (-681.215) (-696.807) (-683.328) * (-689.852) (-680.128) (-683.991) [-680.062] -- 0:00:58
      49500 -- (-684.911) (-683.813) [-689.435] (-683.062) * (-680.623) (-680.136) [-682.410] (-683.700) -- 0:00:57
      50000 -- (-684.407) [-685.480] (-686.889) (-682.926) * (-679.925) [-679.542] (-683.605) (-682.006) -- 0:00:57

      Average standard deviation of split frequencies: 0.030238

      50500 -- (-683.513) [-686.527] (-694.587) (-683.770) * (-683.633) (-680.567) [-683.466] (-682.330) -- 0:00:56
      51000 -- [-680.667] (-683.736) (-695.536) (-682.392) * (-681.480) [-679.760] (-681.252) (-680.890) -- 0:00:55
      51500 -- (-681.252) (-681.221) [-685.218] (-685.368) * (-682.192) [-680.333] (-683.686) (-682.662) -- 0:00:55
      52000 -- [-680.878] (-680.721) (-695.613) (-680.806) * (-682.319) [-679.449] (-681.291) (-681.119) -- 0:00:54
      52500 -- [-681.222] (-681.176) (-689.579) (-681.962) * (-682.013) (-683.807) [-681.402] (-682.272) -- 0:00:54
      53000 -- [-680.500] (-682.233) (-694.427) (-683.336) * [-682.073] (-681.910) (-681.177) (-680.415) -- 0:00:53
      53500 -- (-681.355) (-681.800) [-687.407] (-681.754) * [-680.723] (-683.100) (-686.308) (-679.632) -- 0:00:53
      54000 -- [-680.383] (-681.866) (-693.766) (-681.868) * [-683.890] (-681.601) (-682.984) (-680.469) -- 0:00:52
      54500 -- [-679.904] (-681.899) (-696.238) (-682.745) * (-683.128) [-684.444] (-685.796) (-680.415) -- 0:00:52
      55000 -- [-679.932] (-683.770) (-698.751) (-681.588) * [-682.105] (-681.755) (-688.290) (-680.027) -- 0:00:51

      Average standard deviation of split frequencies: 0.032409

      55500 -- (-680.982) [-681.540] (-696.562) (-681.102) * (-684.159) (-686.483) [-686.304] (-680.630) -- 0:00:51
      56000 -- (-680.090) (-684.813) (-695.162) [-680.421] * (-683.649) (-686.031) [-683.578] (-681.232) -- 0:00:50
      56500 -- [-680.844] (-679.612) (-686.357) (-687.977) * (-680.837) [-682.839] (-682.823) (-688.169) -- 0:00:50
      57000 -- (-682.932) [-680.655] (-701.580) (-689.161) * (-681.694) (-686.428) (-681.834) [-681.248] -- 0:00:49
      57500 -- [-681.347] (-684.602) (-698.551) (-683.375) * (-680.256) [-680.993] (-685.320) (-681.663) -- 0:00:49
      58000 -- [-683.173] (-681.845) (-691.179) (-679.747) * (-681.115) (-681.608) [-682.303] (-681.945) -- 0:00:48
      58500 -- (-683.666) [-681.040] (-693.298) (-681.402) * (-681.028) (-684.284) [-681.945] (-679.671) -- 0:00:48
      59000 -- (-682.762) (-681.170) [-690.828] (-684.127) * [-680.904] (-682.802) (-682.394) (-682.758) -- 0:00:47
      59500 -- (-682.268) [-682.507] (-687.587) (-682.808) * [-682.876] (-682.264) (-684.512) (-682.784) -- 0:01:03
      60000 -- (-680.943) [-682.465] (-691.902) (-681.996) * (-683.730) (-680.860) (-682.621) [-682.595] -- 0:01:02

      Average standard deviation of split frequencies: 0.035171

      60500 -- (-681.532) (-681.178) (-694.280) [-680.488] * (-679.563) [-680.142] (-683.500) (-681.647) -- 0:01:02
      61000 -- (-681.027) (-688.421) [-689.382] (-682.660) * (-680.832) (-685.186) [-679.844] (-682.595) -- 0:01:01
      61500 -- (-681.032) (-682.300) (-686.176) [-681.014] * [-681.116] (-685.452) (-679.772) (-680.984) -- 0:01:01
      62000 -- [-681.934] (-681.042) (-686.599) (-681.317) * (-681.189) (-686.686) [-681.861] (-680.011) -- 0:01:00
      62500 -- (-685.228) (-681.693) [-690.917] (-684.521) * (-683.672) [-686.000] (-679.901) (-680.292) -- 0:01:00
      63000 -- (-682.149) (-680.983) [-690.383] (-683.754) * [-683.020] (-684.673) (-683.757) (-680.292) -- 0:00:59
      63500 -- (-681.778) [-682.713] (-692.684) (-682.781) * (-680.434) (-680.549) (-687.144) [-680.682] -- 0:00:58
      64000 -- (-682.143) (-681.950) (-688.133) [-682.828] * (-681.297) [-682.881] (-682.290) (-680.432) -- 0:00:58
      64500 -- (-680.925) (-681.461) [-694.801] (-684.242) * (-683.013) (-683.300) [-682.648] (-681.208) -- 0:00:58
      65000 -- (-682.187) (-685.993) [-690.736] (-680.623) * [-683.620] (-684.705) (-683.711) (-682.733) -- 0:00:57

      Average standard deviation of split frequencies: 0.031201

      65500 -- [-683.409] (-682.936) (-709.531) (-679.959) * [-683.342] (-684.481) (-683.429) (-684.679) -- 0:00:57
      66000 -- [-679.916] (-681.686) (-690.198) (-682.905) * (-682.688) (-687.661) (-684.208) [-681.869] -- 0:00:56
      66500 -- (-682.369) (-680.878) [-683.629] (-680.728) * (-682.317) [-684.998] (-687.757) (-680.587) -- 0:00:56
      67000 -- (-683.799) (-683.261) (-681.579) [-680.921] * (-684.386) [-681.100] (-681.651) (-681.753) -- 0:00:55
      67500 -- (-680.575) (-685.098) [-681.852] (-680.653) * (-681.438) (-683.149) [-681.244] (-682.816) -- 0:00:55
      68000 -- (-680.117) (-683.678) (-683.644) [-682.963] * [-683.898] (-683.401) (-684.240) (-681.611) -- 0:00:54
      68500 -- [-681.322] (-684.838) (-680.029) (-685.586) * [-684.380] (-686.772) (-684.946) (-681.637) -- 0:00:54
      69000 -- [-681.471] (-682.058) (-682.873) (-683.484) * (-684.910) [-679.812] (-682.804) (-680.405) -- 0:00:53
      69500 -- (-683.154) [-682.994] (-682.806) (-682.701) * (-680.378) (-680.582) (-682.564) [-683.731] -- 0:00:53
      70000 -- (-679.994) (-684.855) (-683.546) [-681.555] * (-681.217) (-681.137) [-682.419] (-681.387) -- 0:00:53

      Average standard deviation of split frequencies: 0.033354

      70500 -- (-681.004) (-683.171) [-682.470] (-682.771) * [-680.374] (-681.377) (-681.489) (-681.545) -- 0:00:52
      71000 -- (-681.604) (-682.056) [-681.250] (-680.197) * (-684.763) (-680.834) (-683.405) [-680.975] -- 0:00:52
      71500 -- (-684.276) [-683.886] (-680.707) (-680.218) * (-680.925) [-681.250] (-681.187) (-682.127) -- 0:00:51
      72000 -- (-681.844) [-684.796] (-681.737) (-680.337) * (-681.477) (-680.071) (-680.566) [-684.467] -- 0:00:51
      72500 -- [-682.244] (-682.951) (-681.241) (-684.635) * [-682.610] (-681.700) (-680.413) (-679.850) -- 0:00:51
      73000 -- (-683.535) (-684.250) [-681.822] (-682.228) * (-682.253) (-682.473) (-684.051) [-679.985] -- 0:00:50
      73500 -- [-686.070] (-681.803) (-685.581) (-679.786) * (-682.406) (-682.796) [-683.373] (-679.936) -- 0:01:03
      74000 -- (-683.159) [-683.478] (-681.529) (-682.265) * (-681.774) (-683.637) [-680.157] (-681.925) -- 0:01:02
      74500 -- [-679.781] (-680.888) (-681.376) (-680.798) * (-684.104) (-681.583) (-679.916) [-683.211] -- 0:01:02
      75000 -- (-680.909) [-681.776] (-680.231) (-683.511) * (-683.913) (-683.105) (-681.002) [-680.968] -- 0:01:01

      Average standard deviation of split frequencies: 0.035910

      75500 -- (-681.514) (-680.653) (-681.370) [-682.001] * (-681.725) [-683.220] (-682.019) (-681.876) -- 0:01:01
      76000 -- [-679.563] (-683.319) (-682.299) (-681.319) * (-680.570) (-680.840) (-681.938) [-680.703] -- 0:01:00
      76500 -- (-681.360) [-683.220] (-681.575) (-683.204) * (-683.182) [-681.269] (-682.793) (-685.085) -- 0:01:00
      77000 -- (-682.241) [-681.550] (-681.300) (-681.524) * (-683.763) (-679.803) (-680.332) [-683.529] -- 0:00:59
      77500 -- (-683.824) (-683.941) [-681.438] (-681.616) * [-683.713] (-681.542) (-682.035) (-685.772) -- 0:00:59
      78000 -- (-680.477) (-682.611) [-682.876] (-682.651) * (-680.286) (-684.788) [-681.535] (-683.255) -- 0:00:59
      78500 -- (-684.031) [-685.238] (-683.492) (-683.446) * (-680.742) (-683.542) [-682.298] (-684.761) -- 0:00:58
      79000 -- (-686.068) (-683.476) (-686.140) [-682.213] * [-682.802] (-682.870) (-683.250) (-683.896) -- 0:00:58
      79500 -- [-681.587] (-681.936) (-684.612) (-681.945) * [-682.571] (-684.321) (-680.741) (-681.783) -- 0:00:57
      80000 -- (-683.219) (-685.793) (-683.069) [-685.174] * (-686.582) (-684.044) (-680.667) [-680.961] -- 0:00:57

      Average standard deviation of split frequencies: 0.037831

      80500 -- (-682.071) (-680.605) [-682.238] (-681.015) * (-682.072) (-684.276) [-682.648] (-681.399) -- 0:00:57
      81000 -- (-681.315) (-679.822) [-680.312] (-687.306) * (-681.835) (-682.461) [-682.922] (-682.890) -- 0:00:56
      81500 -- (-679.752) (-685.138) (-681.448) [-682.259] * [-684.402] (-680.658) (-681.157) (-684.499) -- 0:00:56
      82000 -- [-679.814] (-681.802) (-681.666) (-683.653) * [-680.506] (-681.084) (-682.367) (-680.157) -- 0:00:55
      82500 -- (-683.914) [-682.814] (-681.315) (-681.445) * [-684.085] (-681.746) (-684.412) (-680.713) -- 0:00:55
      83000 -- (-681.741) (-682.250) (-680.988) [-679.865] * (-684.537) (-683.867) (-681.750) [-680.103] -- 0:00:55
      83500 -- [-679.521] (-680.600) (-684.634) (-681.352) * (-683.363) [-683.674] (-681.195) (-682.211) -- 0:00:54
      84000 -- (-681.279) [-680.226] (-682.324) (-685.003) * (-683.465) [-681.951] (-681.331) (-681.732) -- 0:00:54
      84500 -- (-681.932) (-682.228) [-685.012] (-685.449) * [-682.783] (-681.544) (-680.645) (-680.855) -- 0:00:54
      85000 -- (-680.598) [-681.195] (-682.030) (-682.172) * [-683.414] (-684.176) (-680.166) (-681.434) -- 0:00:53

      Average standard deviation of split frequencies: 0.031792

      85500 -- [-681.614] (-682.180) (-680.765) (-685.081) * (-681.790) (-680.204) (-683.318) [-685.301] -- 0:00:53
      86000 -- [-680.328] (-687.522) (-683.247) (-685.347) * (-683.980) [-680.691] (-682.273) (-683.313) -- 0:00:53
      86500 -- (-681.052) [-682.513] (-684.610) (-682.548) * (-683.831) (-682.424) (-685.873) [-683.786] -- 0:00:52
      87000 -- (-680.390) (-682.619) (-680.834) [-683.130] * (-681.185) [-683.324] (-679.776) (-687.697) -- 0:00:52
      87500 -- [-679.943] (-682.938) (-682.543) (-683.313) * [-682.918] (-681.934) (-680.575) (-684.651) -- 0:00:52
      88000 -- [-681.397] (-682.702) (-682.518) (-685.051) * [-680.481] (-681.745) (-682.131) (-684.130) -- 0:00:51
      88500 -- (-681.915) [-681.364] (-684.010) (-684.272) * (-687.061) (-685.098) (-681.279) [-681.623] -- 0:00:51
      89000 -- (-682.247) [-683.938] (-681.283) (-685.239) * (-684.713) [-686.167] (-680.805) (-683.650) -- 0:00:51
      89500 -- (-682.011) (-681.671) (-681.976) [-683.084] * (-683.159) [-683.366] (-681.409) (-680.181) -- 0:01:01
      90000 -- (-682.076) [-683.634] (-682.514) (-681.471) * [-682.400] (-682.701) (-681.049) (-681.766) -- 0:01:00

      Average standard deviation of split frequencies: 0.032351

      90500 -- (-684.254) (-680.360) (-679.915) [-680.898] * [-684.999] (-681.149) (-681.601) (-682.657) -- 0:01:00
      91000 -- [-681.371] (-679.950) (-679.980) (-682.587) * (-683.461) (-681.479) (-680.917) [-683.320] -- 0:00:59
      91500 -- (-683.225) [-680.051] (-681.036) (-680.854) * (-683.329) (-681.573) (-681.837) [-680.051] -- 0:00:59
      92000 -- (-681.248) [-684.320] (-680.291) (-684.993) * (-681.689) (-681.145) [-682.368] (-680.410) -- 0:00:59
      92500 -- (-681.829) [-679.939] (-680.847) (-685.236) * (-681.403) (-688.037) (-680.007) [-684.847] -- 0:00:58
      93000 -- (-683.905) (-681.439) (-680.101) [-683.121] * [-681.873] (-684.827) (-680.907) (-683.870) -- 0:00:58
      93500 -- (-683.325) [-681.097] (-680.086) (-682.873) * (-682.515) (-681.748) [-681.214] (-682.686) -- 0:00:58
      94000 -- (-683.328) (-684.160) (-680.548) [-687.124] * (-681.878) (-682.158) [-681.690] (-682.959) -- 0:00:57
      94500 -- (-683.564) [-679.990] (-680.554) (-682.405) * (-690.151) [-680.672] (-681.828) (-681.652) -- 0:00:57
      95000 -- (-681.948) [-681.646] (-680.626) (-682.849) * (-686.445) (-683.811) (-683.889) [-680.770] -- 0:00:57

      Average standard deviation of split frequencies: 0.028946

      95500 -- (-682.356) [-682.512] (-681.086) (-681.181) * [-682.902] (-683.446) (-681.203) (-683.177) -- 0:00:56
      96000 -- (-682.995) (-682.278) (-681.521) [-681.521] * (-682.889) (-681.620) (-682.075) [-683.773] -- 0:00:56
      96500 -- (-679.752) (-680.252) [-682.290] (-682.586) * (-680.711) (-684.239) (-681.967) [-682.417] -- 0:00:56
      97000 -- [-679.871] (-683.739) (-682.235) (-680.037) * (-681.128) [-679.978] (-681.053) (-684.331) -- 0:00:55
      97500 -- (-681.022) (-684.469) (-681.381) [-681.976] * (-681.786) (-681.937) [-680.708] (-681.969) -- 0:00:55
      98000 -- (-681.456) (-680.693) [-680.769] (-685.070) * (-685.345) (-681.378) (-682.125) [-682.187] -- 0:00:55
      98500 -- (-679.986) [-680.369] (-686.571) (-686.450) * (-682.324) (-684.013) [-681.871] (-685.945) -- 0:00:54
      99000 -- (-680.348) (-681.425) [-681.023] (-683.490) * (-680.873) [-681.707] (-683.721) (-682.233) -- 0:00:54
      99500 -- (-680.794) (-681.095) (-685.307) [-681.477] * (-680.510) (-682.786) (-682.662) [-681.261] -- 0:00:54
      100000 -- (-684.721) (-682.581) [-683.486] (-681.239) * (-682.902) (-681.653) (-683.746) [-684.469] -- 0:00:54

      Average standard deviation of split frequencies: 0.025632

      100500 -- (-684.679) [-681.794] (-682.236) (-680.445) * [-681.194] (-679.939) (-683.309) (-682.994) -- 0:00:53
      101000 -- [-681.850] (-684.340) (-682.178) (-680.056) * (-682.352) [-683.085] (-682.872) (-682.082) -- 0:00:53
      101500 -- (-684.114) [-681.142] (-681.856) (-680.788) * (-682.758) [-679.918] (-680.295) (-681.305) -- 0:00:53
      102000 -- (-682.139) (-680.441) (-680.772) [-680.304] * (-681.279) [-681.886] (-681.180) (-680.821) -- 0:00:52
      102500 -- (-682.523) [-681.742] (-680.644) (-680.649) * (-684.020) (-680.863) (-684.378) [-680.161] -- 0:00:52
      103000 -- (-683.423) [-682.455] (-681.265) (-681.368) * (-682.148) [-681.563] (-681.542) (-681.356) -- 0:00:52
      103500 -- (-682.304) (-680.999) (-682.158) [-684.448] * (-682.311) (-681.322) (-681.854) [-681.328] -- 0:00:51
      104000 -- [-684.924] (-679.845) (-681.388) (-680.237) * (-680.259) (-682.614) (-680.598) [-681.955] -- 0:00:51
      104500 -- (-683.784) [-682.857] (-680.531) (-682.340) * (-681.953) (-684.107) [-683.551] (-683.978) -- 0:00:51
      105000 -- (-679.420) (-683.507) (-685.481) [-683.252] * (-683.899) (-684.177) [-682.659] (-681.559) -- 0:00:51

      Average standard deviation of split frequencies: 0.023640

      105500 -- [-680.521] (-681.799) (-682.864) (-681.826) * (-681.002) [-681.617] (-680.139) (-682.166) -- 0:00:50
      106000 -- (-680.289) (-681.782) [-681.793] (-682.207) * (-681.611) [-683.892] (-681.235) (-683.234) -- 0:00:59
      106500 -- (-684.299) [-679.946] (-680.353) (-685.031) * (-683.161) (-682.708) (-680.491) [-682.109] -- 0:00:58
      107000 -- (-680.424) (-680.252) (-683.374) [-681.752] * (-683.305) (-680.971) [-680.596] (-680.684) -- 0:00:58
      107500 -- (-680.391) (-681.272) [-679.861] (-683.085) * [-680.636] (-681.424) (-681.247) (-684.425) -- 0:00:58
      108000 -- (-680.538) [-681.827] (-682.889) (-683.073) * (-680.859) (-680.220) [-684.101] (-681.760) -- 0:00:57
      108500 -- [-683.306] (-683.278) (-680.425) (-680.642) * (-680.586) (-680.222) [-683.635] (-683.937) -- 0:00:57
      109000 -- (-681.863) (-688.046) (-681.599) [-681.990] * [-680.397] (-680.886) (-680.921) (-681.251) -- 0:00:57
      109500 -- (-681.557) [-687.073] (-682.727) (-680.664) * [-681.413] (-682.732) (-680.468) (-683.531) -- 0:00:56
      110000 -- [-681.318] (-688.997) (-681.560) (-681.455) * (-680.555) (-689.884) [-682.272] (-683.759) -- 0:00:56

      Average standard deviation of split frequencies: 0.025795

      110500 -- (-681.213) [-684.253] (-682.350) (-684.612) * (-680.559) (-681.423) [-681.354] (-681.097) -- 0:00:56
      111000 -- (-685.972) (-682.192) (-681.559) [-679.853] * [-681.647] (-683.769) (-680.045) (-680.160) -- 0:00:56
      111500 -- (-680.862) [-681.778] (-683.951) (-681.332) * (-680.440) (-681.783) [-680.703] (-679.996) -- 0:00:55
      112000 -- (-680.800) (-681.263) [-681.313] (-682.634) * (-680.085) [-684.287] (-684.458) (-679.773) -- 0:00:55
      112500 -- (-682.351) (-681.034) (-681.214) [-680.469] * (-682.232) (-682.819) [-683.106] (-680.106) -- 0:00:55
      113000 -- (-681.267) (-679.741) (-681.536) [-684.021] * (-682.741) (-680.254) [-680.627] (-681.375) -- 0:00:54
      113500 -- [-681.929] (-682.904) (-680.232) (-681.625) * (-684.311) (-682.043) [-679.654] (-681.395) -- 0:00:54
      114000 -- (-681.106) (-682.682) (-682.333) [-685.296] * [-681.651] (-684.618) (-681.881) (-684.607) -- 0:00:54
      114500 -- (-685.775) [-680.510] (-684.726) (-686.600) * (-687.371) [-683.791] (-684.871) (-681.608) -- 0:00:54
      115000 -- (-683.924) (-680.840) (-681.708) [-683.772] * [-681.265] (-684.193) (-683.345) (-681.340) -- 0:00:53

      Average standard deviation of split frequencies: 0.023100

      115500 -- (-682.212) (-680.150) (-682.871) [-683.930] * [-681.091] (-681.205) (-681.974) (-681.569) -- 0:00:53
      116000 -- [-681.589] (-680.926) (-681.926) (-686.109) * (-679.903) [-682.518] (-683.734) (-680.594) -- 0:00:53
      116500 -- (-684.191) [-680.219] (-680.055) (-685.922) * (-681.163) [-681.794] (-680.881) (-680.352) -- 0:00:53
      117000 -- (-681.962) [-681.629] (-683.444) (-684.304) * (-681.313) (-680.086) (-683.041) [-680.406] -- 0:00:52
      117500 -- (-682.091) [-686.831] (-685.109) (-686.808) * (-682.040) (-680.601) [-682.879] (-682.143) -- 0:00:52
      118000 -- [-681.064] (-681.924) (-681.861) (-682.413) * [-680.222] (-680.982) (-685.628) (-679.569) -- 0:00:52
      118500 -- (-681.878) (-681.803) [-679.555] (-682.647) * (-685.832) [-685.238] (-683.194) (-680.155) -- 0:00:52
      119000 -- (-683.084) [-683.117] (-681.664) (-681.052) * (-680.267) [-688.600] (-685.836) (-680.479) -- 0:00:51
      119500 -- (-683.207) (-683.035) (-680.944) [-681.785] * (-686.566) [-682.209] (-681.447) (-681.671) -- 0:00:51
      120000 -- (-682.442) [-682.944] (-680.078) (-679.627) * (-684.165) (-685.479) [-681.140] (-681.207) -- 0:00:51

      Average standard deviation of split frequencies: 0.021384

      120500 -- [-684.280] (-682.631) (-680.263) (-679.707) * (-681.962) (-681.506) [-684.530] (-680.886) -- 0:00:51
      121000 -- (-682.093) [-683.333] (-680.512) (-681.922) * [-683.074] (-685.953) (-682.168) (-681.668) -- 0:00:50
      121500 -- (-681.148) (-685.327) [-681.851] (-680.122) * (-682.975) (-681.713) [-680.882] (-685.464) -- 0:00:50
      122000 -- (-682.543) (-682.584) [-682.154] (-682.093) * (-687.061) (-680.782) (-682.027) [-683.534] -- 0:00:50
      122500 -- (-683.793) (-680.528) [-681.638] (-683.704) * (-683.163) (-682.137) (-680.579) [-683.299] -- 0:00:57
      123000 -- (-685.616) (-686.634) [-680.588] (-681.394) * (-680.480) [-681.547] (-681.821) (-690.091) -- 0:00:57
      123500 -- [-683.283] (-682.782) (-684.311) (-680.745) * [-680.191] (-680.337) (-682.523) (-685.719) -- 0:00:56
      124000 -- [-681.655] (-681.777) (-684.372) (-681.359) * (-683.080) [-680.770] (-682.005) (-681.748) -- 0:00:56
      124500 -- [-685.150] (-681.469) (-684.786) (-682.619) * (-682.585) (-680.313) [-682.656] (-684.588) -- 0:00:56
      125000 -- (-680.690) (-684.053) (-684.344) [-681.425] * (-681.530) (-680.203) [-683.113] (-680.594) -- 0:00:56

      Average standard deviation of split frequencies: 0.020873

      125500 -- (-682.387) (-681.693) [-680.969] (-681.812) * [-684.379] (-680.119) (-681.739) (-680.403) -- 0:00:55
      126000 -- (-688.007) (-684.215) [-682.220] (-679.702) * (-682.303) (-680.434) [-680.506] (-684.683) -- 0:00:55
      126500 -- (-686.066) [-682.173] (-681.849) (-681.420) * (-681.064) [-680.388] (-682.951) (-682.123) -- 0:00:55
      127000 -- (-684.904) (-680.894) [-681.304] (-686.222) * (-682.380) (-681.957) [-680.457] (-682.670) -- 0:00:54
      127500 -- [-680.204] (-681.731) (-679.822) (-682.348) * [-683.516] (-680.866) (-682.282) (-682.118) -- 0:00:54
      128000 -- (-680.086) [-681.834] (-681.229) (-680.047) * (-681.948) (-681.110) [-681.197] (-682.329) -- 0:00:54
      128500 -- (-681.475) (-681.261) (-680.592) [-684.706] * [-681.859] (-679.595) (-683.840) (-682.125) -- 0:00:54
      129000 -- (-681.137) (-680.510) (-680.155) [-688.092] * [-685.376] (-679.861) (-682.259) (-682.053) -- 0:00:54
      129500 -- (-679.652) (-681.926) (-682.526) [-683.688] * (-681.995) [-680.639] (-681.088) (-682.637) -- 0:00:53
      130000 -- (-682.549) (-680.906) [-680.682] (-684.875) * (-683.881) (-679.960) [-681.631] (-681.876) -- 0:00:53

      Average standard deviation of split frequencies: 0.022909

      130500 -- [-681.137] (-680.717) (-681.367) (-680.178) * (-679.995) (-682.919) (-683.007) [-680.380] -- 0:00:53
      131000 -- (-681.551) (-680.117) [-681.645] (-682.972) * (-682.438) (-681.406) (-680.980) [-679.874] -- 0:00:53
      131500 -- (-680.294) [-680.028] (-683.368) (-681.404) * [-683.055] (-683.647) (-681.218) (-681.429) -- 0:00:52
      132000 -- (-680.768) [-680.374] (-681.977) (-681.249) * [-684.884] (-681.184) (-681.716) (-680.736) -- 0:00:52
      132500 -- (-682.079) [-682.961] (-681.321) (-684.594) * (-684.033) (-686.660) [-680.336] (-687.828) -- 0:00:52
      133000 -- [-681.589] (-687.034) (-684.291) (-682.622) * [-685.811] (-683.804) (-683.303) (-687.919) -- 0:00:52
      133500 -- (-680.333) (-681.861) [-683.032] (-683.903) * (-681.265) (-682.092) (-679.950) [-683.599] -- 0:00:51
      134000 -- [-682.584] (-680.895) (-681.487) (-684.364) * (-681.070) [-681.511] (-679.846) (-682.145) -- 0:00:51
      134500 -- (-681.416) (-681.013) (-682.254) [-683.862] * (-683.127) (-686.042) [-679.911] (-681.402) -- 0:00:51
      135000 -- [-679.404] (-680.855) (-680.987) (-682.953) * (-682.889) [-681.633] (-681.252) (-686.096) -- 0:00:51

      Average standard deviation of split frequencies: 0.021760

      135500 -- (-683.499) [-680.807] (-680.412) (-681.219) * [-681.426] (-683.716) (-681.094) (-681.205) -- 0:00:51
      136000 -- (-683.648) (-680.741) [-680.301] (-681.245) * (-681.867) (-680.955) (-679.936) [-681.679] -- 0:00:50
      136500 -- (-685.004) [-680.899] (-680.531) (-681.283) * (-682.827) [-682.419] (-680.925) (-680.337) -- 0:00:50
      137000 -- (-685.358) (-685.224) (-682.671) [-681.661] * [-684.714] (-683.752) (-682.095) (-680.421) -- 0:00:50
      137500 -- (-683.348) [-681.507] (-682.503) (-683.761) * (-683.814) (-679.928) (-683.531) [-681.479] -- 0:00:50
      138000 -- [-680.927] (-681.920) (-682.083) (-680.402) * (-680.776) (-682.667) [-681.824] (-690.653) -- 0:00:49
      138500 -- (-680.414) [-680.370] (-683.345) (-682.907) * [-680.842] (-683.612) (-683.132) (-683.486) -- 0:00:49
      139000 -- (-683.068) (-683.501) [-684.683] (-685.714) * (-682.216) [-679.608] (-679.959) (-687.670) -- 0:00:49
      139500 -- (-680.717) (-681.722) (-680.537) [-682.086] * (-685.140) [-680.121] (-680.699) (-686.039) -- 0:00:55
      140000 -- (-681.542) [-680.581] (-680.969) (-681.260) * [-681.198] (-683.261) (-684.563) (-683.842) -- 0:00:55

      Average standard deviation of split frequencies: 0.022155

      140500 -- (-685.455) (-680.979) (-682.156) [-680.692] * [-681.673] (-681.385) (-681.236) (-685.002) -- 0:00:55
      141000 -- (-683.879) (-683.132) [-681.307] (-682.218) * (-681.632) (-683.643) [-680.136] (-684.574) -- 0:00:54
      141500 -- (-681.905) (-682.399) (-683.909) [-681.540] * (-682.132) [-680.709] (-681.539) (-682.048) -- 0:00:54
      142000 -- [-681.295] (-682.406) (-681.131) (-682.677) * (-680.226) [-680.668] (-683.591) (-681.119) -- 0:00:54
      142500 -- (-682.338) (-682.573) (-681.050) [-682.738] * (-681.665) (-683.163) [-685.652] (-680.517) -- 0:00:54
      143000 -- (-682.253) [-684.420] (-682.614) (-683.490) * (-686.335) (-681.052) [-687.390] (-683.774) -- 0:00:53
      143500 -- (-681.313) (-680.925) (-682.789) [-683.295] * (-685.257) [-681.130] (-688.556) (-683.633) -- 0:00:53
      144000 -- (-684.192) (-679.952) (-683.512) [-681.588] * (-685.800) [-680.619] (-685.675) (-685.391) -- 0:00:53
      144500 -- (-681.753) (-680.086) (-682.818) [-681.870] * [-683.122] (-687.217) (-682.647) (-680.078) -- 0:00:53
      145000 -- (-680.434) (-682.331) [-682.538] (-682.659) * (-682.233) [-682.085] (-680.706) (-682.047) -- 0:00:53

      Average standard deviation of split frequencies: 0.020826

      145500 -- (-683.194) (-683.685) [-682.984] (-684.087) * (-682.658) (-680.692) (-681.634) [-682.426] -- 0:00:52
      146000 -- (-681.128) (-679.671) (-680.770) [-680.300] * (-684.470) [-680.950] (-681.825) (-684.125) -- 0:00:52
      146500 -- (-683.482) [-680.374] (-681.014) (-681.038) * (-680.493) [-681.283] (-684.080) (-685.848) -- 0:00:52
      147000 -- (-683.205) (-683.405) (-681.205) [-683.843] * [-685.940] (-681.966) (-680.713) (-683.481) -- 0:00:52
      147500 -- [-684.165] (-683.992) (-681.029) (-680.319) * (-682.528) (-680.543) (-682.717) [-682.536] -- 0:00:52
      148000 -- [-683.335] (-681.248) (-680.385) (-681.491) * (-679.706) (-683.559) [-679.732] (-682.004) -- 0:00:51
      148500 -- (-681.886) [-681.275] (-682.122) (-680.613) * [-681.039] (-681.087) (-681.248) (-681.485) -- 0:00:51
      149000 -- (-682.140) (-681.536) (-680.378) [-680.765] * (-681.272) [-682.869] (-681.947) (-685.696) -- 0:00:51
      149500 -- [-683.110] (-685.419) (-683.403) (-682.379) * (-681.217) (-682.542) [-681.055] (-680.212) -- 0:00:51
      150000 -- (-680.383) (-687.132) [-680.737] (-684.843) * [-680.542] (-679.882) (-680.419) (-683.501) -- 0:00:51

      Average standard deviation of split frequencies: 0.020749

      150500 -- (-681.196) (-684.712) (-681.943) [-681.593] * (-682.037) [-679.691] (-681.480) (-683.996) -- 0:00:50
      151000 -- (-685.525) [-681.077] (-684.231) (-680.383) * [-682.907] (-682.098) (-683.139) (-680.120) -- 0:00:50
      151500 -- [-684.006] (-681.751) (-685.820) (-684.502) * (-682.353) (-681.204) (-681.703) [-682.674] -- 0:00:50
      152000 -- (-682.508) (-681.154) (-684.258) [-683.114] * (-683.376) (-683.035) [-680.762] (-684.348) -- 0:00:50
      152500 -- [-680.725] (-680.191) (-683.702) (-683.241) * (-683.198) (-681.169) [-679.924] (-686.638) -- 0:00:50
      153000 -- [-682.650] (-681.770) (-681.147) (-681.132) * (-684.866) (-680.011) [-682.231] (-682.111) -- 0:00:49
      153500 -- (-679.869) [-681.293] (-680.139) (-681.267) * (-681.743) (-679.699) (-682.704) [-682.629] -- 0:00:49
      154000 -- [-681.560] (-681.875) (-681.500) (-679.868) * (-687.347) (-682.119) (-684.966) [-682.639] -- 0:00:49
      154500 -- (-684.273) (-681.784) [-681.174] (-680.537) * (-683.938) [-681.532] (-685.534) (-681.594) -- 0:00:49
      155000 -- (-681.115) [-680.166] (-682.925) (-681.607) * (-685.112) [-681.016] (-679.897) (-684.961) -- 0:00:49

      Average standard deviation of split frequencies: 0.017775

      155500 -- (-680.332) (-680.516) (-683.045) [-680.693] * (-682.519) [-681.163] (-681.163) (-686.091) -- 0:00:48
      156000 -- [-680.718] (-679.531) (-681.896) (-682.765) * [-682.024] (-685.137) (-683.259) (-680.688) -- 0:00:54
      156500 -- (-681.069) (-680.047) [-679.903] (-682.303) * (-683.423) (-685.248) (-683.013) [-682.842] -- 0:00:53
      157000 -- (-681.572) (-685.131) [-681.902] (-682.961) * (-682.471) [-681.596] (-682.775) (-680.985) -- 0:00:53
      157500 -- (-687.101) [-680.786] (-685.186) (-681.604) * (-680.558) (-682.563) (-680.309) [-683.964] -- 0:00:53
      158000 -- (-684.353) [-680.140] (-683.268) (-681.388) * [-680.216] (-680.694) (-683.613) (-685.884) -- 0:00:53
      158500 -- [-683.834] (-682.821) (-682.697) (-681.750) * (-681.005) (-680.112) (-681.144) [-684.523] -- 0:00:53
      159000 -- (-685.768) (-684.081) (-681.443) [-680.763] * [-680.508] (-682.706) (-681.113) (-683.365) -- 0:00:52
      159500 -- (-681.656) (-680.953) [-683.602] (-682.290) * [-681.868] (-681.558) (-680.019) (-683.252) -- 0:00:52
      160000 -- (-684.971) (-680.633) [-682.104] (-684.233) * (-681.307) (-680.840) [-681.812] (-685.346) -- 0:00:52

      Average standard deviation of split frequencies: 0.018295

      160500 -- [-681.491] (-680.388) (-682.598) (-681.526) * [-681.678] (-681.320) (-681.461) (-685.650) -- 0:00:52
      161000 -- (-680.965) (-682.482) [-680.607] (-680.031) * (-683.455) (-681.784) [-680.666] (-683.179) -- 0:00:52
      161500 -- (-682.709) [-680.172] (-684.226) (-688.294) * [-682.256] (-682.310) (-681.647) (-692.472) -- 0:00:51
      162000 -- [-681.054] (-681.528) (-682.429) (-685.577) * (-682.292) (-680.726) [-680.972] (-682.895) -- 0:00:51
      162500 -- (-682.490) [-680.714] (-680.896) (-684.719) * (-683.957) (-683.200) (-680.795) [-682.472] -- 0:00:51
      163000 -- (-681.991) [-682.517] (-682.139) (-684.392) * (-683.095) (-682.492) [-680.169] (-683.109) -- 0:00:51
      163500 -- (-680.051) (-682.099) (-680.655) [-681.959] * (-683.747) (-680.881) (-682.686) [-683.200] -- 0:00:51
      164000 -- (-682.964) (-684.784) [-681.704] (-680.368) * (-679.853) (-679.793) [-682.319] (-682.422) -- 0:00:50
      164500 -- (-681.668) [-682.289] (-683.203) (-680.785) * (-680.860) [-680.954] (-681.353) (-683.909) -- 0:00:50
      165000 -- (-685.654) [-682.495] (-679.713) (-688.962) * [-680.104] (-682.523) (-682.824) (-686.457) -- 0:00:50

      Average standard deviation of split frequencies: 0.017985

      165500 -- (-682.572) (-683.285) [-681.781] (-681.003) * [-682.712] (-684.393) (-680.379) (-682.226) -- 0:00:50
      166000 -- (-681.836) (-681.530) (-681.533) [-679.958] * (-683.325) (-683.142) (-680.006) [-680.170] -- 0:00:50
      166500 -- (-682.684) (-681.616) (-683.712) [-679.974] * (-683.204) (-682.253) [-679.709] (-682.214) -- 0:00:50
      167000 -- (-687.110) (-683.113) [-682.051] (-680.965) * (-681.976) (-684.274) [-681.876] (-682.524) -- 0:00:49
      167500 -- (-681.784) [-683.289] (-681.480) (-684.483) * (-683.137) (-685.185) [-682.750] (-685.682) -- 0:00:49
      168000 -- (-682.343) [-681.967] (-681.370) (-680.931) * (-688.175) (-680.567) (-684.810) [-684.565] -- 0:00:49
      168500 -- (-682.436) [-682.341] (-681.080) (-680.782) * [-684.030] (-680.640) (-682.723) (-680.591) -- 0:00:49
      169000 -- (-681.639) (-682.366) [-682.738] (-683.631) * (-682.048) (-683.047) (-681.070) [-682.125] -- 0:00:49
      169500 -- [-681.767] (-680.777) (-685.370) (-684.898) * (-685.068) (-680.091) (-680.510) [-681.871] -- 0:00:48
      170000 -- [-683.205] (-681.697) (-680.745) (-680.005) * [-681.625] (-679.968) (-682.681) (-680.525) -- 0:00:48

      Average standard deviation of split frequencies: 0.019480

      170500 -- (-682.331) (-684.032) [-680.643] (-681.051) * (-681.117) (-680.026) (-681.052) [-682.377] -- 0:00:48
      171000 -- [-681.105] (-681.119) (-685.556) (-682.446) * (-683.064) [-680.305] (-680.764) (-684.681) -- 0:00:48
      171500 -- (-682.772) (-683.711) [-679.666] (-682.683) * [-680.212] (-680.437) (-679.975) (-684.590) -- 0:00:48
      172000 -- (-683.771) [-683.749] (-681.703) (-680.895) * [-682.485] (-680.904) (-680.400) (-680.906) -- 0:00:48
      172500 -- [-682.356] (-681.266) (-685.351) (-688.294) * (-684.306) [-680.916] (-681.709) (-681.940) -- 0:00:47
      173000 -- (-682.492) (-683.206) [-681.379] (-688.396) * (-682.327) (-680.760) [-682.367] (-687.817) -- 0:00:52
      173500 -- (-684.800) (-682.046) (-680.017) [-680.423] * (-680.134) (-680.668) (-684.603) [-682.626] -- 0:00:52
      174000 -- (-683.417) (-679.837) [-682.428] (-680.249) * (-679.947) (-681.177) (-683.880) [-682.191] -- 0:00:52
      174500 -- (-681.904) [-682.870] (-682.203) (-681.476) * (-680.202) [-686.742] (-682.414) (-682.561) -- 0:00:52
      175000 -- (-681.991) [-682.746] (-680.722) (-680.648) * (-683.199) (-685.003) (-682.508) [-681.115] -- 0:00:51

      Average standard deviation of split frequencies: 0.020018

      175500 -- (-686.328) [-682.620] (-682.694) (-679.998) * (-680.999) [-681.313] (-681.546) (-682.060) -- 0:00:51
      176000 -- (-684.036) [-681.919] (-684.331) (-681.342) * [-680.098] (-681.843) (-682.435) (-681.202) -- 0:00:51
      176500 -- (-684.288) (-681.647) (-680.373) [-681.651] * (-679.816) (-679.571) [-681.082] (-680.905) -- 0:00:51
      177000 -- (-684.150) (-682.065) [-682.449] (-682.878) * [-682.637] (-683.914) (-680.817) (-679.630) -- 0:00:51
      177500 -- [-680.944] (-679.609) (-682.264) (-681.806) * (-681.870) (-682.911) (-680.462) [-679.893] -- 0:00:50
      178000 -- (-681.422) (-681.153) [-683.919] (-680.442) * (-681.493) (-680.408) [-684.367] (-681.490) -- 0:00:50
      178500 -- (-680.792) (-686.003) [-682.162] (-681.851) * (-685.047) (-680.005) (-684.878) [-679.500] -- 0:00:50
      179000 -- [-681.431] (-681.769) (-685.119) (-681.811) * (-681.606) (-681.047) (-680.118) [-680.451] -- 0:00:50
      179500 -- [-680.500] (-682.583) (-681.552) (-681.299) * (-681.452) (-686.390) (-680.609) [-680.318] -- 0:00:50
      180000 -- (-684.018) (-681.337) (-682.862) [-681.291] * (-680.806) (-679.785) (-681.225) [-679.566] -- 0:00:50

      Average standard deviation of split frequencies: 0.021019

      180500 -- (-681.147) [-680.358] (-679.965) (-681.494) * (-685.475) (-683.867) [-682.318] (-681.806) -- 0:00:49
      181000 -- (-680.642) (-683.157) (-680.098) [-682.099] * (-680.369) (-681.168) [-683.200] (-681.393) -- 0:00:49
      181500 -- (-682.529) (-681.508) (-683.758) [-681.139] * (-680.645) (-680.787) (-685.022) [-680.204] -- 0:00:49
      182000 -- (-682.801) (-680.441) [-681.002] (-679.664) * (-682.780) [-683.687] (-684.062) (-683.312) -- 0:00:49
      182500 -- (-684.683) (-682.323) [-681.370] (-681.222) * (-681.276) (-682.110) [-685.750] (-684.527) -- 0:00:49
      183000 -- (-684.109) (-682.473) [-682.303] (-681.101) * (-684.860) [-681.352] (-681.433) (-682.326) -- 0:00:49
      183500 -- (-680.196) [-683.668] (-683.860) (-681.726) * (-687.300) (-680.704) [-682.437] (-680.745) -- 0:00:48
      184000 -- (-681.186) [-682.669] (-680.437) (-680.592) * (-682.382) (-679.815) (-680.852) [-680.989] -- 0:00:48
      184500 -- (-680.043) (-680.577) [-680.812] (-684.071) * (-684.020) [-681.461] (-681.821) (-684.276) -- 0:00:48
      185000 -- [-681.761] (-680.552) (-682.906) (-682.310) * (-686.553) [-682.399] (-682.694) (-682.842) -- 0:00:48

      Average standard deviation of split frequencies: 0.020009

      185500 -- (-685.434) (-680.052) [-681.931] (-682.721) * (-680.570) (-682.493) [-683.734] (-681.036) -- 0:00:48
      186000 -- (-685.221) (-681.434) [-681.353] (-684.037) * (-681.750) (-685.425) (-682.129) [-681.448] -- 0:00:48
      186500 -- (-682.563) (-680.181) [-682.263] (-683.601) * (-681.853) (-680.894) [-684.214] (-685.430) -- 0:00:47
      187000 -- (-681.015) [-680.489] (-679.540) (-683.403) * (-681.982) (-683.238) (-681.724) [-684.531] -- 0:00:47
      187500 -- (-685.104) (-681.401) [-680.249] (-684.987) * (-680.837) (-685.060) (-682.187) [-682.141] -- 0:00:47
      188000 -- [-680.563] (-680.428) (-680.914) (-681.173) * (-680.679) (-683.782) [-685.202] (-684.679) -- 0:00:47
      188500 -- (-680.334) [-680.226] (-683.331) (-684.785) * (-682.164) [-684.573] (-684.639) (-681.307) -- 0:00:47
      189000 -- (-681.838) [-681.303] (-680.755) (-685.321) * (-682.085) [-682.453] (-685.724) (-683.802) -- 0:00:47
      189500 -- (-681.368) (-680.755) (-682.394) [-685.564] * (-681.654) [-684.058] (-681.480) (-682.675) -- 0:00:47
      190000 -- [-685.422] (-682.921) (-679.919) (-686.637) * (-682.272) (-684.465) (-680.891) [-680.387] -- 0:00:51

      Average standard deviation of split frequencies: 0.019504

      190500 -- [-687.306] (-681.549) (-680.903) (-679.882) * (-683.070) (-684.813) (-682.804) [-680.830] -- 0:00:50
      191000 -- (-683.057) [-680.632] (-680.161) (-680.665) * [-682.022] (-681.372) (-681.913) (-680.294) -- 0:00:50
      191500 -- (-680.345) [-679.911] (-680.739) (-680.186) * [-682.101] (-682.533) (-683.882) (-681.327) -- 0:00:50
      192000 -- (-681.229) (-683.677) (-683.593) [-684.652] * (-681.014) (-681.992) (-683.233) [-680.165] -- 0:00:50
      192500 -- (-680.134) (-682.060) (-683.465) [-681.490] * (-684.121) (-682.936) (-681.062) [-685.157] -- 0:00:50
      193000 -- (-683.556) (-681.270) [-681.434] (-682.906) * (-681.932) (-682.830) (-680.343) [-684.078] -- 0:00:50
      193500 -- [-683.781] (-680.976) (-682.357) (-683.489) * (-680.510) (-681.143) [-680.775] (-683.875) -- 0:00:50
      194000 -- [-684.489] (-681.561) (-684.692) (-681.042) * (-681.108) (-680.933) [-681.613] (-682.751) -- 0:00:49
      194500 -- (-681.823) [-682.893] (-681.160) (-684.890) * (-683.705) [-682.744] (-681.874) (-682.490) -- 0:00:49
      195000 -- [-680.453] (-681.397) (-680.550) (-692.154) * (-683.783) [-683.111] (-683.259) (-680.185) -- 0:00:49

      Average standard deviation of split frequencies: 0.020514

      195500 -- (-680.931) [-681.965] (-681.444) (-682.986) * [-681.838] (-680.800) (-685.068) (-680.772) -- 0:00:49
      196000 -- (-682.447) (-681.443) (-680.803) [-685.877] * (-679.542) (-679.753) [-684.039] (-680.988) -- 0:00:49
      196500 -- (-686.365) (-680.414) (-683.442) [-681.381] * [-681.659] (-680.127) (-680.399) (-691.879) -- 0:00:49
      197000 -- [-686.035] (-685.624) (-691.742) (-682.552) * [-680.578] (-681.672) (-680.058) (-683.388) -- 0:00:48
      197500 -- (-684.281) [-683.148] (-681.532) (-684.152) * (-683.808) (-681.200) (-680.432) [-681.287] -- 0:00:48
      198000 -- (-682.938) (-682.540) (-682.407) [-682.997] * (-682.277) (-689.129) [-680.440] (-682.509) -- 0:00:48
      198500 -- (-682.550) (-682.432) (-681.690) [-684.148] * (-680.782) (-687.399) [-680.755] (-679.569) -- 0:00:48
      199000 -- [-682.640] (-681.352) (-680.786) (-684.153) * (-680.087) (-688.787) (-685.288) [-679.514] -- 0:00:48
      199500 -- (-681.829) (-683.483) [-680.483] (-683.333) * (-683.049) (-680.806) (-682.902) [-681.410] -- 0:00:48
      200000 -- (-680.590) (-681.919) [-680.412] (-680.990) * [-684.578] (-681.304) (-682.119) (-681.507) -- 0:00:48

      Average standard deviation of split frequencies: 0.019968

      200500 -- (-683.167) (-681.926) [-680.740] (-685.545) * (-682.774) (-681.102) [-681.520] (-682.465) -- 0:00:47
      201000 -- (-681.853) (-680.366) [-681.264] (-680.734) * (-681.436) [-680.267] (-679.619) (-680.464) -- 0:00:47
      201500 -- [-682.268] (-682.963) (-681.026) (-680.923) * (-683.923) (-686.274) (-682.130) [-682.668] -- 0:00:47
      202000 -- (-681.200) (-682.322) [-681.267] (-681.047) * (-682.230) [-680.878] (-683.526) (-680.150) -- 0:00:47
      202500 -- [-681.036] (-681.272) (-681.975) (-685.241) * (-681.026) (-685.477) (-680.892) [-680.923] -- 0:00:47
      203000 -- (-680.355) (-682.528) [-681.511] (-681.772) * (-681.930) (-683.024) (-682.205) [-680.892] -- 0:00:47
      203500 -- (-679.838) (-685.780) (-682.940) [-683.382] * (-681.868) (-682.264) [-681.837] (-680.935) -- 0:00:46
      204000 -- (-680.249) (-681.936) (-680.690) [-683.441] * [-681.592] (-683.407) (-681.581) (-681.871) -- 0:00:46
      204500 -- (-680.882) (-681.073) [-682.668] (-680.419) * [-681.564] (-682.589) (-682.066) (-681.535) -- 0:00:46
      205000 -- [-680.894] (-679.901) (-683.296) (-681.226) * (-683.901) [-684.292] (-684.916) (-680.662) -- 0:00:46

      Average standard deviation of split frequencies: 0.018576

      205500 -- [-682.478] (-684.017) (-680.832) (-680.908) * (-681.825) [-680.449] (-683.491) (-682.283) -- 0:00:46
      206000 -- (-683.294) (-684.616) [-683.005] (-681.504) * (-681.897) (-679.886) (-682.541) [-680.229] -- 0:00:46
      206500 -- (-682.506) (-683.548) [-679.954] (-680.826) * (-681.998) [-679.591] (-680.996) (-681.790) -- 0:00:46
      207000 -- [-682.384] (-681.400) (-682.065) (-682.196) * [-681.144] (-680.189) (-681.164) (-682.604) -- 0:00:49
      207500 -- (-681.441) (-683.526) (-681.243) [-680.606] * (-680.456) (-680.189) [-682.590] (-688.196) -- 0:00:49
      208000 -- (-680.497) [-684.472] (-681.907) (-681.355) * (-682.497) [-682.153] (-682.676) (-689.088) -- 0:00:49
      208500 -- (-680.741) (-682.235) (-681.751) [-680.454] * (-680.704) (-682.161) (-680.975) [-682.831] -- 0:00:49
      209000 -- (-683.644) (-681.040) (-682.341) [-681.798] * (-683.009) (-682.031) [-683.200] (-684.430) -- 0:00:49
      209500 -- (-681.164) (-680.869) (-681.162) [-681.546] * (-679.908) (-683.879) [-681.446] (-682.420) -- 0:00:49
      210000 -- [-680.335] (-682.217) (-685.846) (-684.158) * (-680.543) (-681.036) [-681.179] (-682.555) -- 0:00:48

      Average standard deviation of split frequencies: 0.019720

      210500 -- (-680.537) (-681.134) [-683.863] (-680.811) * [-683.442] (-681.739) (-681.354) (-683.127) -- 0:00:48
      211000 -- [-683.270] (-682.671) (-680.553) (-680.199) * [-684.648] (-681.009) (-685.412) (-684.582) -- 0:00:48
      211500 -- [-680.973] (-685.338) (-685.511) (-686.391) * (-682.237) (-681.230) [-680.189] (-683.310) -- 0:00:48
      212000 -- [-680.888] (-684.847) (-682.102) (-682.197) * (-682.919) [-681.266] (-681.720) (-688.438) -- 0:00:48
      212500 -- (-682.344) [-682.059] (-683.242) (-682.097) * (-683.497) [-682.247] (-681.455) (-682.977) -- 0:00:48
      213000 -- (-686.564) [-680.417] (-679.722) (-681.436) * (-681.938) (-683.829) (-681.461) [-683.935] -- 0:00:48
      213500 -- (-684.863) (-680.785) (-682.785) [-682.840] * (-680.778) (-681.778) (-682.212) [-680.381] -- 0:00:47
      214000 -- (-682.537) (-687.773) (-680.141) [-681.957] * [-681.378] (-682.087) (-681.876) (-680.410) -- 0:00:47
      214500 -- (-679.794) [-681.184] (-679.724) (-687.001) * (-681.279) (-682.215) (-680.766) [-680.362] -- 0:00:47
      215000 -- [-680.459] (-681.670) (-680.249) (-684.387) * (-682.179) (-681.908) [-680.363] (-682.906) -- 0:00:47

      Average standard deviation of split frequencies: 0.018687

      215500 -- (-681.856) (-680.618) [-681.685] (-684.471) * [-682.544] (-682.543) (-680.939) (-684.449) -- 0:00:47
      216000 -- (-681.405) (-680.883) [-680.914] (-687.354) * [-681.344] (-680.503) (-680.668) (-681.493) -- 0:00:47
      216500 -- [-680.928] (-682.038) (-683.682) (-684.231) * (-682.021) (-681.203) (-680.895) [-685.402] -- 0:00:47
      217000 -- (-683.785) (-681.876) [-684.142] (-680.771) * (-682.943) (-683.567) [-681.092] (-681.185) -- 0:00:46
      217500 -- (-683.359) (-682.776) [-685.872] (-681.625) * [-681.123] (-684.301) (-680.750) (-681.754) -- 0:00:46
      218000 -- [-682.522] (-684.337) (-685.645) (-681.293) * [-679.936] (-682.516) (-680.344) (-684.097) -- 0:00:46
      218500 -- [-683.835] (-684.315) (-685.680) (-683.528) * (-680.898) (-681.191) [-682.868] (-681.663) -- 0:00:46
      219000 -- (-682.613) [-680.506] (-679.957) (-684.498) * (-680.914) [-691.006] (-681.320) (-681.434) -- 0:00:46
      219500 -- (-681.552) (-681.631) (-680.320) [-683.044] * [-683.332] (-685.517) (-682.185) (-681.936) -- 0:00:46
      220000 -- (-684.741) (-681.889) [-683.466] (-681.292) * (-682.320) [-682.908] (-680.407) (-685.559) -- 0:00:46

      Average standard deviation of split frequencies: 0.017945

      220500 -- (-686.971) (-682.680) [-680.524] (-680.488) * (-681.828) (-681.636) (-681.528) [-679.535] -- 0:00:45
      221000 -- (-682.553) (-682.445) (-681.213) [-680.631] * (-683.105) [-681.186] (-682.418) (-679.643) -- 0:00:45
      221500 -- (-682.539) [-681.772] (-681.311) (-680.502) * [-682.293] (-683.088) (-681.585) (-680.952) -- 0:00:45
      222000 -- (-682.287) (-680.947) (-683.991) [-680.956] * (-683.846) [-682.442] (-681.180) (-681.626) -- 0:00:45
      222500 -- (-682.278) (-681.219) (-680.460) [-683.342] * (-682.601) (-680.548) (-681.471) [-684.553] -- 0:00:45
      223000 -- (-680.370) [-683.081] (-683.925) (-682.050) * (-684.143) (-679.901) [-686.148] (-681.761) -- 0:00:45
      223500 -- (-679.851) [-682.913] (-680.470) (-682.817) * (-679.957) (-680.433) (-681.472) [-680.886] -- 0:00:45
      224000 -- (-680.793) (-683.576) (-685.423) [-680.504] * [-681.076] (-680.560) (-680.897) (-682.382) -- 0:00:48
      224500 -- (-686.052) (-681.148) [-681.423] (-680.637) * (-679.917) [-680.812] (-681.132) (-686.471) -- 0:00:48
      225000 -- [-685.172] (-683.766) (-684.871) (-680.612) * (-681.767) [-680.546] (-682.339) (-683.915) -- 0:00:48

      Average standard deviation of split frequencies: 0.017521

      225500 -- (-680.489) (-682.506) [-684.475] (-680.114) * [-680.726] (-680.958) (-681.851) (-683.426) -- 0:00:48
      226000 -- (-680.609) (-683.674) [-682.734] (-679.946) * (-681.083) (-679.982) [-680.966] (-684.680) -- 0:00:47
      226500 -- [-680.327] (-682.790) (-684.516) (-679.546) * (-683.930) (-682.432) (-683.893) [-680.109] -- 0:00:47
      227000 -- (-681.986) (-682.160) [-680.685] (-679.442) * (-681.902) [-683.061] (-682.458) (-681.000) -- 0:00:47
      227500 -- (-680.506) (-681.514) (-681.318) [-681.207] * [-683.886] (-679.837) (-683.969) (-684.094) -- 0:00:47
      228000 -- (-684.656) (-683.787) (-681.742) [-681.378] * (-680.921) (-681.394) (-685.134) [-683.299] -- 0:00:47
      228500 -- (-681.512) (-683.409) (-683.528) [-680.867] * (-680.555) (-680.581) [-684.782] (-680.384) -- 0:00:47
      229000 -- (-682.694) (-684.209) (-682.372) [-680.870] * [-680.703] (-680.783) (-688.192) (-680.789) -- 0:00:47
      229500 -- [-685.000] (-681.067) (-683.296) (-681.243) * (-684.869) (-682.302) (-689.645) [-680.380] -- 0:00:47
      230000 -- (-681.324) (-681.787) [-682.176] (-686.617) * [-684.124] (-685.772) (-680.582) (-679.860) -- 0:00:46

      Average standard deviation of split frequencies: 0.017848

      230500 -- (-682.691) [-680.857] (-681.628) (-682.908) * (-682.778) (-680.697) [-683.128] (-679.776) -- 0:00:46
      231000 -- (-679.619) [-680.751] (-684.780) (-684.989) * (-680.479) (-681.191) (-683.724) [-679.778] -- 0:00:46
      231500 -- [-684.386] (-680.308) (-681.611) (-682.611) * (-688.015) (-689.669) [-680.895] (-680.575) -- 0:00:46
      232000 -- (-682.658) [-682.755] (-686.055) (-680.922) * (-681.890) [-681.789] (-682.101) (-682.549) -- 0:00:46
      232500 -- [-681.920] (-682.726) (-683.342) (-680.764) * [-680.722] (-681.314) (-682.743) (-680.608) -- 0:00:46
      233000 -- [-681.097] (-681.454) (-680.945) (-681.218) * (-681.392) (-680.825) (-684.055) [-680.674] -- 0:00:46
      233500 -- (-681.149) [-681.926] (-680.619) (-680.393) * (-682.417) [-681.359] (-682.181) (-681.674) -- 0:00:45
      234000 -- (-681.129) (-684.158) [-680.947] (-680.903) * (-685.114) (-686.422) (-687.664) [-680.449] -- 0:00:45
      234500 -- (-685.112) [-680.486] (-680.489) (-679.988) * (-687.133) (-680.637) [-685.326] (-681.587) -- 0:00:45
      235000 -- [-685.336] (-680.475) (-681.086) (-679.974) * (-685.331) (-680.896) (-680.252) [-681.213] -- 0:00:45

      Average standard deviation of split frequencies: 0.017844

      235500 -- (-684.216) (-680.516) (-686.084) [-681.245] * (-680.777) [-680.755] (-684.985) (-684.835) -- 0:00:45
      236000 -- (-684.804) (-681.799) [-686.543] (-683.581) * (-683.201) [-680.423] (-687.101) (-682.104) -- 0:00:45
      236500 -- [-684.719] (-684.531) (-681.314) (-681.427) * (-683.549) (-681.180) [-685.198] (-681.087) -- 0:00:45
      237000 -- (-684.261) [-680.188] (-681.445) (-681.560) * [-683.512] (-680.433) (-685.472) (-681.214) -- 0:00:45
      237500 -- (-681.143) (-680.524) (-682.873) [-679.966] * (-683.638) [-680.157] (-682.691) (-680.660) -- 0:00:44
      238000 -- (-682.279) (-679.674) (-681.773) [-681.893] * (-685.791) [-681.508] (-682.440) (-682.404) -- 0:00:44
      238500 -- [-681.542] (-681.161) (-679.940) (-684.286) * (-681.685) [-681.399] (-681.320) (-684.348) -- 0:00:44
      239000 -- (-681.169) (-681.678) [-681.792] (-681.767) * [-680.268] (-681.931) (-679.530) (-688.924) -- 0:00:44
      239500 -- (-683.305) (-682.285) (-682.294) [-680.998] * (-681.318) [-681.573] (-682.595) (-685.873) -- 0:00:44
      240000 -- (-680.707) (-684.545) (-687.176) [-680.568] * [-682.124] (-681.514) (-684.575) (-685.340) -- 0:00:44

      Average standard deviation of split frequencies: 0.015670

      240500 -- (-682.778) (-684.704) (-680.590) [-679.919] * (-682.577) (-679.782) (-684.063) [-682.990] -- 0:00:47
      241000 -- (-682.729) (-680.888) [-680.934] (-680.103) * (-679.887) (-680.732) (-682.284) [-681.435] -- 0:00:47
      241500 -- [-680.606] (-680.021) (-681.674) (-680.954) * (-684.904) [-681.473] (-682.463) (-682.637) -- 0:00:47
      242000 -- (-680.331) (-681.490) (-686.023) [-682.522] * (-688.031) (-680.577) [-683.453] (-682.106) -- 0:00:46
      242500 -- [-682.491] (-680.505) (-687.257) (-680.315) * (-688.437) (-682.662) [-681.909] (-681.796) -- 0:00:46
      243000 -- (-684.171) (-680.430) (-685.172) [-680.148] * (-680.216) [-686.644] (-681.781) (-683.683) -- 0:00:46
      243500 -- (-682.605) (-680.075) (-684.844) [-680.486] * (-683.344) (-681.846) (-684.277) [-680.513] -- 0:00:46
      244000 -- (-682.367) [-679.774] (-681.764) (-685.957) * (-685.426) (-683.600) (-682.159) [-679.769] -- 0:00:46
      244500 -- [-681.122] (-681.228) (-681.722) (-684.340) * [-681.282] (-679.982) (-681.955) (-682.811) -- 0:00:46
      245000 -- [-682.889] (-683.045) (-679.951) (-681.924) * [-680.759] (-681.384) (-680.519) (-680.924) -- 0:00:46

      Average standard deviation of split frequencies: 0.014316

      245500 -- (-681.880) (-681.905) (-684.809) [-680.468] * (-682.259) (-682.026) (-683.559) [-682.176] -- 0:00:46
      246000 -- (-682.596) (-681.612) (-681.625) [-683.445] * [-679.618] (-682.173) (-685.620) (-681.622) -- 0:00:45
      246500 -- (-680.174) [-683.104] (-682.925) (-682.397) * [-684.133] (-681.222) (-685.221) (-680.602) -- 0:00:45
      247000 -- (-679.835) (-681.027) (-681.812) [-682.434] * [-681.302] (-682.099) (-682.537) (-682.270) -- 0:00:45
      247500 -- (-679.612) [-682.758] (-681.634) (-685.579) * [-680.463] (-684.620) (-680.490) (-686.732) -- 0:00:45
      248000 -- (-681.751) [-680.896] (-681.578) (-683.166) * (-680.996) (-683.180) (-680.252) [-680.054] -- 0:00:45
      248500 -- [-680.394] (-680.615) (-681.454) (-680.794) * (-679.907) (-682.524) (-686.057) [-680.214] -- 0:00:45
      249000 -- [-680.020] (-680.480) (-684.181) (-681.066) * (-684.135) (-683.815) [-683.985] (-680.321) -- 0:00:45
      249500 -- (-679.955) (-682.768) (-685.994) [-681.130] * (-681.361) (-680.692) (-682.145) [-682.117] -- 0:00:45
      250000 -- (-681.295) [-680.525] (-680.575) (-686.927) * (-682.080) (-682.276) [-681.762] (-684.038) -- 0:00:45

      Average standard deviation of split frequencies: 0.013496

      250500 -- [-680.354] (-681.267) (-680.669) (-682.639) * [-680.397] (-686.491) (-683.194) (-682.909) -- 0:00:44
      251000 -- (-682.737) [-680.904] (-683.611) (-686.795) * (-680.862) (-684.108) [-682.083] (-681.559) -- 0:00:44
      251500 -- [-679.778] (-680.538) (-683.397) (-681.778) * (-681.487) (-684.956) [-687.201] (-688.431) -- 0:00:44
      252000 -- (-684.086) (-683.852) [-682.092] (-686.735) * (-684.951) [-682.780] (-683.114) (-687.580) -- 0:00:44
      252500 -- (-682.104) (-682.575) [-681.446] (-683.859) * (-680.978) [-679.685] (-682.744) (-681.455) -- 0:00:44
      253000 -- [-685.689] (-683.688) (-682.757) (-681.130) * (-686.151) (-684.068) [-685.419] (-679.672) -- 0:00:44
      253500 -- (-681.859) (-683.025) [-681.928] (-684.763) * [-681.600] (-682.564) (-684.731) (-680.353) -- 0:00:44
      254000 -- (-685.448) (-681.088) (-679.992) [-683.096] * [-680.160] (-683.358) (-684.310) (-680.380) -- 0:00:44
      254500 -- [-682.586] (-681.148) (-686.091) (-685.446) * [-682.204] (-682.505) (-680.957) (-679.836) -- 0:00:43
      255000 -- (-680.284) (-680.844) [-686.263] (-680.445) * (-686.723) [-681.424] (-681.484) (-683.868) -- 0:00:43

      Average standard deviation of split frequencies: 0.013107

      255500 -- (-680.086) (-681.535) (-685.724) [-681.656] * [-683.311] (-680.696) (-682.712) (-680.699) -- 0:00:43
      256000 -- (-680.592) [-686.657] (-681.801) (-683.602) * [-685.130] (-682.435) (-683.886) (-681.419) -- 0:00:43
      256500 -- (-680.124) (-680.617) (-681.637) [-684.330] * [-685.917] (-684.142) (-681.362) (-681.153) -- 0:00:43
      257000 -- [-679.784] (-680.300) (-682.811) (-693.486) * (-681.113) (-681.317) [-680.094] (-684.899) -- 0:00:43
      257500 -- (-685.245) (-681.513) (-683.256) [-683.738] * (-681.509) (-681.312) [-681.493] (-684.822) -- 0:00:46
      258000 -- [-681.898] (-682.480) (-682.046) (-686.043) * (-680.922) (-680.505) [-680.519] (-685.353) -- 0:00:46
      258500 -- (-682.071) (-683.324) [-682.186] (-684.139) * (-681.512) (-680.633) (-680.153) [-681.133] -- 0:00:45
      259000 -- (-684.776) (-682.146) [-679.836] (-680.546) * (-682.309) (-684.446) [-681.846] (-681.936) -- 0:00:45
      259500 -- (-683.739) [-684.083] (-682.332) (-681.069) * (-684.052) (-679.977) (-681.034) [-680.515] -- 0:00:45
      260000 -- (-684.578) (-682.884) (-683.059) [-680.482] * [-683.569] (-680.406) (-681.068) (-686.569) -- 0:00:45

      Average standard deviation of split frequencies: 0.013936

      260500 -- (-685.552) [-681.746] (-681.659) (-681.307) * (-681.439) [-680.235] (-680.664) (-680.200) -- 0:00:45
      261000 -- (-682.341) [-681.133] (-681.394) (-682.116) * (-680.883) [-679.563] (-680.132) (-682.145) -- 0:00:45
      261500 -- (-680.646) (-684.055) (-681.723) [-680.727] * (-683.916) [-679.907] (-680.266) (-682.541) -- 0:00:45
      262000 -- (-681.136) [-682.022] (-680.670) (-680.857) * (-681.883) (-681.666) [-680.686] (-683.679) -- 0:00:45
      262500 -- (-684.583) [-681.704] (-683.091) (-681.594) * (-681.058) (-680.519) [-682.220] (-684.677) -- 0:00:44
      263000 -- (-681.931) [-683.551] (-688.456) (-680.923) * (-690.306) (-682.113) [-681.901] (-680.715) -- 0:00:44
      263500 -- (-680.841) [-681.177] (-685.976) (-681.513) * (-681.554) (-680.527) (-680.698) [-680.418] -- 0:00:44
      264000 -- (-685.302) (-682.197) (-680.703) [-683.481] * (-681.258) [-680.796] (-679.919) (-682.859) -- 0:00:44
      264500 -- [-685.287] (-682.336) (-680.269) (-682.267) * (-681.152) (-680.785) [-680.571] (-680.242) -- 0:00:44
      265000 -- [-684.575] (-680.663) (-681.433) (-682.085) * [-681.661] (-681.071) (-680.933) (-682.885) -- 0:00:44

      Average standard deviation of split frequencies: 0.014276

      265500 -- (-685.942) [-684.078] (-683.021) (-682.534) * (-683.939) (-682.462) (-681.243) [-680.889] -- 0:00:44
      266000 -- [-684.062] (-680.675) (-681.791) (-682.665) * (-680.467) [-683.113] (-680.934) (-680.964) -- 0:00:44
      266500 -- (-682.500) [-681.161] (-681.901) (-681.684) * [-682.382] (-680.727) (-683.642) (-681.561) -- 0:00:44
      267000 -- [-681.079] (-681.657) (-681.524) (-681.903) * (-682.651) (-681.855) [-683.156] (-682.291) -- 0:00:43
      267500 -- (-680.578) [-683.070] (-682.105) (-683.158) * (-682.741) [-683.560] (-682.902) (-683.496) -- 0:00:43
      268000 -- (-679.888) (-682.407) (-682.357) [-682.645] * (-684.642) (-683.683) (-684.880) [-681.020] -- 0:00:43
      268500 -- [-680.614] (-680.373) (-681.887) (-683.197) * [-682.592] (-680.111) (-684.415) (-681.384) -- 0:00:43
      269000 -- [-680.584] (-682.406) (-680.312) (-684.210) * (-679.428) (-680.543) [-680.439] (-680.764) -- 0:00:43
      269500 -- [-679.863] (-680.105) (-681.048) (-683.266) * (-681.816) (-679.846) (-680.640) [-680.171] -- 0:00:43
      270000 -- (-680.832) (-681.346) [-679.925] (-680.823) * (-684.960) [-682.429] (-683.464) (-682.745) -- 0:00:43

      Average standard deviation of split frequencies: 0.012675

      270500 -- (-680.728) (-684.742) (-682.390) [-680.604] * (-683.540) (-680.196) [-681.943] (-683.977) -- 0:00:43
      271000 -- (-681.912) (-681.377) (-680.331) [-680.780] * [-680.662] (-683.712) (-683.410) (-683.600) -- 0:00:43
      271500 -- (-683.353) (-680.515) [-682.453] (-680.907) * (-680.064) [-683.610] (-680.901) (-680.262) -- 0:00:42
      272000 -- (-682.128) [-680.173] (-681.240) (-680.298) * (-681.156) (-682.741) (-683.561) [-680.389] -- 0:00:42
      272500 -- [-682.105] (-683.075) (-682.387) (-681.683) * [-682.267] (-682.383) (-682.759) (-684.994) -- 0:00:42
      273000 -- [-680.120] (-680.112) (-683.030) (-681.481) * (-680.889) (-686.142) (-680.465) [-680.626] -- 0:00:42
      273500 -- (-679.842) (-680.532) [-683.886] (-681.572) * (-682.320) [-680.328] (-682.590) (-682.612) -- 0:00:42
      274000 -- (-680.559) (-683.948) (-681.614) [-682.367] * (-683.904) [-680.871] (-683.193) (-683.311) -- 0:00:42
      274500 -- [-680.133] (-683.677) (-684.642) (-681.179) * [-682.332] (-679.821) (-680.738) (-683.121) -- 0:00:44
      275000 -- (-680.136) [-686.573] (-679.725) (-679.896) * (-682.960) [-679.506] (-681.796) (-682.816) -- 0:00:44

      Average standard deviation of split frequencies: 0.012157

      275500 -- [-681.276] (-683.529) (-683.071) (-680.278) * (-684.223) [-680.459] (-682.965) (-684.021) -- 0:00:44
      276000 -- (-679.955) (-682.199) (-684.029) [-679.819] * (-682.417) (-681.253) [-681.582] (-680.863) -- 0:00:44
      276500 -- (-679.988) (-682.063) (-682.985) [-680.749] * (-683.088) (-681.707) [-683.310] (-682.430) -- 0:00:44
      277000 -- [-685.619] (-682.713) (-681.151) (-683.300) * (-682.890) [-680.550] (-682.199) (-684.839) -- 0:00:44
      277500 -- (-681.767) (-681.899) [-682.036] (-684.033) * [-681.275] (-682.902) (-683.222) (-680.296) -- 0:00:44
      278000 -- (-682.234) (-680.100) [-683.830] (-683.033) * (-681.123) (-681.532) [-681.753] (-680.810) -- 0:00:44
      278500 -- (-681.342) (-683.918) [-681.114] (-682.780) * (-680.639) [-680.233] (-682.263) (-681.625) -- 0:00:44
      279000 -- [-682.020] (-681.235) (-680.669) (-684.869) * (-680.899) (-680.683) (-684.499) [-681.073] -- 0:00:43
      279500 -- (-680.168) (-682.519) [-686.059] (-683.213) * (-680.310) [-680.245] (-686.342) (-681.572) -- 0:00:43
      280000 -- (-680.342) [-682.398] (-691.837) (-682.816) * [-682.774] (-679.888) (-681.667) (-684.964) -- 0:00:43

      Average standard deviation of split frequencies: 0.012492

      280500 -- [-680.440] (-682.893) (-683.790) (-681.924) * (-682.939) (-680.239) (-681.096) [-682.139] -- 0:00:43
      281000 -- [-682.440] (-682.097) (-682.265) (-680.232) * [-680.484] (-682.386) (-682.777) (-682.756) -- 0:00:43
      281500 -- (-681.797) (-682.378) (-682.934) [-680.497] * (-681.455) [-685.374] (-685.038) (-682.807) -- 0:00:43
      282000 -- (-684.994) (-680.268) [-683.276] (-682.925) * [-683.945] (-685.448) (-682.836) (-679.549) -- 0:00:43
      282500 -- (-680.863) (-680.079) [-681.188] (-680.149) * [-680.462] (-682.192) (-680.691) (-681.657) -- 0:00:43
      283000 -- (-682.087) (-680.275) [-681.321] (-681.300) * (-683.198) [-682.591] (-682.137) (-680.828) -- 0:00:43
      283500 -- (-682.658) (-680.146) [-681.752] (-681.820) * (-680.794) (-685.222) (-680.340) [-680.461] -- 0:00:42
      284000 -- (-681.594) [-681.040] (-680.553) (-681.604) * (-680.400) [-688.401] (-680.273) (-680.985) -- 0:00:42
      284500 -- (-682.710) [-680.195] (-681.848) (-683.185) * (-679.954) (-682.741) [-680.273] (-682.627) -- 0:00:42
      285000 -- [-681.719] (-682.716) (-683.117) (-681.057) * (-681.908) [-681.054] (-682.519) (-681.963) -- 0:00:42

      Average standard deviation of split frequencies: 0.011441

      285500 -- [-681.859] (-680.992) (-682.239) (-682.104) * (-684.883) (-680.590) [-680.259] (-681.582) -- 0:00:42
      286000 -- [-683.285] (-681.095) (-680.830) (-681.269) * (-681.596) (-681.927) (-681.201) [-682.010] -- 0:00:42
      286500 -- (-683.545) (-681.203) (-683.322) [-681.745] * (-686.396) [-683.740] (-680.934) (-680.629) -- 0:00:42
      287000 -- (-687.248) (-680.909) [-680.522] (-685.961) * [-680.602] (-681.539) (-683.017) (-680.912) -- 0:00:42
      287500 -- [-684.810] (-681.389) (-684.023) (-692.822) * [-680.384] (-681.619) (-682.952) (-682.015) -- 0:00:42
      288000 -- (-681.611) [-680.994] (-682.561) (-685.362) * (-681.476) [-683.820] (-685.167) (-684.183) -- 0:00:42
      288500 -- (-685.577) [-681.059] (-681.852) (-686.299) * (-682.170) (-683.535) (-681.418) [-684.132] -- 0:00:41
      289000 -- [-680.641] (-682.051) (-681.008) (-681.411) * (-679.785) (-682.298) [-681.578] (-683.955) -- 0:00:41
      289500 -- (-682.064) [-688.032] (-681.225) (-681.769) * (-683.730) (-682.025) (-688.429) [-682.161] -- 0:00:41
      290000 -- (-682.713) (-682.146) (-683.697) [-682.070] * (-684.019) (-680.135) (-683.315) [-680.753] -- 0:00:41

      Average standard deviation of split frequencies: 0.011830

      290500 -- (-680.714) (-685.066) [-682.455] (-681.794) * [-683.924] (-684.497) (-681.415) (-683.355) -- 0:00:41
      291000 -- (-680.209) (-681.228) (-681.935) [-680.673] * (-684.474) (-681.858) [-679.894] (-682.596) -- 0:00:41
      291500 -- (-680.736) (-681.235) [-680.132] (-681.787) * (-681.345) [-681.174] (-681.249) (-680.068) -- 0:00:43
      292000 -- [-682.325] (-681.671) (-682.908) (-684.134) * (-681.675) (-680.217) (-681.966) [-682.132] -- 0:00:43
      292500 -- (-688.575) (-683.500) [-683.891] (-681.145) * [-680.535] (-681.899) (-682.476) (-680.912) -- 0:00:43
      293000 -- (-683.944) (-683.352) (-684.311) [-681.645] * (-681.292) (-681.458) [-680.428] (-681.242) -- 0:00:43
      293500 -- (-683.438) (-681.859) [-680.525] (-681.400) * (-681.872) (-681.302) (-680.857) [-681.144] -- 0:00:43
      294000 -- [-680.735] (-683.952) (-679.649) (-681.061) * (-680.956) (-681.130) [-684.034] (-680.945) -- 0:00:43
      294500 -- [-684.184] (-684.122) (-683.205) (-681.435) * (-684.967) [-680.541] (-684.032) (-685.999) -- 0:00:43
      295000 -- (-681.950) (-684.786) (-689.739) [-681.201] * (-680.142) [-680.630] (-681.785) (-682.459) -- 0:00:43

      Average standard deviation of split frequencies: 0.012085

      295500 -- (-685.325) (-684.000) [-680.965] (-681.944) * [-681.171] (-683.560) (-681.044) (-680.548) -- 0:00:42
      296000 -- (-680.246) [-682.563] (-681.779) (-682.800) * (-681.992) (-680.189) [-679.871] (-683.434) -- 0:00:42
      296500 -- (-680.043) [-683.552] (-686.890) (-680.041) * (-681.035) (-680.646) (-680.413) [-681.545] -- 0:00:42
      297000 -- (-683.359) [-681.304] (-683.428) (-681.447) * (-680.738) (-683.613) (-679.987) [-682.231] -- 0:00:42
      297500 -- (-685.398) (-684.493) [-684.939] (-685.256) * (-680.729) (-682.650) [-683.088] (-682.652) -- 0:00:42
      298000 -- [-685.090] (-682.959) (-684.346) (-684.164) * [-682.605] (-689.111) (-683.894) (-682.203) -- 0:00:42
      298500 -- [-683.159] (-684.264) (-684.110) (-682.278) * (-682.423) (-690.389) (-681.098) [-683.594] -- 0:00:42
      299000 -- (-682.030) [-682.613] (-683.263) (-688.943) * [-680.434] (-687.892) (-688.813) (-680.724) -- 0:00:42
      299500 -- [-683.961] (-683.201) (-681.056) (-684.862) * (-681.745) (-682.462) [-682.527] (-682.803) -- 0:00:42
      300000 -- (-681.335) (-682.045) (-682.657) [-683.723] * (-680.603) (-681.145) [-681.098] (-681.277) -- 0:00:42

      Average standard deviation of split frequencies: 0.013033

      300500 -- (-680.809) [-681.110] (-681.475) (-682.576) * (-681.290) (-681.153) [-682.970] (-681.813) -- 0:00:41
      301000 -- (-680.987) (-682.358) [-681.607] (-681.704) * (-680.827) [-683.393] (-680.732) (-681.402) -- 0:00:41
      301500 -- (-682.227) (-681.534) [-680.600] (-680.947) * (-683.242) (-686.206) (-681.829) [-682.374] -- 0:00:41
      302000 -- (-680.338) [-681.964] (-682.728) (-681.277) * (-683.715) [-681.872] (-683.744) (-682.301) -- 0:00:41
      302500 -- [-680.825] (-682.368) (-687.362) (-681.066) * (-683.653) [-680.378] (-681.315) (-684.555) -- 0:00:41
      303000 -- (-684.488) (-680.831) [-682.094] (-681.476) * (-681.408) [-684.007] (-684.331) (-682.112) -- 0:00:41
      303500 -- (-679.982) (-682.316) [-679.747] (-681.385) * [-682.903] (-680.971) (-680.764) (-680.883) -- 0:00:41
      304000 -- (-685.052) (-682.393) [-679.966] (-684.114) * (-684.339) (-681.429) [-685.313] (-682.582) -- 0:00:41
      304500 -- (-684.473) (-682.182) [-681.356] (-683.740) * [-683.767] (-684.520) (-680.662) (-681.948) -- 0:00:41
      305000 -- (-682.860) (-680.464) (-679.917) [-682.986] * [-681.827] (-684.514) (-681.748) (-683.411) -- 0:00:41

      Average standard deviation of split frequencies: 0.012596

      305500 -- (-680.506) [-681.045] (-680.858) (-684.181) * (-681.617) [-682.554] (-680.462) (-680.260) -- 0:00:40
      306000 -- (-683.670) [-680.297] (-680.595) (-687.504) * [-682.644] (-682.136) (-684.097) (-680.458) -- 0:00:40
      306500 -- (-682.702) (-682.854) [-680.632] (-681.944) * (-683.353) [-685.251] (-680.940) (-686.376) -- 0:00:40
      307000 -- (-683.607) (-682.482) [-680.674] (-683.263) * (-683.619) [-683.297] (-680.922) (-684.154) -- 0:00:40
      307500 -- (-680.843) [-680.747] (-681.163) (-684.785) * (-682.050) [-680.718] (-682.960) (-680.424) -- 0:00:42
      308000 -- (-680.615) [-681.131] (-685.502) (-683.790) * (-681.461) (-681.695) [-679.713] (-679.464) -- 0:00:42
      308500 -- [-680.174] (-680.106) (-683.353) (-683.976) * (-685.855) (-680.825) [-680.868] (-681.444) -- 0:00:42
      309000 -- [-679.939] (-681.197) (-684.349) (-681.699) * [-680.080] (-679.887) (-680.520) (-681.630) -- 0:00:42
      309500 -- (-681.599) (-680.678) [-683.979] (-680.415) * (-684.900) [-680.927] (-682.313) (-685.701) -- 0:00:42
      310000 -- (-682.294) [-680.729] (-682.423) (-682.022) * [-681.180] (-681.200) (-682.372) (-680.068) -- 0:00:42

      Average standard deviation of split frequencies: 0.012942

      310500 -- [-684.327] (-681.394) (-681.915) (-689.855) * (-679.858) (-682.685) [-680.770] (-683.665) -- 0:00:42
      311000 -- (-680.991) (-682.155) (-681.259) [-682.238] * (-679.982) (-680.427) (-680.161) [-680.701] -- 0:00:42
      311500 -- (-680.537) (-681.797) (-682.079) [-680.782] * (-679.746) (-679.580) [-682.213] (-680.844) -- 0:00:41
      312000 -- (-682.357) (-680.750) (-681.552) [-680.990] * (-680.157) [-680.987] (-680.873) (-680.246) -- 0:00:41
      312500 -- (-683.059) [-681.234] (-682.307) (-687.577) * (-683.395) [-681.181] (-681.141) (-681.859) -- 0:00:41
      313000 -- [-680.687] (-680.213) (-681.570) (-680.752) * [-680.440] (-681.310) (-680.182) (-684.398) -- 0:00:41
      313500 -- [-682.123] (-681.729) (-681.895) (-683.823) * (-684.690) [-683.706] (-681.973) (-681.580) -- 0:00:41
      314000 -- (-679.618) (-682.075) [-680.982] (-681.490) * (-686.663) (-682.519) [-680.938] (-679.965) -- 0:00:41
      314500 -- (-680.514) [-682.883] (-683.675) (-682.937) * (-682.116) (-682.823) (-680.196) [-681.395] -- 0:00:41
      315000 -- [-681.318] (-682.612) (-682.376) (-683.291) * (-682.762) (-681.354) [-681.215] (-680.700) -- 0:00:41

      Average standard deviation of split frequencies: 0.012900

      315500 -- (-681.102) [-680.681] (-680.061) (-680.496) * (-681.881) (-681.550) (-683.077) [-680.338] -- 0:00:41
      316000 -- (-680.962) (-684.483) [-681.793] (-683.010) * (-681.270) (-681.064) [-683.830] (-681.269) -- 0:00:41
      316500 -- (-681.304) (-682.528) [-680.708] (-683.603) * (-684.464) (-684.714) [-683.441] (-684.209) -- 0:00:41
      317000 -- (-681.249) (-685.041) [-680.968] (-683.997) * (-685.040) (-681.071) [-680.873] (-684.880) -- 0:00:40
      317500 -- (-682.336) (-681.996) [-683.414] (-682.372) * (-682.104) (-681.561) [-680.570] (-682.156) -- 0:00:40
      318000 -- [-681.177] (-684.782) (-681.465) (-682.458) * (-682.276) [-682.459] (-680.648) (-681.844) -- 0:00:40
      318500 -- (-681.332) (-680.197) [-682.685] (-684.963) * (-682.904) [-683.220] (-681.290) (-680.365) -- 0:00:40
      319000 -- (-685.364) [-680.772] (-681.412) (-681.072) * [-682.514] (-682.570) (-683.196) (-681.037) -- 0:00:40
      319500 -- (-680.948) (-682.577) (-684.533) [-681.120] * [-682.308] (-682.714) (-682.006) (-680.911) -- 0:00:40
      320000 -- (-681.471) [-680.979] (-680.650) (-680.986) * (-688.437) (-683.074) (-680.229) [-681.543] -- 0:00:40

      Average standard deviation of split frequencies: 0.012798

      320500 -- (-680.713) (-683.701) (-684.005) [-681.936] * (-684.264) (-680.482) [-684.391] (-682.891) -- 0:00:40
      321000 -- (-684.324) (-692.160) [-682.642] (-684.566) * (-682.458) [-681.945] (-681.545) (-682.096) -- 0:00:40
      321500 -- (-682.968) (-687.583) [-682.547] (-681.135) * (-682.128) (-684.126) (-681.315) [-681.677] -- 0:00:40
      322000 -- (-685.554) [-682.639] (-681.455) (-680.965) * (-682.162) (-681.241) [-682.117] (-680.067) -- 0:00:40
      322500 -- (-682.872) [-680.332] (-682.203) (-683.139) * (-681.294) (-681.152) [-681.563] (-680.517) -- 0:00:39
      323000 -- [-680.743] (-680.031) (-683.667) (-681.176) * (-682.775) (-681.177) [-680.801] (-681.321) -- 0:00:39
      323500 -- (-684.507) [-682.681] (-682.742) (-679.520) * (-681.592) [-682.018] (-681.258) (-686.064) -- 0:00:39
      324000 -- (-684.454) (-683.176) (-685.151) [-680.169] * (-680.347) [-685.110] (-684.713) (-686.076) -- 0:00:41
      324500 -- (-682.557) (-684.657) (-685.605) [-680.155] * [-682.461] (-684.143) (-684.851) (-682.969) -- 0:00:41
      325000 -- (-681.428) (-682.932) (-680.384) [-680.124] * (-683.594) [-686.502] (-684.255) (-680.724) -- 0:00:41

      Average standard deviation of split frequencies: 0.012674

      325500 -- (-685.514) (-684.523) (-680.659) [-680.002] * (-682.434) [-687.637] (-683.847) (-682.918) -- 0:00:41
      326000 -- (-679.623) [-681.685] (-681.940) (-681.194) * (-683.835) (-682.470) [-685.169] (-682.450) -- 0:00:41
      326500 -- (-681.752) [-682.715] (-683.734) (-681.440) * [-680.998] (-681.767) (-684.069) (-683.403) -- 0:00:41
      327000 -- [-683.059] (-682.782) (-680.792) (-681.553) * (-682.332) [-681.233] (-681.523) (-683.346) -- 0:00:41
      327500 -- (-681.217) [-680.968] (-680.676) (-682.289) * (-681.718) (-682.376) (-681.208) [-683.030] -- 0:00:41
      328000 -- (-681.220) [-685.290] (-681.547) (-680.691) * (-682.489) (-684.526) (-682.723) [-680.514] -- 0:00:40
      328500 -- [-682.441] (-681.726) (-683.302) (-681.056) * [-683.352] (-680.643) (-681.101) (-683.452) -- 0:00:40
      329000 -- (-682.274) (-682.417) [-682.604] (-682.279) * [-681.872] (-679.738) (-682.444) (-683.695) -- 0:00:40
      329500 -- (-683.086) [-682.169] (-680.265) (-682.410) * (-683.447) (-679.989) [-682.184] (-681.687) -- 0:00:40
      330000 -- (-684.127) [-680.998] (-681.833) (-686.586) * (-682.537) (-681.324) [-680.042] (-682.459) -- 0:00:40

      Average standard deviation of split frequencies: 0.013227

      330500 -- (-680.336) (-685.222) [-683.048] (-680.934) * [-681.544] (-682.309) (-680.676) (-682.858) -- 0:00:40
      331000 -- [-683.578] (-681.682) (-683.300) (-682.267) * (-684.719) (-682.360) (-681.201) [-680.644] -- 0:00:40
      331500 -- (-684.522) (-689.342) (-685.564) [-679.919] * [-681.600] (-680.282) (-682.639) (-680.989) -- 0:00:40
      332000 -- [-681.375] (-684.696) (-689.472) (-682.703) * (-680.965) (-681.606) (-681.805) [-680.344] -- 0:00:40
      332500 -- (-680.391) (-683.116) [-684.343] (-682.736) * [-683.314] (-680.401) (-690.419) (-681.251) -- 0:00:40
      333000 -- (-680.798) (-680.183) [-682.767] (-684.383) * (-681.392) [-683.831] (-683.635) (-682.416) -- 0:00:40
      333500 -- (-680.111) (-683.131) (-683.647) [-681.975] * (-681.517) (-683.009) (-684.473) [-683.621] -- 0:00:39
      334000 -- (-682.214) (-681.690) (-679.928) [-684.941] * (-680.724) [-681.455] (-682.583) (-683.650) -- 0:00:39
      334500 -- (-681.669) (-681.852) [-681.157] (-683.137) * (-682.537) (-682.027) (-680.227) [-682.722] -- 0:00:39
      335000 -- [-682.956] (-684.825) (-680.694) (-683.247) * (-681.468) (-682.530) [-680.847] (-679.824) -- 0:00:39

      Average standard deviation of split frequencies: 0.013173

      335500 -- (-683.439) (-685.461) (-681.953) [-680.705] * (-686.093) (-680.735) (-682.183) [-680.970] -- 0:00:39
      336000 -- (-680.379) (-681.691) [-681.845] (-681.329) * [-681.661] (-679.771) (-683.274) (-681.953) -- 0:00:39
      336500 -- (-681.341) (-681.600) [-682.726] (-682.666) * [-682.446] (-681.786) (-681.186) (-680.067) -- 0:00:39
      337000 -- (-685.554) (-684.815) (-681.350) [-681.754] * (-685.060) [-685.525] (-684.387) (-681.035) -- 0:00:39
      337500 -- (-682.230) [-680.056] (-680.990) (-688.047) * (-682.792) (-684.649) [-683.113] (-681.716) -- 0:00:39
      338000 -- (-681.843) [-680.598] (-685.920) (-685.069) * (-681.221) (-683.625) [-686.333] (-685.532) -- 0:00:39
      338500 -- (-681.304) (-684.412) (-688.736) [-681.345] * (-684.265) (-683.921) [-680.413] (-679.868) -- 0:00:39
      339000 -- (-684.446) [-685.248] (-689.845) (-686.916) * (-684.155) (-682.166) [-680.033] (-679.671) -- 0:00:38
      339500 -- (-685.136) [-682.445] (-685.117) (-681.875) * (-682.889) (-681.362) (-681.313) [-682.797] -- 0:00:38
      340000 -- (-683.998) [-682.924] (-680.464) (-683.779) * (-681.233) (-681.129) [-681.220] (-681.216) -- 0:00:38

      Average standard deviation of split frequencies: 0.013530

      340500 -- [-682.754] (-682.503) (-680.483) (-686.856) * (-684.858) [-680.843] (-682.916) (-680.700) -- 0:00:40
      341000 -- (-681.097) (-681.287) [-681.483] (-681.448) * [-683.394] (-681.941) (-682.017) (-680.379) -- 0:00:40
      341500 -- (-680.605) (-683.959) [-682.269] (-680.835) * (-681.451) (-688.910) [-682.720] (-682.617) -- 0:00:40
      342000 -- [-680.312] (-679.837) (-684.607) (-681.846) * (-680.053) (-681.696) (-685.044) [-682.323] -- 0:00:40
      342500 -- (-680.566) (-681.337) [-681.352] (-684.818) * [-682.382] (-682.704) (-683.242) (-683.231) -- 0:00:40
      343000 -- [-687.679] (-682.619) (-680.876) (-683.441) * (-681.564) (-682.751) [-682.964] (-681.789) -- 0:00:40
      343500 -- (-689.404) (-681.240) (-682.775) [-684.261] * (-682.778) [-686.294] (-682.279) (-681.751) -- 0:00:40
      344000 -- (-680.591) (-680.620) [-680.070] (-680.910) * (-679.650) (-682.516) [-682.271] (-681.339) -- 0:00:40
      344500 -- [-682.246] (-682.286) (-681.752) (-682.848) * (-680.114) [-682.882] (-685.087) (-681.646) -- 0:00:39
      345000 -- (-681.764) (-680.609) (-681.949) [-681.759] * (-681.149) [-681.659] (-682.283) (-681.638) -- 0:00:39

      Average standard deviation of split frequencies: 0.013397

      345500 -- (-684.242) (-680.349) (-680.425) [-681.835] * [-681.242] (-680.552) (-683.104) (-685.847) -- 0:00:39
      346000 -- (-684.586) (-680.549) (-680.521) [-679.814] * (-684.952) (-681.189) (-682.856) [-682.032] -- 0:00:39
      346500 -- (-681.148) (-680.633) (-682.084) [-682.914] * (-680.600) (-680.983) [-681.463] (-681.416) -- 0:00:39
      347000 -- (-681.343) [-681.871] (-683.742) (-682.492) * (-681.703) [-682.936] (-685.001) (-680.808) -- 0:00:39
      347500 -- (-681.214) (-682.112) (-680.985) [-680.829] * [-682.626] (-683.544) (-681.254) (-681.640) -- 0:00:39
      348000 -- (-681.270) (-681.438) (-683.601) [-683.146] * (-680.465) (-681.650) [-681.811] (-682.690) -- 0:00:39
      348500 -- (-683.056) (-680.577) [-683.812] (-682.350) * [-680.431] (-680.633) (-680.883) (-681.504) -- 0:00:39
      349000 -- (-681.742) (-680.059) [-681.281] (-682.535) * (-683.647) [-683.591] (-680.936) (-682.212) -- 0:00:39
      349500 -- (-681.583) [-682.442] (-682.221) (-681.576) * [-680.186] (-682.868) (-681.175) (-681.828) -- 0:00:39
      350000 -- (-683.800) (-680.568) (-681.155) [-681.520] * (-680.341) [-680.676] (-681.682) (-681.689) -- 0:00:39

      Average standard deviation of split frequencies: 0.013231

      350500 -- (-680.332) (-682.759) (-683.998) [-681.485] * [-680.473] (-682.801) (-682.024) (-680.559) -- 0:00:38
      351000 -- (-685.278) [-681.666] (-681.846) (-681.126) * (-681.395) (-681.952) [-682.027] (-686.286) -- 0:00:38
      351500 -- [-683.603] (-682.588) (-683.140) (-680.425) * (-680.441) (-680.800) [-680.111] (-687.173) -- 0:00:38
      352000 -- [-680.283] (-680.825) (-681.448) (-681.575) * (-683.065) (-682.708) [-682.051] (-680.573) -- 0:00:38
      352500 -- (-682.530) (-681.352) (-684.394) [-680.046] * [-680.718] (-680.331) (-680.862) (-682.840) -- 0:00:38
      353000 -- (-682.712) [-681.338] (-680.998) (-680.645) * (-680.399) (-680.699) [-681.045] (-681.999) -- 0:00:38
      353500 -- (-682.704) [-681.415] (-681.065) (-680.577) * (-681.863) [-682.379] (-681.714) (-683.184) -- 0:00:38
      354000 -- (-679.706) (-684.868) (-683.038) [-681.353] * (-685.555) [-681.355] (-681.786) (-680.772) -- 0:00:38
      354500 -- (-680.777) (-682.099) (-680.985) [-681.530] * (-683.931) [-679.844] (-682.925) (-680.429) -- 0:00:38
      355000 -- [-682.006] (-681.250) (-681.768) (-682.251) * [-681.021] (-682.476) (-684.119) (-683.574) -- 0:00:38

      Average standard deviation of split frequencies: 0.013008

      355500 -- (-684.108) (-684.637) [-681.442] (-684.895) * [-680.441] (-681.075) (-680.833) (-683.711) -- 0:00:38
      356000 -- (-679.862) (-682.221) [-680.176] (-681.662) * [-681.055] (-680.518) (-682.731) (-683.729) -- 0:00:37
      356500 -- (-684.721) [-682.426] (-682.633) (-682.000) * (-679.966) [-680.150] (-681.510) (-683.429) -- 0:00:37
      357000 -- [-679.661] (-685.606) (-682.157) (-681.188) * [-679.714] (-682.304) (-688.760) (-682.135) -- 0:00:37
      357500 -- (-680.657) (-684.003) [-688.847] (-682.635) * (-681.887) (-682.347) [-682.173] (-684.969) -- 0:00:39
      358000 -- (-680.716) (-681.539) [-681.338] (-681.762) * (-682.788) [-681.998] (-683.083) (-680.669) -- 0:00:39
      358500 -- (-681.972) (-681.451) (-680.702) [-682.048] * (-684.573) (-680.295) [-681.579] (-684.234) -- 0:00:39
      359000 -- (-685.454) (-682.439) [-680.304] (-681.527) * (-683.092) (-679.597) [-680.784] (-680.714) -- 0:00:39
      359500 -- (-680.526) [-681.718] (-682.685) (-680.333) * [-681.641] (-684.560) (-680.438) (-680.098) -- 0:00:39
      360000 -- (-680.542) [-681.295] (-680.488) (-680.240) * [-680.693] (-680.506) (-681.154) (-680.966) -- 0:00:39

      Average standard deviation of split frequencies: 0.013651

      360500 -- (-681.853) (-680.793) (-682.313) [-680.005] * (-682.519) (-680.569) [-684.733] (-681.557) -- 0:00:39
      361000 -- (-685.505) (-680.999) (-681.765) [-680.463] * (-681.886) (-686.352) (-682.133) [-683.996] -- 0:00:38
      361500 -- (-679.880) (-680.070) (-681.927) [-680.734] * (-679.933) [-681.963] (-683.982) (-682.041) -- 0:00:38
      362000 -- (-681.602) (-680.798) [-679.955] (-682.663) * (-681.118) (-681.019) (-681.063) [-683.154] -- 0:00:38
      362500 -- (-683.663) (-681.483) (-681.919) [-681.822] * (-680.869) [-680.853] (-680.975) (-679.784) -- 0:00:38
      363000 -- (-685.131) (-681.869) [-683.013] (-682.199) * (-680.544) [-681.963] (-683.964) (-681.779) -- 0:00:38
      363500 -- [-683.237] (-681.678) (-685.630) (-682.041) * [-681.574] (-684.745) (-684.132) (-681.458) -- 0:00:38
      364000 -- (-687.577) (-680.836) (-682.632) [-681.646] * (-683.597) (-685.331) (-682.512) [-683.986] -- 0:00:38
      364500 -- (-681.098) [-683.664] (-680.237) (-683.546) * [-680.794] (-682.004) (-680.893) (-684.265) -- 0:00:38
      365000 -- [-680.600] (-684.080) (-680.347) (-682.733) * (-680.117) (-680.403) (-680.688) [-684.164] -- 0:00:38

      Average standard deviation of split frequencies: 0.015027

      365500 -- [-680.711] (-686.151) (-679.982) (-684.308) * (-682.747) (-682.361) [-683.968] (-684.530) -- 0:00:38
      366000 -- (-683.580) (-684.602) (-680.157) [-681.477] * (-682.909) [-681.995] (-680.508) (-681.591) -- 0:00:38
      366500 -- (-681.073) [-681.780] (-679.597) (-681.923) * (-682.628) (-681.656) (-684.533) [-680.440] -- 0:00:38
      367000 -- (-681.288) (-682.535) (-686.954) [-680.380] * (-683.885) [-681.028] (-680.581) (-682.150) -- 0:00:37
      367500 -- [-680.319] (-683.881) (-685.924) (-681.546) * (-685.051) (-684.957) [-683.822] (-681.313) -- 0:00:37
      368000 -- (-682.173) (-681.442) (-683.481) [-680.420] * (-684.530) (-683.779) (-681.812) [-680.745] -- 0:00:37
      368500 -- [-682.427] (-682.948) (-680.610) (-682.543) * (-682.436) (-681.476) [-681.610] (-691.555) -- 0:00:37
      369000 -- (-684.389) [-683.164] (-679.953) (-682.628) * [-681.992] (-681.712) (-682.220) (-685.580) -- 0:00:37
      369500 -- (-684.186) [-686.011] (-681.549) (-684.327) * [-681.964] (-682.169) (-681.495) (-681.777) -- 0:00:37
      370000 -- (-682.201) (-680.328) (-681.498) [-683.613] * (-681.733) (-683.525) [-680.540] (-683.938) -- 0:00:37

      Average standard deviation of split frequencies: 0.013919

      370500 -- (-681.263) (-681.068) (-686.403) [-681.925] * (-681.802) [-680.666] (-682.361) (-682.340) -- 0:00:37
      371000 -- (-680.433) (-681.994) (-681.227) [-681.723] * (-682.454) [-680.397] (-684.494) (-681.492) -- 0:00:37
      371500 -- (-681.863) (-686.088) [-681.880] (-681.760) * (-684.647) (-684.504) [-681.033] (-681.634) -- 0:00:37
      372000 -- (-680.335) [-680.986] (-680.878) (-685.173) * (-681.431) (-683.910) [-680.939] (-683.204) -- 0:00:37
      372500 -- (-682.839) (-684.104) [-683.237] (-681.134) * (-684.215) [-679.669] (-680.640) (-681.451) -- 0:00:37
      373000 -- (-685.445) [-682.472] (-681.713) (-680.451) * (-683.314) [-679.790] (-680.908) (-681.319) -- 0:00:36
      373500 -- (-681.650) (-681.299) [-680.802] (-682.402) * (-681.436) (-681.431) (-680.016) [-680.415] -- 0:00:36
      374000 -- [-681.827] (-681.597) (-681.955) (-680.963) * (-680.572) (-680.763) (-682.087) [-681.761] -- 0:00:36
      374500 -- [-680.538] (-680.950) (-681.976) (-682.673) * (-681.425) [-685.026] (-682.858) (-681.151) -- 0:00:38
      375000 -- (-680.409) (-681.585) (-680.604) [-682.143] * (-680.954) (-682.208) [-680.859] (-681.138) -- 0:00:38

      Average standard deviation of split frequencies: 0.013025

      375500 -- (-681.997) (-680.787) (-680.375) [-683.349] * (-680.954) (-681.091) (-680.581) [-682.464] -- 0:00:38
      376000 -- (-683.293) (-681.980) [-680.397] (-687.088) * [-681.830] (-682.793) (-682.729) (-686.448) -- 0:00:38
      376500 -- [-682.610] (-680.982) (-685.597) (-679.967) * (-688.738) [-681.554] (-680.496) (-687.633) -- 0:00:38
      377000 -- (-682.762) (-681.428) (-679.771) [-682.003] * (-685.078) (-681.513) [-681.747] (-683.190) -- 0:00:38
      377500 -- (-683.511) (-680.710) [-680.304] (-681.988) * [-680.772] (-683.309) (-680.660) (-682.115) -- 0:00:37
      378000 -- (-684.323) (-680.422) [-684.327] (-681.625) * (-682.127) (-682.749) (-680.827) [-683.956] -- 0:00:37
      378500 -- [-685.667] (-681.354) (-684.025) (-680.854) * [-683.024] (-681.894) (-685.269) (-680.990) -- 0:00:37
      379000 -- (-679.963) (-681.173) (-681.551) [-681.659] * (-681.170) (-682.722) [-682.534] (-681.157) -- 0:00:37
      379500 -- [-681.282] (-682.466) (-681.167) (-682.954) * [-687.338] (-682.166) (-683.692) (-683.252) -- 0:00:37
      380000 -- (-682.997) (-681.484) [-680.760] (-681.457) * (-684.112) (-683.887) (-683.193) [-682.450] -- 0:00:37

      Average standard deviation of split frequencies: 0.013331

      380500 -- (-684.577) (-685.294) (-681.922) [-680.643] * (-682.817) (-683.506) (-682.772) [-681.770] -- 0:00:37
      381000 -- (-682.297) (-683.917) [-683.191] (-682.184) * (-682.543) (-682.781) [-680.323] (-681.847) -- 0:00:37
      381500 -- (-683.819) (-683.599) [-682.936] (-681.739) * (-680.320) [-681.807] (-683.040) (-681.011) -- 0:00:37
      382000 -- (-682.922) (-680.932) [-683.024] (-682.027) * [-680.578] (-681.800) (-683.869) (-683.138) -- 0:00:37
      382500 -- (-683.795) (-680.731) [-682.033] (-681.521) * [-680.603] (-686.762) (-681.817) (-681.967) -- 0:00:37
      383000 -- (-681.499) [-681.442] (-680.693) (-683.404) * [-680.582] (-683.538) (-680.613) (-683.109) -- 0:00:37
      383500 -- (-680.469) [-681.752] (-683.357) (-683.370) * [-680.104] (-683.191) (-682.837) (-680.417) -- 0:00:36
      384000 -- (-683.760) (-680.712) [-681.949] (-684.615) * (-681.167) (-681.276) [-681.999] (-683.140) -- 0:00:36
      384500 -- (-684.744) [-680.781] (-681.268) (-682.241) * (-683.351) [-683.120] (-681.766) (-683.016) -- 0:00:36
      385000 -- (-682.205) [-680.101] (-681.804) (-682.779) * (-680.356) [-682.298] (-680.656) (-682.085) -- 0:00:36

      Average standard deviation of split frequencies: 0.013003

      385500 -- (-682.764) (-681.353) [-681.190] (-683.186) * [-683.142] (-682.373) (-682.315) (-680.936) -- 0:00:36
      386000 -- [-682.919] (-685.649) (-681.935) (-682.899) * (-685.772) [-680.321] (-683.141) (-681.070) -- 0:00:36
      386500 -- (-681.342) (-683.172) [-681.332] (-681.519) * [-681.736] (-682.644) (-682.100) (-681.637) -- 0:00:36
      387000 -- (-681.333) (-682.129) (-684.950) [-682.866] * [-680.389] (-681.811) (-684.449) (-682.228) -- 0:00:36
      387500 -- (-681.472) (-681.560) [-681.449] (-679.950) * (-681.236) [-682.446] (-682.065) (-682.266) -- 0:00:36
      388000 -- (-684.239) (-683.453) [-680.311] (-681.147) * [-681.154] (-681.471) (-679.724) (-684.367) -- 0:00:36
      388500 -- (-681.357) [-681.440] (-681.279) (-683.232) * (-680.684) (-681.502) (-682.357) [-681.986] -- 0:00:36
      389000 -- (-681.703) [-685.015] (-684.558) (-685.129) * [-681.202] (-681.534) (-682.135) (-681.493) -- 0:00:36
      389500 -- (-680.555) (-680.341) [-680.376] (-680.808) * (-680.590) (-681.606) (-685.200) [-681.308] -- 0:00:36
      390000 -- (-682.044) [-682.808] (-681.412) (-684.128) * [-681.568] (-682.397) (-682.053) (-680.659) -- 0:00:35

      Average standard deviation of split frequencies: 0.013131

      390500 -- (-691.508) (-680.377) (-681.185) [-680.377] * (-683.243) (-682.269) [-680.743] (-681.631) -- 0:00:35
      391000 -- (-680.372) [-680.219] (-684.818) (-686.650) * (-680.233) (-680.675) [-680.389] (-682.980) -- 0:00:37
      391500 -- (-681.965) (-681.174) [-682.794] (-681.504) * (-680.720) [-682.334] (-681.626) (-688.336) -- 0:00:37
      392000 -- (-682.232) (-681.299) [-683.634] (-681.256) * (-691.471) (-681.018) (-683.323) [-684.641] -- 0:00:37
      392500 -- (-681.988) (-680.651) (-680.914) [-680.392] * (-685.396) [-680.956] (-682.865) (-681.146) -- 0:00:37
      393000 -- [-680.752] (-680.869) (-681.046) (-682.040) * (-681.861) [-684.004] (-681.631) (-682.503) -- 0:00:37
      393500 -- (-682.141) [-683.013] (-680.028) (-685.257) * (-680.555) (-682.651) (-679.754) [-680.164] -- 0:00:36
      394000 -- (-685.888) (-684.684) (-685.486) [-690.000] * (-681.249) [-681.799] (-679.501) (-681.391) -- 0:00:36
      394500 -- (-682.694) (-683.648) [-686.509] (-691.578) * (-680.604) [-682.300] (-685.902) (-680.391) -- 0:00:36
      395000 -- (-682.997) (-682.789) [-686.714] (-690.117) * [-682.236] (-685.274) (-683.280) (-682.301) -- 0:00:36

      Average standard deviation of split frequencies: 0.012276

      395500 -- (-681.878) (-680.214) [-684.012] (-684.386) * (-688.735) (-680.048) (-681.119) [-681.867] -- 0:00:36
      396000 -- [-681.176] (-680.553) (-683.962) (-685.084) * (-681.385) [-680.112] (-683.591) (-682.858) -- 0:00:36
      396500 -- (-683.274) [-681.309] (-682.701) (-683.540) * (-682.301) (-680.952) [-681.936] (-681.837) -- 0:00:36
      397000 -- [-684.265] (-682.929) (-685.018) (-680.703) * (-680.319) (-683.355) (-683.603) [-683.180] -- 0:00:36
      397500 -- (-681.297) (-680.964) [-683.114] (-684.525) * (-682.698) (-681.693) (-684.724) [-680.908] -- 0:00:36
      398000 -- [-681.417] (-680.910) (-682.798) (-682.015) * (-680.289) (-680.457) [-683.983] (-683.216) -- 0:00:36
      398500 -- (-681.349) (-680.026) (-683.253) [-684.107] * (-684.406) [-680.253] (-682.810) (-682.724) -- 0:00:36
      399000 -- (-683.630) [-681.501] (-680.865) (-680.176) * [-684.256] (-680.135) (-683.989) (-680.433) -- 0:00:36
      399500 -- (-683.007) (-682.973) (-680.373) [-684.012] * (-681.113) (-682.207) (-683.178) [-679.979] -- 0:00:36
      400000 -- (-683.939) (-682.500) (-680.044) [-681.175] * (-680.343) (-681.706) [-680.187] (-684.921) -- 0:00:36

      Average standard deviation of split frequencies: 0.012079

      400500 -- (-680.301) (-683.578) [-681.970] (-681.858) * (-682.154) [-681.551] (-682.371) (-684.163) -- 0:00:35
      401000 -- (-680.430) (-681.255) [-683.010] (-681.812) * (-684.748) (-683.385) [-682.189] (-683.591) -- 0:00:35
      401500 -- (-680.382) (-684.204) [-680.063] (-681.062) * (-682.164) (-684.604) [-680.389] (-682.736) -- 0:00:35
      402000 -- (-686.565) [-680.668] (-683.616) (-684.920) * (-681.957) [-684.033] (-680.176) (-682.578) -- 0:00:35
      402500 -- (-680.637) (-680.820) [-681.967] (-681.691) * [-684.375] (-679.529) (-681.187) (-684.068) -- 0:00:35
      403000 -- (-681.046) (-680.983) (-682.024) [-681.346] * [-680.486] (-688.066) (-683.545) (-682.044) -- 0:00:35
      403500 -- (-682.910) (-680.391) [-681.742] (-680.418) * (-681.419) (-684.688) [-682.770] (-680.124) -- 0:00:35
      404000 -- (-682.525) (-682.222) [-681.302] (-682.250) * [-680.843] (-683.197) (-680.281) (-680.663) -- 0:00:35
      404500 -- (-683.990) (-682.128) [-681.782] (-683.452) * [-680.953] (-684.433) (-681.908) (-689.145) -- 0:00:35
      405000 -- (-681.293) (-681.207) (-683.207) [-680.665] * (-682.229) [-681.652] (-680.675) (-683.312) -- 0:00:35

      Average standard deviation of split frequencies: 0.012482

      405500 -- [-680.537] (-680.950) (-684.442) (-682.616) * (-681.967) (-681.463) [-680.674] (-683.558) -- 0:00:35
      406000 -- (-681.287) (-681.635) (-680.854) [-679.418] * (-680.464) [-682.725] (-684.961) (-681.058) -- 0:00:35
      406500 -- (-680.456) (-685.050) (-682.084) [-682.484] * (-683.264) [-680.846] (-683.929) (-681.840) -- 0:00:35
      407000 -- (-684.697) [-686.662] (-686.169) (-681.230) * [-683.066] (-682.198) (-685.879) (-679.813) -- 0:00:34
      407500 -- (-682.323) (-683.417) [-680.528] (-680.292) * [-682.853] (-682.556) (-680.847) (-682.111) -- 0:00:34
      408000 -- [-683.595] (-684.449) (-679.493) (-679.571) * (-684.316) (-682.003) [-685.518] (-684.538) -- 0:00:36
      408500 -- [-682.460] (-680.693) (-682.173) (-679.990) * (-682.459) (-688.912) (-689.234) [-679.974] -- 0:00:36
      409000 -- (-683.372) (-681.474) (-683.023) [-683.376] * (-681.844) [-681.543] (-679.733) (-682.830) -- 0:00:36
      409500 -- (-681.679) [-680.487] (-681.252) (-682.019) * [-680.073] (-680.811) (-681.239) (-685.060) -- 0:00:36
      410000 -- (-681.754) [-681.772] (-681.430) (-682.646) * (-681.105) (-681.411) [-683.466] (-682.577) -- 0:00:35

      Average standard deviation of split frequencies: 0.012125

      410500 -- (-681.790) (-683.314) (-683.213) [-681.363] * [-679.689] (-684.642) (-681.565) (-684.042) -- 0:00:35
      411000 -- (-683.866) (-682.984) (-680.584) [-681.357] * (-681.665) [-684.323] (-681.033) (-681.905) -- 0:00:35
      411500 -- [-682.968] (-680.160) (-686.575) (-682.258) * (-683.465) (-682.903) [-681.509] (-683.944) -- 0:00:35
      412000 -- (-679.955) [-681.355] (-687.978) (-680.689) * [-683.213] (-683.600) (-681.095) (-682.494) -- 0:00:35
      412500 -- (-680.699) (-684.079) [-681.442] (-682.378) * [-680.309] (-682.416) (-681.057) (-682.296) -- 0:00:35
      413000 -- (-682.225) (-681.726) (-680.578) [-680.500] * (-684.796) [-680.610] (-681.515) (-682.016) -- 0:00:35
      413500 -- (-679.781) [-680.366] (-681.419) (-681.851) * [-682.896] (-679.673) (-680.922) (-683.483) -- 0:00:35
      414000 -- (-681.508) [-682.921] (-684.032) (-686.183) * [-684.199] (-679.568) (-680.719) (-681.909) -- 0:00:35
      414500 -- (-682.027) (-679.531) (-680.407) [-680.386] * [-681.371] (-679.797) (-684.329) (-683.330) -- 0:00:35
      415000 -- (-686.358) (-682.682) [-681.170] (-683.435) * (-683.206) (-680.276) [-680.380] (-680.054) -- 0:00:35

      Average standard deviation of split frequencies: 0.011686

      415500 -- (-682.562) [-682.253] (-683.910) (-681.483) * (-684.428) [-680.052] (-684.973) (-680.908) -- 0:00:35
      416000 -- (-680.927) (-684.341) (-683.627) [-685.303] * [-681.384] (-681.380) (-686.622) (-680.659) -- 0:00:35
      416500 -- (-679.763) (-682.460) [-681.663] (-680.668) * (-683.522) (-680.477) [-679.897] (-682.881) -- 0:00:35
      417000 -- (-684.059) (-683.105) (-683.041) [-685.205] * (-681.717) (-680.210) (-683.364) [-683.961] -- 0:00:34
      417500 -- [-680.883] (-681.211) (-681.667) (-684.332) * [-681.490] (-682.488) (-680.919) (-681.981) -- 0:00:34
      418000 -- (-680.163) (-681.741) (-680.767) [-681.922] * [-681.059] (-682.139) (-682.918) (-681.222) -- 0:00:34
      418500 -- (-680.715) (-682.292) (-683.950) [-680.784] * (-681.523) [-682.600] (-685.614) (-681.762) -- 0:00:34
      419000 -- [-681.373] (-680.608) (-680.804) (-686.128) * (-682.980) (-681.232) (-680.347) [-680.687] -- 0:00:34
      419500 -- (-681.400) (-680.133) (-679.874) [-686.077] * (-681.959) [-682.635] (-681.059) (-682.594) -- 0:00:34
      420000 -- (-684.538) (-680.074) [-680.783] (-683.375) * (-681.411) (-683.870) [-682.902] (-679.801) -- 0:00:34

      Average standard deviation of split frequencies: 0.012117

      420500 -- [-683.535] (-680.703) (-680.113) (-681.583) * [-682.043] (-681.108) (-682.714) (-679.607) -- 0:00:34
      421000 -- [-684.600] (-681.530) (-684.866) (-682.477) * (-681.374) (-681.437) (-684.727) [-679.980] -- 0:00:34
      421500 -- [-684.845] (-680.726) (-680.787) (-681.601) * [-680.215] (-681.051) (-683.619) (-681.475) -- 0:00:34
      422000 -- (-685.219) (-680.825) [-681.436] (-682.365) * (-679.975) (-680.390) [-682.124] (-679.785) -- 0:00:34
      422500 -- (-682.698) (-681.759) [-683.665] (-681.070) * (-683.652) (-681.325) [-680.313] (-682.672) -- 0:00:34
      423000 -- (-683.416) [-680.290] (-680.953) (-685.322) * (-681.719) (-679.930) [-681.570] (-681.042) -- 0:00:34
      423500 -- (-681.753) (-680.188) [-682.273] (-683.324) * (-680.720) [-681.658] (-686.163) (-681.723) -- 0:00:34
      424000 -- (-681.535) (-683.019) (-682.532) [-681.875] * (-681.905) [-681.132] (-685.368) (-687.616) -- 0:00:33
      424500 -- (-681.604) [-680.004] (-683.690) (-681.040) * (-682.829) [-684.734] (-685.431) (-682.143) -- 0:00:33
      425000 -- [-683.968] (-681.355) (-681.273) (-683.319) * (-683.161) (-681.377) [-683.447] (-680.605) -- 0:00:35

      Average standard deviation of split frequencies: 0.012246

      425500 -- (-685.234) (-680.010) [-680.271] (-684.205) * (-681.267) (-681.755) [-681.505] (-680.471) -- 0:00:35
      426000 -- (-683.010) (-681.069) [-679.967] (-683.777) * (-686.127) [-679.713] (-680.299) (-682.363) -- 0:00:35
      426500 -- [-682.403] (-682.096) (-679.950) (-683.032) * (-683.160) (-680.625) [-686.356] (-682.417) -- 0:00:34
      427000 -- [-680.914] (-679.916) (-682.051) (-681.959) * [-680.893] (-683.606) (-683.582) (-681.835) -- 0:00:34
      427500 -- (-681.541) [-679.632] (-681.503) (-684.787) * [-683.414] (-680.371) (-683.310) (-680.572) -- 0:00:34
      428000 -- (-682.357) [-679.738] (-682.929) (-681.405) * (-686.771) (-679.531) (-681.732) [-682.514] -- 0:00:34
      428500 -- (-680.750) (-679.673) (-681.436) [-681.913] * (-683.358) (-681.758) [-680.908] (-688.036) -- 0:00:34
      429000 -- (-681.846) [-683.608] (-683.096) (-687.071) * (-683.550) (-681.335) (-683.231) [-684.380] -- 0:00:34
      429500 -- (-680.101) (-680.771) [-681.901] (-689.369) * (-683.052) (-680.586) (-680.885) [-683.580] -- 0:00:34
      430000 -- (-681.377) (-680.199) (-681.088) [-680.809] * (-680.850) (-681.312) [-681.604] (-680.966) -- 0:00:34

      Average standard deviation of split frequencies: 0.011311

      430500 -- [-681.569] (-682.094) (-684.922) (-681.598) * [-684.438] (-681.466) (-682.951) (-682.451) -- 0:00:34
      431000 -- (-681.649) (-683.594) [-682.794] (-684.575) * [-687.098] (-681.408) (-680.492) (-682.055) -- 0:00:34
      431500 -- (-686.529) (-684.523) (-682.976) [-681.623] * (-688.621) (-681.670) (-680.787) [-681.743] -- 0:00:34
      432000 -- (-685.907) (-683.642) (-683.123) [-681.957] * (-685.325) [-682.074] (-680.810) (-688.114) -- 0:00:34
      432500 -- (-682.981) [-686.724] (-682.849) (-684.654) * (-683.779) [-683.692] (-680.836) (-685.451) -- 0:00:34
      433000 -- (-680.642) (-683.355) (-683.261) [-681.124] * (-684.026) [-681.659] (-682.359) (-687.441) -- 0:00:34
      433500 -- (-680.798) (-684.445) (-680.065) [-680.844] * [-683.354] (-679.591) (-683.189) (-685.445) -- 0:00:33
      434000 -- (-686.579) [-682.723] (-683.223) (-680.561) * (-680.792) (-680.771) (-687.389) [-683.814] -- 0:00:33
      434500 -- (-680.925) (-680.793) (-682.340) [-683.917] * (-682.463) (-681.715) (-682.508) [-680.329] -- 0:00:33
      435000 -- (-681.148) (-679.792) (-681.611) [-682.041] * (-682.266) [-680.301] (-680.996) (-682.486) -- 0:00:33

      Average standard deviation of split frequencies: 0.011555

      435500 -- (-680.549) (-682.781) [-683.885] (-680.559) * (-681.819) (-679.997) (-681.456) [-682.931] -- 0:00:33
      436000 -- [-679.949] (-681.149) (-682.041) (-685.724) * (-681.305) (-679.842) [-683.638] (-681.878) -- 0:00:33
      436500 -- (-681.017) (-681.869) (-681.438) [-681.120] * (-682.388) [-680.601] (-684.017) (-683.981) -- 0:00:33
      437000 -- (-680.406) (-680.176) [-683.304] (-681.298) * [-681.720] (-682.408) (-682.499) (-679.798) -- 0:00:33
      437500 -- [-680.685] (-680.158) (-681.908) (-684.913) * (-681.784) [-680.457] (-681.077) (-680.026) -- 0:00:33
      438000 -- [-681.468] (-680.771) (-681.199) (-680.875) * (-680.719) (-680.266) (-682.468) [-681.330] -- 0:00:33
      438500 -- [-681.596] (-681.998) (-683.036) (-681.642) * (-681.189) (-682.017) (-680.293) [-681.972] -- 0:00:33
      439000 -- (-682.494) (-682.136) [-679.977] (-680.893) * [-683.591] (-680.215) (-683.958) (-680.419) -- 0:00:33
      439500 -- (-680.769) [-679.810] (-682.562) (-684.733) * (-682.479) (-680.009) [-683.400] (-680.454) -- 0:00:33
      440000 -- [-680.221] (-683.044) (-680.647) (-684.515) * (-683.391) [-679.540] (-681.250) (-682.446) -- 0:00:33

      Average standard deviation of split frequencies: 0.012235

      440500 -- (-681.670) [-681.774] (-683.328) (-680.313) * (-679.902) [-679.528] (-680.272) (-683.326) -- 0:00:33
      441000 -- (-690.685) [-682.487] (-680.304) (-682.480) * (-682.198) (-680.451) (-680.807) [-681.122] -- 0:00:32
      441500 -- (-682.775) (-688.734) [-682.191] (-682.428) * [-683.655] (-683.935) (-682.425) (-681.024) -- 0:00:34
      442000 -- (-681.111) (-686.509) [-681.691] (-685.641) * [-682.123] (-681.096) (-684.334) (-681.343) -- 0:00:34
      442500 -- (-682.476) (-680.531) (-682.128) [-681.528] * [-680.050] (-684.127) (-683.114) (-683.078) -- 0:00:34
      443000 -- (-683.980) (-683.348) [-683.911] (-681.225) * [-679.824] (-682.442) (-683.438) (-680.867) -- 0:00:33
      443500 -- [-683.718] (-680.457) (-682.675) (-680.481) * (-683.323) (-686.421) (-682.879) [-683.932] -- 0:00:33
      444000 -- (-681.713) (-684.940) [-681.118] (-679.787) * [-680.357] (-681.300) (-681.733) (-681.200) -- 0:00:33
      444500 -- (-685.720) (-682.986) (-681.962) [-680.366] * (-684.352) (-679.915) [-681.690] (-682.904) -- 0:00:33
      445000 -- (-685.750) (-681.521) (-681.430) [-682.361] * [-682.796] (-679.863) (-686.505) (-682.563) -- 0:00:33

      Average standard deviation of split frequencies: 0.012062

      445500 -- (-685.348) (-680.752) [-681.255] (-681.567) * (-682.744) [-680.320] (-686.653) (-680.673) -- 0:00:33
      446000 -- (-685.494) [-681.080] (-681.614) (-682.677) * [-681.805] (-681.446) (-684.777) (-680.254) -- 0:00:33
      446500 -- (-681.834) (-683.342) [-685.153] (-680.422) * (-684.938) [-680.957] (-682.514) (-679.777) -- 0:00:33
      447000 -- (-682.900) (-681.158) [-682.232] (-680.004) * [-683.389] (-682.579) (-679.896) (-680.752) -- 0:00:33
      447500 -- (-685.534) (-682.692) (-681.427) [-680.997] * (-682.541) [-681.585] (-681.306) (-687.945) -- 0:00:33
      448000 -- (-686.175) (-682.148) [-680.650] (-681.164) * (-683.013) (-680.606) [-680.059] (-680.950) -- 0:00:33
      448500 -- (-680.758) [-684.359] (-680.387) (-681.205) * (-688.584) [-679.670] (-680.261) (-680.536) -- 0:00:33
      449000 -- (-681.823) [-683.135] (-683.738) (-681.327) * (-681.900) (-682.790) [-682.754] (-682.516) -- 0:00:33
      449500 -- [-680.935] (-685.877) (-682.352) (-684.461) * (-689.454) (-681.035) (-682.303) [-681.823] -- 0:00:33
      450000 -- [-680.837] (-682.325) (-682.101) (-681.544) * (-682.622) [-684.969] (-679.624) (-685.920) -- 0:00:33

      Average standard deviation of split frequencies: 0.011998

      450500 -- (-680.050) (-681.234) (-680.644) [-683.549] * (-682.337) [-680.373] (-682.850) (-681.202) -- 0:00:32
      451000 -- (-682.255) (-683.356) [-680.172] (-683.183) * (-683.415) (-681.619) [-684.224] (-682.738) -- 0:00:32
      451500 -- (-680.622) [-681.697] (-680.259) (-682.774) * [-681.095] (-681.904) (-681.820) (-680.241) -- 0:00:32
      452000 -- (-681.243) (-682.388) [-681.258] (-684.032) * (-682.896) (-683.117) (-681.246) [-682.972] -- 0:00:32
      452500 -- (-682.015) [-684.755] (-679.560) (-691.857) * (-682.922) (-686.384) [-680.884] (-685.734) -- 0:00:32
      453000 -- (-683.495) (-685.582) [-684.066] (-680.396) * [-681.785] (-682.832) (-683.463) (-681.347) -- 0:00:32
      453500 -- [-681.434] (-681.034) (-685.423) (-682.283) * [-679.978] (-687.186) (-681.794) (-682.665) -- 0:00:32
      454000 -- (-684.572) (-680.399) [-688.977] (-682.645) * (-684.395) (-680.003) (-682.532) [-680.553] -- 0:00:32
      454500 -- (-683.659) (-681.258) [-681.792] (-681.674) * (-685.160) [-682.200] (-682.990) (-680.734) -- 0:00:32
      455000 -- [-679.883] (-682.573) (-683.847) (-681.166) * (-687.640) (-682.456) (-683.467) [-680.855] -- 0:00:32

      Average standard deviation of split frequencies: 0.011919

      455500 -- (-682.335) (-686.496) (-684.826) [-680.412] * (-680.989) [-680.326] (-686.282) (-686.598) -- 0:00:32
      456000 -- (-680.777) [-682.047] (-681.854) (-680.269) * [-681.782] (-683.065) (-681.454) (-681.008) -- 0:00:32
      456500 -- (-683.109) (-686.813) (-680.496) [-681.052] * [-679.584] (-686.501) (-683.747) (-682.101) -- 0:00:32
      457000 -- (-680.210) (-686.095) (-683.841) [-682.567] * [-680.494] (-682.538) (-681.582) (-682.184) -- 0:00:32
      457500 -- (-681.158) [-682.102] (-680.343) (-680.322) * (-679.675) (-683.242) (-681.401) [-680.838] -- 0:00:32
      458000 -- [-683.021] (-680.430) (-687.118) (-681.186) * [-681.050] (-680.702) (-680.291) (-683.210) -- 0:00:31
      458500 -- (-685.492) (-681.238) [-684.180] (-682.256) * (-683.545) (-682.219) [-682.970] (-685.292) -- 0:00:33
      459000 -- (-687.694) [-679.965] (-682.414) (-683.579) * (-683.946) (-684.687) (-681.649) [-682.998] -- 0:00:33
      459500 -- (-682.384) (-681.170) [-681.719] (-680.054) * (-681.485) (-683.313) [-683.483] (-682.525) -- 0:00:32
      460000 -- (-680.022) (-680.359) (-683.304) [-683.032] * (-682.130) (-681.077) (-681.343) [-682.100] -- 0:00:32

      Average standard deviation of split frequencies: 0.010895

      460500 -- (-680.820) (-681.875) (-680.459) [-682.174] * (-686.455) [-683.540] (-681.066) (-681.742) -- 0:00:32
      461000 -- (-680.395) (-681.656) [-691.742] (-682.146) * (-681.292) (-684.677) [-680.929] (-682.934) -- 0:00:32
      461500 -- [-681.945] (-682.272) (-683.875) (-685.980) * (-685.072) (-684.222) (-680.871) [-682.667] -- 0:00:32
      462000 -- (-680.483) (-680.755) [-681.294] (-681.664) * (-680.856) [-680.229] (-680.047) (-683.569) -- 0:00:32
      462500 -- (-681.392) (-679.635) [-682.049] (-681.833) * (-681.394) (-683.323) (-680.163) [-682.343] -- 0:00:32
      463000 -- (-679.964) (-679.707) [-680.566] (-682.211) * (-679.860) (-681.682) [-684.392] (-681.928) -- 0:00:32
      463500 -- (-680.840) (-680.719) [-681.298] (-685.256) * (-683.676) [-682.947] (-682.997) (-681.085) -- 0:00:32
      464000 -- (-681.382) (-681.486) (-681.538) [-683.877] * (-682.893) (-683.016) (-683.384) [-682.702] -- 0:00:32
      464500 -- (-679.963) [-679.917] (-680.685) (-684.966) * (-682.378) (-683.955) [-681.547] (-680.571) -- 0:00:32
      465000 -- (-685.295) (-684.932) [-680.758] (-686.374) * [-681.583] (-684.247) (-681.004) (-681.788) -- 0:00:32

      Average standard deviation of split frequencies: 0.010592

      465500 -- (-681.618) (-688.564) [-680.863] (-682.560) * (-682.870) (-680.195) (-682.124) [-680.351] -- 0:00:32
      466000 -- (-682.106) [-684.192] (-681.474) (-680.074) * (-680.433) (-685.353) [-681.830] (-684.124) -- 0:00:32
      466500 -- [-682.601] (-680.437) (-682.242) (-679.959) * (-681.145) [-681.992] (-680.368) (-684.531) -- 0:00:32
      467000 -- (-684.911) (-679.639) (-683.346) [-680.716] * [-681.172] (-682.104) (-680.709) (-684.290) -- 0:00:31
      467500 -- (-682.904) [-679.893] (-683.516) (-680.166) * [-681.284] (-683.920) (-681.396) (-681.161) -- 0:00:31
      468000 -- (-686.224) [-681.524] (-682.106) (-682.507) * (-683.513) (-686.026) [-681.894] (-681.430) -- 0:00:31
      468500 -- [-679.970] (-684.146) (-682.710) (-681.817) * (-683.307) (-682.627) (-679.659) [-679.866] -- 0:00:31
      469000 -- (-683.069) [-682.600] (-682.253) (-682.328) * [-680.782] (-683.504) (-681.101) (-679.794) -- 0:00:31
      469500 -- (-681.185) [-681.780] (-688.461) (-682.029) * (-682.939) [-682.412] (-679.883) (-680.746) -- 0:00:31
      470000 -- (-685.034) (-682.324) [-683.607] (-683.539) * [-681.737] (-681.521) (-683.433) (-682.085) -- 0:00:31

      Average standard deviation of split frequencies: 0.010428

      470500 -- (-682.162) (-680.990) (-681.979) [-683.625] * [-686.308] (-679.827) (-681.665) (-682.653) -- 0:00:31
      471000 -- (-684.547) (-680.995) [-680.763] (-679.845) * [-683.764] (-680.732) (-682.030) (-681.345) -- 0:00:31
      471500 -- (-680.041) (-682.645) [-681.029] (-683.090) * [-682.174] (-681.870) (-681.826) (-680.275) -- 0:00:31
      472000 -- (-682.268) (-681.647) [-680.279] (-681.796) * (-681.210) (-681.169) (-682.330) [-683.045] -- 0:00:31
      472500 -- (-681.260) [-682.730] (-681.029) (-686.735) * (-680.018) (-683.743) [-681.569] (-685.263) -- 0:00:31
      473000 -- (-681.341) [-679.442] (-680.285) (-679.730) * [-680.788] (-684.256) (-683.132) (-688.566) -- 0:00:31
      473500 -- [-680.961] (-686.948) (-681.573) (-681.028) * (-681.889) (-681.632) (-681.492) [-681.863] -- 0:00:31
      474000 -- [-682.168] (-681.415) (-681.053) (-680.847) * (-683.033) (-681.173) (-690.508) [-682.454] -- 0:00:31
      474500 -- [-684.913] (-683.509) (-682.007) (-681.669) * (-680.592) [-683.305] (-684.395) (-681.490) -- 0:00:31
      475000 -- (-681.970) (-683.579) (-683.386) [-682.793] * (-683.586) (-681.937) (-684.212) [-685.481] -- 0:00:30

      Average standard deviation of split frequencies: 0.010777

      475500 -- (-680.349) (-680.920) [-682.639] (-681.324) * (-681.843) (-683.982) [-682.205] (-681.346) -- 0:00:31
      476000 -- (-682.696) (-681.754) [-681.241] (-680.300) * (-681.343) (-684.703) [-683.466] (-680.867) -- 0:00:31
      476500 -- (-683.104) [-683.823] (-680.727) (-680.422) * (-683.385) [-682.368] (-680.027) (-680.769) -- 0:00:31
      477000 -- (-682.673) (-681.864) (-681.429) [-680.210] * (-681.263) (-680.966) (-687.235) [-680.239] -- 0:00:31
      477500 -- [-681.827] (-680.001) (-681.031) (-682.308) * (-681.047) [-683.402] (-682.487) (-685.191) -- 0:00:31
      478000 -- (-680.030) (-687.319) (-681.832) [-683.750] * (-679.951) (-682.239) (-685.648) [-681.641] -- 0:00:31
      478500 -- (-680.420) [-679.968] (-687.143) (-685.437) * (-682.156) (-681.346) [-682.015] (-681.273) -- 0:00:31
      479000 -- (-680.984) [-680.773] (-683.831) (-681.150) * (-683.199) (-681.794) (-685.362) [-684.578] -- 0:00:31
      479500 -- (-682.239) (-682.010) (-681.778) [-682.850] * (-682.286) (-680.609) (-687.433) [-680.788] -- 0:00:31
      480000 -- (-684.200) (-686.233) (-683.654) [-680.946] * (-682.428) [-680.880] (-683.342) (-679.663) -- 0:00:31

      Average standard deviation of split frequencies: 0.010384

      480500 -- (-681.996) [-682.468] (-685.911) (-679.564) * [-683.045] (-682.419) (-685.973) (-680.521) -- 0:00:31
      481000 -- (-684.155) (-682.270) [-680.993] (-681.256) * [-680.882] (-682.745) (-680.726) (-682.669) -- 0:00:31
      481500 -- (-682.655) (-685.841) (-681.377) [-679.714] * (-682.997) (-682.652) [-680.483] (-682.847) -- 0:00:31
      482000 -- (-680.186) (-684.277) [-680.793] (-682.678) * (-684.123) [-680.912] (-681.004) (-683.823) -- 0:00:31
      482500 -- (-682.153) (-682.624) [-681.588] (-681.569) * (-680.751) (-681.334) (-681.770) [-681.215] -- 0:00:31
      483000 -- (-683.309) (-684.866) [-681.568] (-681.665) * [-681.447] (-684.989) (-684.013) (-685.189) -- 0:00:31
      483500 -- (-681.266) (-681.452) (-684.034) [-683.792] * [-680.447] (-685.763) (-683.116) (-684.338) -- 0:00:30
      484000 -- [-682.454] (-681.186) (-682.759) (-684.202) * (-680.879) (-680.318) (-681.764) [-683.183] -- 0:00:30
      484500 -- (-680.959) [-680.207] (-682.363) (-683.438) * (-682.577) (-682.393) [-681.250] (-684.712) -- 0:00:30
      485000 -- (-682.071) [-680.929] (-681.676) (-681.738) * [-681.082] (-682.994) (-682.010) (-683.611) -- 0:00:30

      Average standard deviation of split frequencies: 0.011069

      485500 -- (-683.116) [-680.178] (-682.830) (-680.739) * [-683.819] (-683.487) (-680.730) (-681.661) -- 0:00:30
      486000 -- (-687.826) (-680.342) [-682.570] (-679.628) * (-680.961) [-686.586] (-681.622) (-684.099) -- 0:00:30
      486500 -- (-682.914) (-680.213) (-685.269) [-680.513] * (-681.133) (-684.549) [-680.442] (-681.453) -- 0:00:30
      487000 -- [-680.790] (-680.955) (-682.787) (-679.645) * (-683.940) [-684.165] (-680.512) (-681.650) -- 0:00:30
      487500 -- (-681.186) (-682.760) (-685.219) [-682.274] * [-681.019] (-682.616) (-681.467) (-682.296) -- 0:00:30
      488000 -- (-680.922) [-681.408] (-681.391) (-683.391) * (-682.192) [-685.354] (-683.090) (-684.128) -- 0:00:30
      488500 -- (-681.013) [-681.458] (-680.113) (-680.243) * (-682.863) (-684.330) [-680.962] (-680.852) -- 0:00:30
      489000 -- [-681.693] (-681.099) (-682.272) (-680.729) * (-687.353) (-681.164) [-683.914] (-681.801) -- 0:00:30
      489500 -- [-681.832] (-681.269) (-682.647) (-680.856) * (-682.002) (-680.390) [-680.884] (-684.403) -- 0:00:30
      490000 -- (-683.385) (-680.574) (-679.926) [-680.438] * (-680.140) [-680.528] (-680.304) (-682.047) -- 0:00:30

      Average standard deviation of split frequencies: 0.010738

      490500 -- (-682.325) (-682.120) [-681.332] (-682.221) * [-680.337] (-680.121) (-681.372) (-680.605) -- 0:00:30
      491000 -- (-680.374) (-684.596) [-681.595] (-680.132) * (-688.611) [-680.891] (-680.911) (-681.055) -- 0:00:30
      491500 -- [-680.280] (-682.179) (-681.852) (-680.156) * [-683.813] (-680.145) (-680.127) (-681.908) -- 0:00:30
      492000 -- (-684.835) [-681.257] (-680.943) (-683.063) * (-682.704) (-682.298) [-681.422] (-680.341) -- 0:00:29
      492500 -- (-685.041) [-683.406] (-680.958) (-682.897) * (-686.151) (-682.327) [-685.978] (-680.260) -- 0:00:30
      493000 -- (-683.430) (-680.611) (-680.862) [-681.031] * [-683.468] (-683.457) (-680.795) (-682.920) -- 0:00:30
      493500 -- [-684.036] (-680.139) (-685.850) (-680.471) * (-687.454) [-682.738] (-685.752) (-682.945) -- 0:00:30
      494000 -- (-685.462) (-680.581) [-679.746] (-684.550) * (-684.375) (-680.202) [-681.029] (-682.126) -- 0:00:30
      494500 -- (-682.915) [-682.548] (-681.572) (-682.836) * (-683.229) (-681.652) (-681.745) [-680.992] -- 0:00:30
      495000 -- (-681.702) (-682.790) (-683.223) [-680.420] * (-685.956) (-685.570) (-679.757) [-681.636] -- 0:00:30

      Average standard deviation of split frequencies: 0.010455

      495500 -- [-680.749] (-683.250) (-679.926) (-680.721) * (-683.960) [-683.488] (-684.062) (-681.141) -- 0:00:30
      496000 -- (-685.014) (-685.304) [-679.764] (-679.705) * (-683.080) [-681.562] (-683.445) (-680.385) -- 0:00:30
      496500 -- (-685.656) (-686.518) (-684.375) [-679.824] * (-681.227) [-681.601] (-681.307) (-682.435) -- 0:00:30
      497000 -- (-682.675) (-682.099) [-681.763] (-680.404) * [-681.373] (-682.251) (-680.311) (-681.745) -- 0:00:30
      497500 -- (-683.048) (-683.283) (-680.651) [-681.521] * (-683.510) [-680.602] (-682.300) (-682.118) -- 0:00:30
      498000 -- [-681.369] (-683.394) (-681.166) (-681.813) * (-682.691) (-680.460) [-680.036] (-681.966) -- 0:00:30
      498500 -- (-682.932) (-682.575) [-682.244] (-683.499) * [-680.322] (-682.684) (-680.940) (-682.427) -- 0:00:30
      499000 -- (-684.553) (-680.312) [-687.290] (-681.523) * (-679.817) (-682.328) [-682.389] (-683.274) -- 0:00:30
      499500 -- (-681.771) (-681.736) [-681.501] (-681.076) * [-680.298] (-682.243) (-680.848) (-681.392) -- 0:00:30
      500000 -- [-682.358] (-682.769) (-685.027) (-680.184) * [-680.024] (-683.573) (-680.199) (-679.733) -- 0:00:30

      Average standard deviation of split frequencies: 0.010191

      500500 -- (-682.957) (-679.794) (-683.470) [-680.312] * [-680.486] (-683.868) (-681.424) (-686.433) -- 0:00:29
      501000 -- (-680.983) (-679.606) (-683.308) [-679.840] * (-681.338) (-681.401) [-683.061] (-687.876) -- 0:00:29
      501500 -- [-680.336] (-680.939) (-686.778) (-680.765) * [-681.871] (-681.143) (-684.823) (-687.752) -- 0:00:29
      502000 -- [-681.382] (-685.798) (-681.668) (-680.933) * (-682.563) (-680.124) (-684.608) [-682.795] -- 0:00:29
      502500 -- (-684.117) (-680.084) (-681.220) [-680.133] * (-681.007) (-682.063) (-680.848) [-684.193] -- 0:00:29
      503000 -- (-683.918) [-683.471] (-687.368) (-682.384) * [-681.317] (-682.737) (-680.028) (-680.710) -- 0:00:29
      503500 -- [-679.688] (-687.932) (-682.603) (-682.009) * (-682.758) (-683.807) (-682.654) [-681.223] -- 0:00:29
      504000 -- (-681.404) (-684.136) [-680.247] (-680.430) * (-682.118) (-687.684) [-683.065] (-682.018) -- 0:00:29
      504500 -- (-681.652) (-684.330) (-680.700) [-680.285] * (-682.553) (-682.626) [-679.575] (-684.753) -- 0:00:29
      505000 -- (-680.550) (-684.053) [-681.406] (-680.103) * (-684.749) (-682.650) [-681.470] (-681.376) -- 0:00:29

      Average standard deviation of split frequencies: 0.010084

      505500 -- (-683.440) [-680.778] (-684.363) (-681.692) * (-682.033) (-684.466) [-682.269] (-681.738) -- 0:00:29
      506000 -- (-682.672) (-685.263) [-682.892] (-681.015) * (-682.895) [-685.641] (-680.991) (-682.774) -- 0:00:29
      506500 -- [-681.756] (-681.591) (-680.942) (-681.998) * (-684.507) [-681.372] (-684.313) (-684.259) -- 0:00:29
      507000 -- (-681.248) (-682.577) [-682.336] (-683.769) * (-686.250) [-682.076] (-680.849) (-686.928) -- 0:00:29
      507500 -- (-681.426) (-681.038) (-681.708) [-682.491] * (-680.813) [-682.401] (-680.768) (-682.844) -- 0:00:29
      508000 -- (-680.339) [-682.212] (-680.876) (-684.235) * (-682.511) (-680.905) [-681.303] (-682.006) -- 0:00:29
      508500 -- (-680.123) (-683.421) [-680.226] (-680.851) * (-684.416) (-680.133) (-681.420) [-680.789] -- 0:00:28
      509000 -- [-680.011] (-684.526) (-682.371) (-681.075) * (-681.151) (-682.009) (-688.207) [-680.730] -- 0:00:28
      509500 -- [-684.509] (-681.796) (-682.559) (-682.831) * [-683.292] (-682.296) (-682.601) (-680.680) -- 0:00:29
      510000 -- (-682.137) (-682.833) (-681.597) [-681.500] * (-681.416) (-682.027) [-680.160] (-681.363) -- 0:00:29

      Average standard deviation of split frequencies: 0.010643

      510500 -- [-681.278] (-681.520) (-686.211) (-683.685) * (-682.482) [-680.730] (-679.852) (-681.116) -- 0:00:29
      511000 -- (-685.591) [-679.814] (-684.651) (-683.481) * (-682.056) (-684.158) [-680.071] (-682.057) -- 0:00:29
      511500 -- (-686.245) (-679.855) (-688.123) [-685.048] * (-683.832) (-683.480) [-684.406] (-682.603) -- 0:00:29
      512000 -- [-682.364] (-680.895) (-681.580) (-680.320) * [-683.992] (-684.593) (-685.299) (-684.860) -- 0:00:29
      512500 -- [-682.314] (-681.844) (-682.587) (-682.602) * [-683.571] (-679.671) (-682.422) (-681.966) -- 0:00:29
      513000 -- [-681.638] (-684.850) (-680.567) (-682.963) * (-683.289) (-684.788) (-681.141) [-682.107] -- 0:00:29
      513500 -- (-683.202) (-682.770) [-684.069] (-682.703) * (-683.125) (-680.882) (-684.773) [-682.564] -- 0:00:29
      514000 -- [-682.054] (-683.908) (-679.837) (-679.439) * (-682.832) (-681.134) (-681.451) [-682.646] -- 0:00:29
      514500 -- (-682.814) (-682.745) [-680.085] (-680.591) * (-682.480) (-683.558) [-681.661] (-682.037) -- 0:00:29
      515000 -- [-681.813] (-682.489) (-681.736) (-680.202) * (-680.914) (-684.905) (-683.654) [-681.517] -- 0:00:29

      Average standard deviation of split frequencies: 0.010278

      515500 -- (-686.205) [-682.211] (-680.618) (-684.773) * [-680.486] (-681.578) (-683.732) (-687.998) -- 0:00:29
      516000 -- (-682.631) [-680.834] (-682.630) (-682.709) * (-680.486) (-682.704) (-681.769) [-680.989] -- 0:00:29
      516500 -- (-680.283) (-680.433) [-682.645] (-683.038) * (-683.213) (-681.128) [-682.540] (-681.889) -- 0:00:29
      517000 -- (-682.272) (-680.364) (-685.021) [-681.387] * (-682.763) (-685.611) (-683.473) [-680.238] -- 0:00:28
      517500 -- (-681.508) (-679.840) (-681.571) [-681.228] * (-681.144) (-681.039) [-682.530] (-680.255) -- 0:00:28
      518000 -- (-689.886) (-683.062) [-683.829] (-682.631) * (-687.947) (-680.102) [-681.169] (-680.417) -- 0:00:28
      518500 -- (-685.900) (-681.855) (-682.851) [-680.862] * (-681.931) [-681.288] (-681.190) (-681.010) -- 0:00:28
      519000 -- (-682.602) (-681.533) (-683.702) [-683.123] * (-682.240) (-682.390) (-682.050) [-682.628] -- 0:00:28
      519500 -- [-680.703] (-681.887) (-683.265) (-682.123) * (-681.872) (-684.173) [-680.795] (-685.339) -- 0:00:28
      520000 -- [-679.791] (-681.911) (-680.570) (-682.854) * [-686.040] (-684.254) (-682.495) (-685.434) -- 0:00:28

      Average standard deviation of split frequencies: 0.010758

      520500 -- (-679.571) (-682.556) [-682.865] (-684.161) * (-682.469) (-685.217) (-684.791) [-682.580] -- 0:00:28
      521000 -- (-688.435) [-680.677] (-680.914) (-680.573) * (-681.273) (-681.310) (-681.848) [-680.754] -- 0:00:28
      521500 -- [-685.617] (-681.768) (-681.652) (-684.232) * (-681.839) [-683.740] (-684.632) (-684.850) -- 0:00:28
      522000 -- (-682.146) (-681.682) (-684.623) [-685.631] * [-683.115] (-685.452) (-680.395) (-682.527) -- 0:00:28
      522500 -- (-685.511) [-684.966] (-683.104) (-682.540) * (-679.769) (-685.248) (-680.395) [-680.827] -- 0:00:28
      523000 -- [-679.917] (-684.291) (-684.102) (-686.321) * (-681.382) (-682.768) (-681.486) [-680.920] -- 0:00:28
      523500 -- (-681.498) [-680.833] (-683.572) (-681.038) * (-682.394) (-681.445) (-681.134) [-681.751] -- 0:00:28
      524000 -- (-680.938) (-683.380) [-682.321] (-681.090) * (-681.139) (-681.889) [-680.882] (-680.105) -- 0:00:28
      524500 -- (-681.300) (-685.146) [-683.742] (-681.388) * (-680.088) [-683.338] (-681.617) (-681.763) -- 0:00:28
      525000 -- (-680.196) (-684.021) [-685.151] (-680.220) * (-682.436) (-680.698) [-680.441] (-681.964) -- 0:00:28

      Average standard deviation of split frequencies: 0.010544

      525500 -- (-680.657) (-685.632) (-681.742) [-681.559] * (-682.361) (-680.668) [-679.388] (-681.088) -- 0:00:27
      526000 -- (-680.987) (-681.743) [-681.858] (-680.282) * (-682.343) (-680.306) [-681.232] (-681.552) -- 0:00:28
      526500 -- (-682.109) (-681.210) [-683.395] (-680.619) * (-683.424) (-685.807) (-681.291) [-682.141] -- 0:00:28
      527000 -- (-682.320) (-680.724) (-682.890) [-683.309] * (-680.376) [-682.265] (-683.444) (-680.811) -- 0:00:28
      527500 -- (-681.667) [-680.744] (-683.439) (-680.597) * [-679.782] (-682.517) (-682.916) (-682.254) -- 0:00:28
      528000 -- [-681.869] (-683.195) (-683.625) (-680.980) * (-679.961) (-683.388) (-680.662) [-684.846] -- 0:00:28
      528500 -- [-683.501] (-681.874) (-687.535) (-682.888) * (-679.819) (-680.889) (-680.911) [-682.859] -- 0:00:28
      529000 -- (-681.787) [-679.922] (-682.851) (-680.059) * [-680.182] (-680.364) (-681.684) (-682.566) -- 0:00:28
      529500 -- [-683.485] (-682.100) (-685.265) (-680.069) * [-685.608] (-683.021) (-683.388) (-681.479) -- 0:00:28
      530000 -- [-681.553] (-681.041) (-682.072) (-680.181) * (-684.043) [-680.993] (-683.935) (-682.834) -- 0:00:28

      Average standard deviation of split frequencies: 0.009883

      530500 -- (-683.203) (-680.892) (-682.518) [-680.626] * (-680.747) (-681.435) (-683.017) [-680.084] -- 0:00:28
      531000 -- (-682.175) [-681.144] (-681.223) (-681.442) * [-680.650] (-680.577) (-682.754) (-680.030) -- 0:00:28
      531500 -- [-680.789] (-682.925) (-683.830) (-681.723) * (-681.628) (-682.162) (-679.837) [-679.878] -- 0:00:28
      532000 -- (-683.929) (-680.947) [-680.968] (-680.405) * (-680.391) [-679.947] (-680.433) (-682.640) -- 0:00:28
      532500 -- [-681.912] (-679.609) (-683.510) (-693.796) * (-682.503) [-680.734] (-680.243) (-682.189) -- 0:00:28
      533000 -- [-680.717] (-679.920) (-684.513) (-682.890) * (-681.777) [-680.361] (-680.859) (-682.310) -- 0:00:28
      533500 -- (-680.339) [-680.294] (-684.072) (-682.206) * (-682.171) (-679.883) [-682.795] (-680.090) -- 0:00:27
      534000 -- (-681.150) (-681.046) (-685.506) [-680.891] * (-684.412) (-680.737) [-680.694] (-681.307) -- 0:00:27
      534500 -- (-686.901) [-680.779] (-685.506) (-680.220) * [-681.627] (-681.458) (-681.074) (-682.500) -- 0:00:27
      535000 -- [-679.862] (-680.330) (-681.376) (-683.985) * (-681.551) [-679.852] (-681.853) (-681.173) -- 0:00:27

      Average standard deviation of split frequencies: 0.009345

      535500 -- (-679.928) (-682.913) [-681.349] (-682.183) * (-683.843) (-684.036) [-680.463] (-682.969) -- 0:00:27
      536000 -- (-682.213) (-681.136) (-681.991) [-680.721] * (-681.402) (-683.661) (-679.884) [-680.854] -- 0:00:27
      536500 -- (-680.902) (-680.515) [-681.005] (-680.358) * (-683.670) (-680.019) (-684.829) [-683.428] -- 0:00:27
      537000 -- (-683.045) (-682.728) (-680.802) [-680.571] * (-681.281) (-681.249) [-680.394] (-681.922) -- 0:00:27
      537500 -- (-682.488) (-681.593) [-682.978] (-680.596) * (-680.999) (-683.059) [-681.113] (-682.932) -- 0:00:27
      538000 -- [-681.981] (-682.837) (-683.347) (-681.994) * (-682.522) (-688.672) [-685.657] (-683.889) -- 0:00:27
      538500 -- [-680.431] (-683.541) (-681.461) (-684.308) * [-681.774] (-685.401) (-684.550) (-683.421) -- 0:00:27
      539000 -- (-680.580) (-681.222) [-684.440] (-683.620) * (-683.690) (-687.250) (-685.225) [-683.137] -- 0:00:27
      539500 -- (-682.189) (-682.147) (-680.041) [-680.609] * [-684.044] (-686.184) (-682.657) (-681.137) -- 0:00:27
      540000 -- [-680.117] (-684.906) (-681.575) (-679.663) * (-686.979) (-680.770) [-682.442] (-681.887) -- 0:00:27

      Average standard deviation of split frequencies: 0.009536

      540500 -- [-682.974] (-682.973) (-682.851) (-681.453) * [-683.315] (-683.779) (-684.090) (-683.045) -- 0:00:27
      541000 -- (-682.230) (-685.829) [-680.725] (-679.920) * (-685.632) (-683.331) (-680.400) [-684.295] -- 0:00:27
      541500 -- (-681.753) (-682.328) (-681.807) [-680.165] * (-684.484) (-682.868) [-681.467] (-682.541) -- 0:00:27
      542000 -- (-683.398) (-680.595) (-682.983) [-680.315] * (-682.265) (-681.489) [-680.560] (-681.360) -- 0:00:27
      542500 -- (-683.466) [-680.991] (-684.877) (-684.695) * (-682.496) (-679.642) [-683.959] (-681.767) -- 0:00:26
      543000 -- [-687.506] (-682.523) (-685.105) (-681.515) * [-682.120] (-682.884) (-683.173) (-680.131) -- 0:00:27
      543500 -- [-681.006] (-683.309) (-680.615) (-685.105) * (-681.914) [-683.295] (-682.611) (-679.543) -- 0:00:27
      544000 -- (-681.117) [-680.913] (-681.581) (-680.916) * [-680.504] (-682.556) (-681.948) (-682.513) -- 0:00:27
      544500 -- (-683.225) [-687.013] (-679.844) (-683.167) * (-680.354) [-682.530] (-680.589) (-681.601) -- 0:00:27
      545000 -- [-681.991] (-682.302) (-683.616) (-680.402) * (-680.442) (-680.058) [-681.904] (-684.802) -- 0:00:27

      Average standard deviation of split frequencies: 0.009443

      545500 -- [-684.075] (-681.891) (-683.269) (-680.404) * [-680.072] (-681.407) (-682.007) (-682.101) -- 0:00:27
      546000 -- (-683.245) (-682.749) (-682.250) [-681.401] * (-682.292) (-681.360) (-680.359) [-684.440] -- 0:00:27
      546500 -- [-680.696] (-679.508) (-680.695) (-681.955) * [-681.206] (-681.791) (-681.135) (-684.078) -- 0:00:27
      547000 -- (-680.633) (-682.216) (-681.002) [-681.559] * (-680.659) [-680.464] (-680.795) (-681.546) -- 0:00:27
      547500 -- (-680.046) (-680.279) (-680.682) [-680.180] * (-684.362) (-682.434) (-682.860) [-683.422] -- 0:00:27
      548000 -- (-681.612) [-680.664] (-680.860) (-679.994) * (-682.784) (-684.208) [-680.611] (-680.872) -- 0:00:27
      548500 -- (-684.379) [-682.949] (-680.374) (-682.885) * (-679.843) (-682.017) (-682.879) [-681.516] -- 0:00:27
      549000 -- (-681.701) (-682.758) (-679.585) [-682.512] * [-681.463] (-684.304) (-681.416) (-681.885) -- 0:00:27
      549500 -- (-680.821) [-681.937] (-679.830) (-680.546) * [-680.801] (-683.081) (-682.419) (-680.304) -- 0:00:27
      550000 -- [-681.249] (-679.984) (-681.618) (-682.181) * (-680.773) (-680.037) [-681.179] (-681.040) -- 0:00:27

      Average standard deviation of split frequencies: 0.009096

      550500 -- [-684.075] (-679.884) (-686.496) (-682.960) * (-683.623) [-680.358] (-682.185) (-680.810) -- 0:00:26
      551000 -- (-685.908) (-680.712) (-681.544) [-683.132] * [-680.813] (-681.406) (-683.981) (-681.158) -- 0:00:26
      551500 -- [-682.504] (-682.055) (-681.569) (-680.483) * [-680.472] (-681.875) (-679.758) (-681.094) -- 0:00:26
      552000 -- [-683.212] (-681.928) (-683.378) (-683.499) * (-679.970) (-685.720) (-680.570) [-680.606] -- 0:00:26
      552500 -- (-681.470) [-682.255] (-681.542) (-682.440) * (-681.495) (-682.471) (-681.387) [-681.956] -- 0:00:26
      553000 -- (-682.396) (-680.846) (-680.126) [-683.352] * (-683.537) (-683.339) [-682.154] (-681.789) -- 0:00:26
      553500 -- (-681.297) (-683.670) (-680.100) [-683.877] * [-680.888] (-687.465) (-681.080) (-683.451) -- 0:00:26
      554000 -- (-680.281) (-685.966) (-683.942) [-680.204] * (-681.172) (-681.322) [-680.399] (-684.597) -- 0:00:26
      554500 -- (-680.684) (-685.120) [-680.832] (-685.921) * (-681.178) [-680.914] (-679.704) (-682.690) -- 0:00:26
      555000 -- (-680.456) (-683.184) (-682.874) [-683.888] * (-680.712) (-685.236) [-682.317] (-679.898) -- 0:00:26

      Average standard deviation of split frequencies: 0.009825

      555500 -- [-680.456] (-681.160) (-682.575) (-681.458) * (-683.795) [-681.504] (-680.510) (-681.433) -- 0:00:26
      556000 -- (-680.468) (-681.701) [-681.366] (-681.643) * [-680.946] (-681.024) (-682.660) (-682.594) -- 0:00:26
      556500 -- [-683.446] (-682.228) (-681.723) (-682.212) * (-684.794) [-679.844] (-681.562) (-682.148) -- 0:00:26
      557000 -- (-681.181) (-682.115) (-680.611) [-681.277] * [-680.960] (-681.470) (-682.072) (-682.161) -- 0:00:26
      557500 -- (-681.382) (-681.916) [-681.047] (-681.079) * (-680.948) (-680.966) (-680.549) [-682.924] -- 0:00:26
      558000 -- (-681.374) (-683.698) [-680.136] (-683.897) * (-685.325) (-679.542) [-681.754] (-681.562) -- 0:00:26
      558500 -- (-679.908) [-686.666] (-680.252) (-682.861) * (-683.290) (-682.398) (-680.738) [-680.056] -- 0:00:26
      559000 -- (-680.936) [-681.141] (-680.829) (-683.718) * [-681.176] (-681.661) (-682.211) (-681.432) -- 0:00:26
      559500 -- [-680.768] (-681.586) (-681.347) (-682.096) * [-681.178] (-680.345) (-680.504) (-681.265) -- 0:00:25
      560000 -- (-679.686) [-681.196] (-680.892) (-685.375) * (-682.332) (-681.317) [-680.248] (-681.804) -- 0:00:26

      Average standard deviation of split frequencies: 0.009196

      560500 -- (-682.108) (-685.640) (-680.755) [-683.261] * [-687.675] (-682.471) (-679.699) (-683.626) -- 0:00:26
      561000 -- [-684.755] (-682.979) (-687.557) (-687.590) * (-682.955) [-680.403] (-682.332) (-685.962) -- 0:00:26
      561500 -- [-682.246] (-684.024) (-682.726) (-686.573) * (-682.425) [-679.914] (-680.177) (-683.916) -- 0:00:26
      562000 -- [-681.249] (-683.896) (-681.323) (-683.679) * (-681.600) [-680.055] (-681.829) (-683.949) -- 0:00:26
      562500 -- (-682.862) (-688.792) [-680.528] (-679.970) * [-682.421] (-684.698) (-682.109) (-683.122) -- 0:00:26
      563000 -- [-680.236] (-689.669) (-681.938) (-680.523) * (-681.103) (-685.073) (-680.349) [-681.761] -- 0:00:26
      563500 -- [-680.012] (-683.643) (-681.663) (-680.654) * (-681.442) (-684.934) (-682.070) [-679.923] -- 0:00:26
      564000 -- [-681.202] (-680.190) (-680.862) (-681.848) * (-681.129) (-684.548) (-687.129) [-680.467] -- 0:00:26
      564500 -- (-682.169) (-685.183) (-684.842) [-686.246] * (-682.651) (-685.089) [-683.391] (-681.879) -- 0:00:26
      565000 -- [-681.459] (-681.790) (-682.441) (-681.228) * (-681.745) [-680.368] (-681.184) (-683.420) -- 0:00:26

      Average standard deviation of split frequencies: 0.009266

      565500 -- [-680.964] (-681.846) (-681.238) (-682.396) * (-681.644) [-679.658] (-685.879) (-686.730) -- 0:00:26
      566000 -- (-681.400) [-684.064] (-681.237) (-680.794) * [-679.597] (-681.162) (-681.152) (-681.256) -- 0:00:26
      566500 -- [-680.428] (-683.115) (-681.079) (-681.029) * (-679.508) (-683.202) (-683.107) [-682.550] -- 0:00:26
      567000 -- (-679.711) [-680.857] (-682.654) (-684.560) * [-680.531] (-686.735) (-681.677) (-682.042) -- 0:00:25
      567500 -- (-680.573) (-680.995) [-681.914] (-685.602) * [-681.845] (-684.162) (-679.977) (-681.302) -- 0:00:25
      568000 -- (-682.947) (-681.493) (-685.042) [-682.247] * (-682.949) (-680.069) (-680.794) [-682.983] -- 0:00:25
      568500 -- (-681.856) (-680.243) (-682.339) [-683.497] * [-679.754] (-680.410) (-682.912) (-681.586) -- 0:00:25
      569000 -- (-682.402) (-681.840) (-680.796) [-682.021] * (-681.468) (-680.639) [-680.259] (-682.721) -- 0:00:25
      569500 -- (-680.908) (-683.953) [-681.464] (-681.337) * (-681.635) [-683.848] (-681.801) (-683.507) -- 0:00:25
      570000 -- (-685.574) [-682.117] (-681.455) (-681.686) * (-680.988) (-680.536) [-682.095] (-685.338) -- 0:00:25

      Average standard deviation of split frequencies: 0.009551

      570500 -- (-681.434) (-681.719) [-680.864] (-682.296) * (-681.036) (-680.653) (-682.210) [-680.936] -- 0:00:25
      571000 -- (-684.262) [-679.667] (-679.502) (-681.493) * [-682.458] (-680.895) (-680.456) (-680.584) -- 0:00:25
      571500 -- (-682.266) (-683.363) [-681.117] (-680.458) * (-680.580) (-683.037) [-683.282] (-683.181) -- 0:00:25
      572000 -- [-679.977] (-681.065) (-682.154) (-679.693) * [-679.999] (-682.558) (-682.007) (-679.475) -- 0:00:25
      572500 -- (-681.166) (-683.869) [-680.721] (-680.790) * [-683.805] (-681.114) (-683.384) (-682.479) -- 0:00:25
      573000 -- (-679.913) (-680.610) (-687.654) [-680.514] * (-679.978) [-680.911] (-682.215) (-684.813) -- 0:00:25
      573500 -- [-681.958] (-681.937) (-682.186) (-680.547) * [-680.219] (-680.828) (-681.925) (-692.362) -- 0:00:25
      574000 -- [-681.046] (-679.789) (-683.427) (-680.706) * [-680.227] (-684.730) (-681.954) (-693.940) -- 0:00:25
      574500 -- [-682.460] (-680.258) (-680.288) (-684.481) * (-684.939) (-687.765) [-680.555] (-681.585) -- 0:00:25
      575000 -- (-682.314) [-679.658] (-680.691) (-680.967) * (-688.726) (-687.629) (-683.880) [-681.816] -- 0:00:25

      Average standard deviation of split frequencies: 0.009821

      575500 -- (-683.464) (-680.594) (-684.160) [-680.806] * [-684.498] (-689.458) (-686.286) (-682.164) -- 0:00:25
      576000 -- (-680.642) (-681.507) (-683.738) [-682.765] * (-682.005) (-681.148) (-681.601) [-685.587] -- 0:00:25
      576500 -- [-681.037] (-679.979) (-683.443) (-689.245) * (-680.282) (-682.841) [-681.736] (-682.830) -- 0:00:24
      577000 -- (-680.365) (-679.675) (-682.111) [-681.624] * (-679.421) (-683.967) [-679.579] (-683.919) -- 0:00:25
      577500 -- [-679.992] (-682.100) (-684.347) (-682.309) * (-683.353) (-684.806) (-682.813) [-683.548] -- 0:00:25
      578000 -- (-685.657) (-683.122) [-680.776] (-681.909) * (-682.702) [-681.294] (-682.627) (-682.233) -- 0:00:25
      578500 -- [-680.574] (-681.393) (-681.732) (-682.666) * [-680.068] (-682.289) (-682.734) (-681.274) -- 0:00:25
      579000 -- (-680.299) (-680.900) [-680.204] (-681.989) * (-682.591) [-683.037] (-688.980) (-680.905) -- 0:00:25
      579500 -- (-680.825) (-679.674) (-680.349) [-685.473] * [-681.883] (-684.084) (-682.310) (-681.237) -- 0:00:25
      580000 -- (-682.176) [-680.052] (-682.685) (-682.116) * (-681.220) (-683.457) [-683.246] (-681.370) -- 0:00:25

      Average standard deviation of split frequencies: 0.009945

      580500 -- (-683.388) [-682.718] (-681.837) (-681.560) * (-682.175) [-680.595] (-684.062) (-682.903) -- 0:00:25
      581000 -- (-681.308) [-682.606] (-681.909) (-682.029) * (-681.172) [-683.153] (-684.542) (-686.352) -- 0:00:25
      581500 -- [-679.894] (-679.577) (-680.782) (-688.337) * [-682.819] (-682.914) (-684.321) (-680.558) -- 0:00:25
      582000 -- (-683.543) (-683.891) (-682.339) [-683.301] * [-681.045] (-681.028) (-688.060) (-682.858) -- 0:00:25
      582500 -- (-682.055) [-681.574] (-680.434) (-681.125) * [-681.761] (-682.756) (-679.608) (-679.785) -- 0:00:25
      583000 -- (-683.122) (-681.075) (-680.408) [-682.869] * [-683.444] (-681.511) (-680.513) (-680.503) -- 0:00:25
      583500 -- [-682.496] (-682.748) (-681.667) (-681.339) * (-680.990) (-679.756) [-679.846] (-681.635) -- 0:00:24
      584000 -- [-681.846] (-681.478) (-681.895) (-681.281) * (-681.338) (-682.529) (-679.934) [-682.870] -- 0:00:24
      584500 -- (-687.695) (-681.324) [-681.306] (-680.610) * [-679.841] (-681.536) (-681.458) (-681.224) -- 0:00:24
      585000 -- (-681.001) [-682.825] (-681.123) (-680.896) * (-684.573) [-681.579] (-686.028) (-681.816) -- 0:00:24

      Average standard deviation of split frequencies: 0.009843

      585500 -- (-681.806) [-686.414] (-681.141) (-682.658) * [-680.525] (-680.043) (-682.458) (-679.820) -- 0:00:24
      586000 -- (-687.042) [-680.618] (-682.984) (-686.449) * (-686.183) (-680.285) (-681.174) [-682.224] -- 0:00:24
      586500 -- (-683.900) [-682.619] (-685.064) (-681.995) * (-685.596) [-681.265] (-682.670) (-681.700) -- 0:00:24
      587000 -- (-684.146) (-681.906) (-679.943) [-682.116] * (-687.841) (-680.973) (-679.839) [-681.725] -- 0:00:24
      587500 -- (-684.476) (-679.989) [-681.435] (-682.190) * [-681.906] (-680.995) (-679.813) (-681.747) -- 0:00:24
      588000 -- (-680.461) [-682.601] (-680.370) (-681.780) * (-681.309) [-681.695] (-684.674) (-680.571) -- 0:00:24
      588500 -- (-681.442) [-681.110] (-681.427) (-681.218) * (-682.709) [-681.569] (-683.573) (-680.142) -- 0:00:24
      589000 -- [-684.540] (-681.885) (-684.406) (-681.427) * (-682.290) (-685.569) (-683.045) [-683.430] -- 0:00:24
      589500 -- (-683.711) (-680.570) [-681.778] (-683.406) * (-682.630) (-683.047) [-681.326] (-683.755) -- 0:00:24
      590000 -- [-684.141] (-680.158) (-682.177) (-683.280) * (-683.130) (-682.484) [-680.440] (-684.029) -- 0:00:24

      Average standard deviation of split frequencies: 0.009976

      590500 -- (-684.142) (-682.282) [-681.335] (-682.697) * (-682.504) (-684.013) [-682.657] (-681.528) -- 0:00:24
      591000 -- [-682.213] (-683.532) (-685.302) (-681.002) * (-681.858) (-683.169) [-683.245] (-682.990) -- 0:00:24
      591500 -- [-681.305] (-681.933) (-685.417) (-680.921) * (-681.428) (-683.875) [-680.549] (-681.943) -- 0:00:24
      592000 -- [-682.233] (-681.996) (-684.781) (-680.378) * (-680.124) (-683.215) [-681.889] (-683.782) -- 0:00:24
      592500 -- (-680.830) (-680.772) (-686.608) [-680.531] * (-681.360) (-680.957) [-681.989] (-681.431) -- 0:00:24
      593000 -- [-682.825] (-681.799) (-681.701) (-684.261) * [-683.016] (-680.877) (-680.615) (-680.855) -- 0:00:24
      593500 -- (-681.758) (-683.479) [-682.400] (-684.842) * (-680.718) [-680.131] (-680.192) (-680.559) -- 0:00:23
      594000 -- (-680.995) (-680.205) (-682.004) [-685.174] * (-683.742) (-682.681) [-682.982] (-682.030) -- 0:00:24
      594500 -- (-681.247) (-680.202) (-684.990) [-683.563] * (-683.433) (-681.680) (-682.887) [-680.746] -- 0:00:24
      595000 -- (-684.219) (-680.938) (-681.958) [-680.485] * [-684.410] (-684.916) (-680.933) (-680.844) -- 0:00:24

      Average standard deviation of split frequencies: 0.009837

      595500 -- (-688.327) [-679.964] (-683.417) (-682.424) * (-683.387) (-685.251) (-681.782) [-680.026] -- 0:00:24
      596000 -- (-681.653) (-683.010) (-681.095) [-681.314] * (-682.268) (-685.960) [-683.783] (-681.149) -- 0:00:24
      596500 -- (-682.459) [-680.795] (-681.877) (-681.270) * (-679.835) (-681.501) (-682.170) [-681.251] -- 0:00:24
      597000 -- [-681.357] (-679.417) (-682.064) (-680.592) * (-681.787) (-679.949) [-682.989] (-681.814) -- 0:00:24
      597500 -- (-680.741) (-684.002) (-683.117) [-681.538] * (-682.760) (-680.379) [-683.242] (-683.424) -- 0:00:24
      598000 -- (-681.459) (-684.168) (-682.441) [-681.614] * (-682.793) (-685.979) (-685.357) [-680.707] -- 0:00:24
      598500 -- (-680.549) (-680.317) [-681.995] (-680.197) * (-681.733) (-681.947) (-682.235) [-679.712] -- 0:00:24
      599000 -- (-684.166) [-680.336] (-681.091) (-681.409) * (-684.068) (-681.651) [-681.510] (-679.943) -- 0:00:24
      599500 -- (-681.139) [-681.436] (-684.485) (-680.139) * (-683.474) (-680.608) (-680.982) [-680.967] -- 0:00:24
      600000 -- (-680.759) [-682.732] (-681.394) (-680.216) * (-680.386) (-681.741) (-683.096) [-682.958] -- 0:00:24

      Average standard deviation of split frequencies: 0.009320

      600500 -- (-680.760) (-683.042) [-682.846] (-680.718) * (-686.286) [-679.772] (-680.270) (-686.426) -- 0:00:23
      601000 -- (-681.339) (-682.322) (-680.207) [-681.137] * [-681.291] (-680.554) (-681.384) (-682.609) -- 0:00:23
      601500 -- (-680.216) (-682.308) [-681.695] (-691.743) * [-685.325] (-683.536) (-680.038) (-681.522) -- 0:00:23
      602000 -- (-684.586) (-683.037) [-683.552] (-692.710) * [-686.920] (-681.566) (-681.813) (-681.854) -- 0:00:23
      602500 -- [-681.185] (-682.972) (-682.060) (-688.256) * (-680.526) [-680.940] (-681.287) (-683.131) -- 0:00:23
      603000 -- (-684.629) (-681.747) [-680.977] (-683.549) * [-681.816] (-685.513) (-682.169) (-682.336) -- 0:00:23
      603500 -- (-681.209) (-681.290) (-685.694) [-681.735] * [-682.458] (-681.570) (-682.736) (-683.657) -- 0:00:23
      604000 -- (-687.435) (-686.698) [-680.230] (-681.132) * (-683.852) (-680.934) (-683.447) [-684.872] -- 0:00:23
      604500 -- (-682.870) (-680.725) [-680.059] (-681.418) * (-680.763) [-684.563] (-682.901) (-683.525) -- 0:00:23
      605000 -- [-681.393] (-683.232) (-681.488) (-680.211) * [-682.495] (-680.763) (-682.963) (-682.350) -- 0:00:23

      Average standard deviation of split frequencies: 0.009092

      605500 -- (-684.912) (-686.983) (-680.458) [-680.696] * [-680.957] (-683.252) (-681.438) (-685.414) -- 0:00:23
      606000 -- (-683.447) (-685.384) (-680.929) [-683.258] * (-681.385) [-681.658] (-682.714) (-682.945) -- 0:00:23
      606500 -- (-682.138) [-679.677] (-681.346) (-682.788) * (-679.816) (-687.098) [-681.887] (-681.039) -- 0:00:23
      607000 -- [-680.564] (-684.683) (-685.479) (-684.942) * (-680.675) (-681.285) [-680.416] (-681.298) -- 0:00:23
      607500 -- (-685.679) (-681.113) [-680.682] (-681.619) * (-679.996) (-680.720) [-680.150] (-684.472) -- 0:00:23
      608000 -- (-682.584) (-680.840) [-680.276] (-680.168) * [-680.004] (-680.672) (-681.138) (-683.345) -- 0:00:23
      608500 -- (-681.805) (-680.401) [-682.845] (-684.371) * (-682.622) (-683.189) [-680.898] (-680.775) -- 0:00:23
      609000 -- (-685.518) (-683.784) (-685.343) [-686.529] * (-680.507) [-682.809] (-680.921) (-683.774) -- 0:00:23
      609500 -- (-682.406) (-680.389) (-683.355) [-684.427] * (-682.808) [-682.078] (-685.810) (-687.185) -- 0:00:23
      610000 -- [-681.819] (-681.472) (-682.247) (-681.954) * (-685.839) (-681.654) [-681.456] (-687.033) -- 0:00:23

      Average standard deviation of split frequencies: 0.009456

      610500 -- (-681.074) (-680.978) [-685.114] (-681.638) * (-681.114) [-681.350] (-681.553) (-680.670) -- 0:00:23
      611000 -- (-681.178) (-682.393) (-681.769) [-681.651] * (-680.756) (-682.722) (-685.498) [-680.689] -- 0:00:23
      611500 -- (-680.778) (-680.156) (-680.261) [-683.482] * (-680.265) [-680.724] (-681.277) (-680.592) -- 0:00:23
      612000 -- (-683.664) (-679.863) [-680.175] (-680.539) * (-684.860) (-682.242) [-682.598] (-680.074) -- 0:00:23
      612500 -- (-683.322) (-679.910) [-680.056] (-681.255) * (-688.319) (-684.282) (-682.866) [-680.344] -- 0:00:23
      613000 -- (-683.217) [-681.986] (-682.884) (-681.546) * (-689.174) (-682.021) [-680.269] (-681.082) -- 0:00:23
      613500 -- [-683.622] (-681.699) (-682.776) (-682.322) * (-683.590) (-680.878) (-680.333) [-680.244] -- 0:00:23
      614000 -- (-682.695) (-681.042) [-680.815] (-682.473) * [-680.259] (-681.043) (-685.701) (-685.488) -- 0:00:23
      614500 -- (-681.936) [-684.012] (-680.655) (-681.445) * [-685.178] (-683.171) (-682.465) (-685.996) -- 0:00:23
      615000 -- [-681.053] (-680.484) (-682.600) (-681.817) * (-683.141) [-680.700] (-682.983) (-681.927) -- 0:00:23

      Average standard deviation of split frequencies: 0.009470

      615500 -- (-682.882) (-681.139) [-685.291] (-682.456) * (-682.682) (-683.178) [-680.577] (-684.038) -- 0:00:23
      616000 -- (-682.075) (-682.933) [-685.567] (-680.537) * [-684.223] (-680.671) (-681.184) (-680.699) -- 0:00:23
      616500 -- (-684.042) (-680.465) [-680.473] (-682.134) * (-684.483) (-682.206) (-680.626) [-680.779] -- 0:00:23
      617000 -- [-684.303] (-681.005) (-681.710) (-681.587) * [-682.690] (-681.381) (-681.861) (-684.119) -- 0:00:22
      617500 -- (-680.739) (-683.044) [-683.447] (-680.614) * [-680.207] (-684.440) (-681.860) (-682.976) -- 0:00:22
      618000 -- (-680.409) [-683.024] (-682.095) (-680.684) * (-682.350) (-681.828) (-680.380) [-679.834] -- 0:00:22
      618500 -- (-682.289) (-685.495) (-681.641) [-680.486] * (-682.789) (-680.833) (-682.186) [-684.002] -- 0:00:22
      619000 -- (-683.377) (-680.645) [-679.552] (-681.766) * (-681.383) (-681.432) [-681.109] (-682.975) -- 0:00:22
      619500 -- (-684.692) [-683.076] (-682.123) (-682.636) * [-681.971] (-682.453) (-681.904) (-681.235) -- 0:00:22
      620000 -- (-680.834) (-681.378) (-680.935) [-683.959] * [-681.732] (-681.774) (-681.589) (-680.294) -- 0:00:22

      Average standard deviation of split frequencies: 0.008782

      620500 -- (-680.920) [-681.282] (-680.540) (-681.631) * (-680.496) [-680.898] (-681.844) (-680.280) -- 0:00:22
      621000 -- (-680.473) (-681.091) (-681.978) [-679.938] * (-681.253) (-680.073) (-680.698) [-683.170] -- 0:00:22
      621500 -- [-681.863] (-680.314) (-681.185) (-683.327) * [-682.274] (-679.805) (-680.173) (-682.635) -- 0:00:22
      622000 -- [-680.915] (-681.953) (-681.942) (-687.535) * (-681.224) [-682.663] (-683.517) (-681.680) -- 0:00:22
      622500 -- (-680.743) (-681.245) [-681.266] (-685.323) * (-681.978) [-681.154] (-684.634) (-682.191) -- 0:00:22
      623000 -- [-680.078] (-682.026) (-681.931) (-687.470) * (-680.537) (-680.345) [-683.114] (-683.190) -- 0:00:22
      623500 -- (-682.158) [-682.273] (-681.280) (-686.312) * (-681.928) (-680.779) [-681.942] (-684.016) -- 0:00:22
      624000 -- (-681.641) [-681.164] (-681.191) (-681.978) * (-682.600) (-682.274) (-682.547) [-681.875] -- 0:00:22
      624500 -- (-680.725) (-680.737) [-680.628] (-685.400) * (-685.368) (-680.974) (-683.122) [-681.728] -- 0:00:22
      625000 -- (-680.127) (-679.791) (-680.515) [-686.346] * (-682.755) (-684.337) (-680.054) [-680.898] -- 0:00:22

      Average standard deviation of split frequencies: 0.008519

      625500 -- (-680.750) (-680.240) [-683.110] (-679.922) * (-680.498) [-681.562] (-681.501) (-681.544) -- 0:00:22
      626000 -- (-679.801) (-680.612) [-681.131] (-680.426) * [-681.645] (-683.890) (-680.797) (-683.699) -- 0:00:22
      626500 -- (-683.411) (-685.364) [-680.002] (-680.310) * (-681.447) (-682.083) [-682.165] (-681.099) -- 0:00:22
      627000 -- (-682.760) (-684.026) (-683.679) [-682.860] * (-680.956) [-680.730] (-681.675) (-681.632) -- 0:00:22
      627500 -- (-679.894) (-684.521) (-682.985) [-680.249] * (-682.294) (-686.197) (-682.305) [-684.933] -- 0:00:22
      628000 -- [-679.555] (-683.133) (-681.425) (-681.630) * (-680.514) [-679.506] (-689.561) (-683.390) -- 0:00:22
      628500 -- (-681.577) (-681.642) [-682.298] (-683.071) * (-680.821) (-680.281) (-684.067) [-681.337] -- 0:00:22
      629000 -- (-682.725) (-681.491) [-681.701] (-681.561) * (-682.473) [-685.514] (-680.747) (-683.987) -- 0:00:22
      629500 -- [-683.126] (-683.944) (-681.003) (-681.953) * (-682.754) (-681.611) [-680.829] (-685.303) -- 0:00:22
      630000 -- (-684.468) (-681.311) (-682.426) [-682.526] * (-685.048) [-680.578] (-685.952) (-684.227) -- 0:00:22

      Average standard deviation of split frequencies: 0.008829

      630500 -- (-682.194) [-680.625] (-681.805) (-681.994) * (-682.537) (-680.315) [-685.120] (-685.458) -- 0:00:22
      631000 -- (-683.229) (-683.523) [-682.344] (-682.613) * (-682.185) (-682.763) [-684.031] (-684.029) -- 0:00:22
      631500 -- (-682.558) (-679.729) [-680.163] (-684.479) * [-681.016] (-683.355) (-686.586) (-685.247) -- 0:00:22
      632000 -- (-681.662) (-680.035) [-683.578] (-681.833) * (-684.679) [-684.431] (-682.911) (-689.068) -- 0:00:22
      632500 -- (-685.071) (-682.378) [-680.665] (-681.044) * (-684.915) (-680.988) (-681.928) [-681.998] -- 0:00:22
      633000 -- (-683.168) [-680.606] (-681.551) (-682.635) * (-682.185) [-681.404] (-680.070) (-683.485) -- 0:00:22
      633500 -- (-684.500) (-680.338) (-682.904) [-680.522] * (-681.522) (-681.099) (-686.318) [-682.977] -- 0:00:21
      634000 -- (-680.104) (-681.671) [-681.287] (-682.470) * [-683.722] (-680.764) (-681.037) (-681.901) -- 0:00:21
      634500 -- [-681.026] (-683.068) (-683.737) (-681.884) * [-680.310] (-681.099) (-681.277) (-681.652) -- 0:00:21
      635000 -- (-685.536) (-682.939) (-683.230) [-681.675] * (-682.484) (-680.786) [-680.763] (-684.059) -- 0:00:21

      Average standard deviation of split frequencies: 0.009487

      635500 -- (-681.666) (-682.020) [-683.312] (-684.483) * [-680.687] (-684.512) (-680.492) (-686.201) -- 0:00:21
      636000 -- (-680.337) (-681.921) [-681.259] (-683.681) * [-681.583] (-684.545) (-680.804) (-684.250) -- 0:00:21
      636500 -- (-681.589) (-682.173) [-680.860] (-685.956) * (-682.061) [-680.059] (-681.725) (-688.163) -- 0:00:21
      637000 -- [-683.232] (-682.329) (-681.315) (-680.671) * (-680.520) [-680.497] (-684.676) (-685.189) -- 0:00:21
      637500 -- (-682.366) (-682.914) [-680.201] (-681.816) * (-680.724) [-680.972] (-680.578) (-681.053) -- 0:00:21
      638000 -- (-685.598) (-680.657) (-683.203) [-682.207] * (-682.109) (-682.350) [-680.579] (-684.547) -- 0:00:21
      638500 -- [-682.940] (-684.811) (-682.843) (-680.302) * (-684.769) (-680.628) [-682.220] (-682.807) -- 0:00:21
      639000 -- (-683.534) (-682.396) (-682.010) [-681.151] * (-682.260) (-683.319) [-682.087] (-680.166) -- 0:00:21
      639500 -- (-683.108) [-680.801] (-684.688) (-683.035) * (-681.531) (-680.745) (-682.306) [-681.459] -- 0:00:21
      640000 -- (-684.312) [-681.867] (-684.343) (-682.988) * (-681.269) (-683.505) [-681.037] (-680.951) -- 0:00:21

      Average standard deviation of split frequencies: 0.009198

      640500 -- (-681.946) (-684.932) [-685.868] (-681.410) * (-681.764) (-687.675) (-679.923) [-684.231] -- 0:00:21
      641000 -- (-684.374) (-681.971) (-682.421) [-679.806] * (-683.937) (-681.836) (-681.833) [-680.369] -- 0:00:21
      641500 -- (-681.342) (-681.827) [-681.985] (-684.674) * (-687.543) (-680.214) (-683.001) [-679.939] -- 0:00:21
      642000 -- (-681.511) (-682.367) [-680.737] (-679.863) * [-681.693] (-683.822) (-687.909) (-680.796) -- 0:00:21
      642500 -- [-680.309] (-681.214) (-680.874) (-680.935) * (-681.643) (-680.376) [-681.519] (-683.247) -- 0:00:21
      643000 -- [-680.318] (-680.769) (-683.738) (-684.548) * (-682.405) [-680.662] (-683.454) (-683.636) -- 0:00:21
      643500 -- (-680.289) (-680.123) [-680.006] (-681.632) * [-681.184] (-682.725) (-683.434) (-683.040) -- 0:00:21
      644000 -- (-683.079) (-680.987) [-680.702] (-684.909) * [-681.478] (-681.462) (-681.360) (-682.290) -- 0:00:21
      644500 -- (-681.799) [-683.201] (-681.052) (-683.611) * (-688.447) (-680.843) [-680.931] (-683.073) -- 0:00:21
      645000 -- [-684.148] (-683.158) (-682.225) (-683.478) * (-681.894) (-681.356) [-680.382] (-684.137) -- 0:00:21

      Average standard deviation of split frequencies: 0.009389

      645500 -- (-687.803) (-687.254) [-680.619] (-683.369) * [-683.984] (-681.668) (-680.803) (-680.921) -- 0:00:21
      646000 -- [-683.113] (-681.726) (-681.898) (-683.389) * (-683.254) (-681.579) (-681.152) [-682.677] -- 0:00:21
      646500 -- [-683.554] (-680.719) (-682.986) (-683.403) * (-683.255) (-684.030) [-681.152] (-680.347) -- 0:00:21
      647000 -- [-683.197] (-682.809) (-681.934) (-682.571) * (-679.944) [-683.896] (-682.393) (-680.131) -- 0:00:21
      647500 -- (-683.425) (-680.934) [-683.666] (-684.744) * (-683.073) (-680.717) (-680.260) [-682.836] -- 0:00:21
      648000 -- (-685.705) [-685.297] (-680.784) (-680.430) * (-683.724) (-681.875) [-681.401] (-682.690) -- 0:00:21
      648500 -- (-680.645) (-681.572) [-682.128] (-681.066) * (-681.637) (-685.831) [-681.552] (-685.013) -- 0:00:21
      649000 -- (-680.217) [-683.136] (-680.413) (-683.219) * (-679.853) [-682.141] (-680.100) (-683.718) -- 0:00:21
      649500 -- (-680.512) [-682.934] (-679.786) (-683.266) * [-681.611] (-683.147) (-681.314) (-682.810) -- 0:00:21
      650000 -- (-682.602) [-682.118] (-683.177) (-686.025) * (-680.949) (-681.386) (-680.875) [-681.640] -- 0:00:21

      Average standard deviation of split frequencies: 0.008501

      650500 -- (-681.106) (-681.501) [-680.754] (-683.023) * (-681.168) [-680.675] (-681.796) (-682.895) -- 0:00:20
      651000 -- (-683.092) [-681.281] (-681.268) (-683.228) * (-681.290) [-683.218] (-682.819) (-682.919) -- 0:00:20
      651500 -- (-682.649) [-680.488] (-679.581) (-685.652) * (-685.326) (-681.528) [-683.618] (-684.680) -- 0:00:20
      652000 -- (-683.829) (-681.421) [-679.894] (-682.374) * [-680.208] (-685.902) (-682.960) (-682.759) -- 0:00:20
      652500 -- (-683.486) [-681.890] (-680.960) (-680.234) * [-680.520] (-683.481) (-686.743) (-683.007) -- 0:00:20
      653000 -- [-681.933] (-686.047) (-682.417) (-679.929) * [-682.783] (-681.034) (-684.597) (-682.775) -- 0:00:20
      653500 -- (-680.476) (-683.645) (-682.181) [-682.491] * (-686.457) (-681.034) (-680.691) [-680.436] -- 0:00:20
      654000 -- [-681.676] (-682.200) (-680.272) (-680.406) * (-686.796) (-682.257) (-679.752) [-681.270] -- 0:00:20
      654500 -- (-684.634) (-680.556) (-682.524) [-681.957] * [-682.916] (-680.976) (-682.663) (-680.917) -- 0:00:20
      655000 -- [-683.490] (-681.545) (-682.254) (-682.593) * [-683.379] (-681.681) (-680.794) (-680.309) -- 0:00:20

      Average standard deviation of split frequencies: 0.009007

      655500 -- (-680.341) (-680.002) (-682.075) [-680.595] * (-681.748) [-680.483] (-682.402) (-682.756) -- 0:00:20
      656000 -- (-681.478) (-684.726) (-681.351) [-681.187] * [-682.240] (-681.656) (-685.674) (-680.805) -- 0:00:20
      656500 -- [-679.752] (-682.504) (-679.974) (-679.891) * (-685.092) (-680.161) [-681.542] (-680.829) -- 0:00:20
      657000 -- (-683.445) (-681.776) [-680.399] (-685.634) * (-683.232) (-683.474) (-683.124) [-681.681] -- 0:00:20
      657500 -- (-681.120) [-684.475] (-681.377) (-686.173) * [-683.941] (-686.683) (-680.819) (-679.689) -- 0:00:20
      658000 -- (-680.211) (-683.850) (-680.798) [-685.839] * (-683.198) (-684.082) [-681.388] (-684.023) -- 0:00:20
      658500 -- [-680.739] (-685.905) (-680.271) (-682.854) * (-681.774) (-681.525) (-684.247) [-684.220] -- 0:00:20
      659000 -- [-680.367] (-680.832) (-681.794) (-688.185) * [-681.392] (-682.072) (-680.836) (-684.371) -- 0:00:20
      659500 -- (-680.154) [-685.042] (-682.984) (-685.839) * (-681.102) [-680.356] (-681.182) (-689.650) -- 0:00:20
      660000 -- (-680.160) [-680.437] (-682.129) (-679.877) * (-680.319) (-683.829) [-680.859] (-683.747) -- 0:00:20

      Average standard deviation of split frequencies: 0.009609

      660500 -- (-679.617) (-682.737) (-681.180) [-681.038] * [-680.139] (-681.157) (-681.780) (-682.597) -- 0:00:20
      661000 -- (-682.247) (-688.477) [-680.486] (-680.793) * (-683.343) (-680.957) [-681.668] (-683.717) -- 0:00:20
      661500 -- [-680.476] (-685.589) (-685.359) (-680.815) * (-682.755) [-679.963] (-681.925) (-682.938) -- 0:00:20
      662000 -- (-684.163) (-680.758) (-681.126) [-681.897] * [-679.607] (-679.830) (-680.187) (-679.992) -- 0:00:20
      662500 -- (-682.739) (-681.545) [-681.763] (-682.653) * (-681.248) (-679.606) (-681.866) [-681.289] -- 0:00:20
      663000 -- (-682.648) (-680.667) [-682.583] (-679.645) * [-681.350] (-680.758) (-682.849) (-683.654) -- 0:00:20
      663500 -- (-685.279) [-681.713] (-684.535) (-681.812) * (-679.832) (-681.322) (-685.577) [-684.686] -- 0:00:20
      664000 -- (-682.340) (-681.985) (-682.778) [-680.279] * [-679.852] (-683.239) (-681.931) (-680.642) -- 0:00:20
      664500 -- (-681.096) [-681.921] (-680.938) (-682.747) * [-679.719] (-680.921) (-681.695) (-681.310) -- 0:00:20
      665000 -- (-681.050) (-680.385) [-681.366] (-679.782) * (-679.895) [-679.665] (-682.456) (-681.198) -- 0:00:20

      Average standard deviation of split frequencies: 0.009909

      665500 -- (-682.623) (-682.253) (-681.149) [-684.673] * [-679.925] (-681.058) (-682.664) (-683.205) -- 0:00:20
      666000 -- (-680.521) (-681.503) [-680.683] (-683.902) * (-681.318) (-687.883) (-682.078) [-683.200] -- 0:00:20
      666500 -- (-679.547) [-680.958] (-679.688) (-680.554) * (-685.543) [-682.111] (-681.524) (-682.307) -- 0:00:20
      667000 -- [-683.942] (-683.092) (-681.689) (-682.729) * [-682.670] (-681.789) (-681.721) (-682.949) -- 0:00:19
      667500 -- (-680.616) (-682.210) (-685.338) [-681.150] * (-683.699) [-681.371] (-683.715) (-681.478) -- 0:00:19
      668000 -- (-680.219) (-682.773) [-682.480] (-680.885) * [-682.794] (-687.794) (-681.013) (-680.014) -- 0:00:19
      668500 -- [-683.659] (-680.705) (-680.532) (-680.731) * (-685.728) (-686.096) (-681.822) [-680.721] -- 0:00:19
      669000 -- [-685.377] (-681.486) (-679.967) (-681.113) * (-684.176) (-683.845) (-685.832) [-684.879] -- 0:00:19
      669500 -- [-681.624] (-680.479) (-683.035) (-680.846) * (-687.231) (-685.282) (-684.230) [-681.426] -- 0:00:19
      670000 -- [-685.309] (-680.328) (-681.809) (-679.914) * (-684.187) (-683.498) (-688.909) [-681.420] -- 0:00:19

      Average standard deviation of split frequencies: 0.009887

      670500 -- (-683.305) [-680.003] (-680.393) (-680.080) * (-681.723) [-681.069] (-682.938) (-681.001) -- 0:00:19
      671000 -- [-681.864] (-682.135) (-682.889) (-681.157) * [-682.626] (-682.017) (-684.309) (-681.052) -- 0:00:19
      671500 -- (-685.166) (-681.733) [-682.537] (-681.818) * [-680.448] (-685.788) (-679.606) (-682.839) -- 0:00:19
      672000 -- (-684.425) (-686.617) [-681.398] (-681.648) * [-680.083] (-684.803) (-681.254) (-685.060) -- 0:00:19
      672500 -- (-682.975) (-691.098) [-681.695] (-684.082) * [-680.135] (-686.278) (-683.782) (-681.827) -- 0:00:19
      673000 -- (-681.290) [-684.005] (-682.248) (-682.090) * [-683.552] (-683.377) (-683.100) (-683.936) -- 0:00:19
      673500 -- (-682.795) (-685.473) [-680.952] (-683.024) * (-687.025) (-682.282) [-684.100] (-682.474) -- 0:00:19
      674000 -- [-681.230] (-683.315) (-680.914) (-682.213) * (-682.722) (-680.806) [-681.529] (-683.143) -- 0:00:19
      674500 -- [-682.634] (-680.111) (-681.748) (-684.970) * (-685.136) [-681.769] (-683.834) (-681.316) -- 0:00:19
      675000 -- (-681.831) [-681.562] (-681.130) (-679.543) * [-684.502] (-682.856) (-682.438) (-683.778) -- 0:00:19

      Average standard deviation of split frequencies: 0.009809

      675500 -- (-681.134) (-682.262) (-681.872) [-679.772] * (-682.551) (-681.178) (-679.962) [-682.952] -- 0:00:19
      676000 -- (-681.307) (-682.943) (-679.883) [-681.324] * (-681.723) (-681.358) (-680.102) [-681.931] -- 0:00:19
      676500 -- (-680.473) (-680.927) (-682.922) [-680.133] * [-682.041] (-680.443) (-680.271) (-681.413) -- 0:00:19
      677000 -- (-681.546) (-683.284) [-680.059] (-681.860) * (-686.827) (-684.147) (-680.280) [-681.069] -- 0:00:19
      677500 -- (-680.495) (-681.098) [-683.276] (-687.029) * [-681.408] (-679.492) (-681.620) (-683.419) -- 0:00:19
      678000 -- (-680.406) [-681.733] (-681.866) (-687.526) * (-682.337) (-680.176) [-681.257] (-684.373) -- 0:00:19
      678500 -- (-682.412) (-680.821) (-681.538) [-681.849] * (-688.763) [-682.681] (-681.873) (-682.238) -- 0:00:19
      679000 -- (-684.438) [-685.041] (-682.514) (-681.263) * (-681.180) (-681.831) (-680.853) [-681.730] -- 0:00:19
      679500 -- (-684.846) (-682.902) (-684.112) [-682.701] * (-682.320) [-683.843] (-683.460) (-681.360) -- 0:00:19
      680000 -- (-681.091) [-681.155] (-683.219) (-681.816) * [-681.200] (-682.715) (-680.832) (-681.948) -- 0:00:19

      Average standard deviation of split frequencies: 0.009834

      680500 -- [-679.589] (-680.612) (-683.527) (-680.538) * (-681.883) [-683.600] (-679.914) (-683.431) -- 0:00:19
      681000 -- [-680.034] (-684.321) (-684.145) (-680.577) * (-684.143) (-683.487) [-683.976] (-684.117) -- 0:00:19
      681500 -- (-682.121) (-682.919) [-682.181] (-684.204) * (-682.405) [-681.306] (-683.099) (-680.643) -- 0:00:19
      682000 -- (-682.484) (-681.164) (-683.609) [-681.264] * (-683.289) (-679.514) [-681.997] (-679.643) -- 0:00:19
      682500 -- (-681.957) (-680.956) (-682.835) [-683.387] * [-684.146] (-681.785) (-681.388) (-680.347) -- 0:00:19
      683000 -- (-679.810) (-686.097) (-680.777) [-683.440] * [-679.542] (-680.326) (-683.415) (-681.060) -- 0:00:19
      683500 -- (-680.395) (-679.930) (-684.447) [-688.364] * (-681.516) (-681.867) [-681.577] (-688.063) -- 0:00:18
      684000 -- (-680.407) [-680.516] (-683.683) (-686.020) * (-682.705) (-683.073) [-683.897] (-683.245) -- 0:00:18
      684500 -- (-686.216) (-680.395) (-682.806) [-682.807] * (-683.138) [-680.153] (-681.031) (-680.168) -- 0:00:18
      685000 -- (-681.616) (-681.303) [-681.753] (-680.749) * (-685.753) (-681.886) [-680.109] (-682.494) -- 0:00:18

      Average standard deviation of split frequencies: 0.009706

      685500 -- (-680.709) [-682.826] (-686.906) (-684.459) * (-683.609) [-683.382] (-683.820) (-685.173) -- 0:00:18
      686000 -- [-682.737] (-681.895) (-680.950) (-680.531) * [-680.365] (-686.577) (-680.576) (-681.920) -- 0:00:18
      686500 -- (-679.620) [-682.586] (-680.836) (-682.453) * (-682.334) [-685.876] (-680.852) (-681.821) -- 0:00:18
      687000 -- (-680.308) [-680.869] (-682.836) (-681.090) * (-682.699) (-684.599) [-680.754] (-681.749) -- 0:00:18
      687500 -- (-681.300) (-680.302) [-682.468] (-682.849) * (-683.057) (-682.175) (-680.922) [-681.183] -- 0:00:18
      688000 -- (-683.071) (-687.986) (-684.368) [-680.955] * (-682.971) (-682.986) (-681.589) [-679.932] -- 0:00:18
      688500 -- (-680.490) (-682.301) (-685.268) [-682.688] * (-683.429) (-680.376) (-681.403) [-681.837] -- 0:00:18
      689000 -- (-682.493) (-682.420) [-681.713] (-682.654) * (-684.084) (-680.747) [-680.509] (-684.263) -- 0:00:18
      689500 -- (-681.517) (-683.562) [-683.876] (-683.530) * (-682.664) (-681.016) (-680.603) [-681.436] -- 0:00:18
      690000 -- (-682.981) (-682.971) [-680.937] (-687.519) * (-682.154) (-681.084) (-680.239) [-680.118] -- 0:00:18

      Average standard deviation of split frequencies: 0.009555

      690500 -- (-682.968) (-683.145) [-681.063] (-680.771) * (-681.281) (-682.212) (-681.639) [-680.164] -- 0:00:18
      691000 -- (-680.555) (-680.855) [-684.008] (-680.573) * (-681.887) (-680.058) [-683.497] (-682.262) -- 0:00:18
      691500 -- (-680.556) (-679.592) (-680.740) [-682.019] * (-680.552) (-680.156) [-680.239] (-682.709) -- 0:00:18
      692000 -- (-684.963) (-680.398) [-680.794] (-683.711) * (-684.142) [-681.170] (-680.405) (-681.262) -- 0:00:18
      692500 -- [-681.673] (-681.926) (-682.555) (-681.599) * (-680.258) (-682.803) [-680.204] (-679.992) -- 0:00:18
      693000 -- (-680.654) [-680.846] (-681.379) (-680.025) * (-685.017) (-682.319) [-681.324] (-681.716) -- 0:00:18
      693500 -- (-681.928) (-680.819) (-682.560) [-681.178] * (-682.810) [-682.068] (-681.230) (-682.632) -- 0:00:18
      694000 -- (-681.726) [-681.863] (-683.065) (-679.995) * [-684.720] (-681.480) (-682.914) (-682.342) -- 0:00:18
      694500 -- (-682.262) [-684.126] (-683.990) (-680.617) * (-682.283) [-682.001] (-681.977) (-681.511) -- 0:00:18
      695000 -- (-683.967) [-681.071] (-683.942) (-683.860) * (-681.705) (-682.550) (-680.540) [-680.416] -- 0:00:18

      Average standard deviation of split frequencies: 0.009573

      695500 -- [-682.657] (-680.386) (-687.263) (-681.699) * [-682.724] (-683.451) (-680.686) (-679.639) -- 0:00:18
      696000 -- (-682.863) [-681.246] (-680.368) (-682.524) * (-680.051) [-683.056] (-684.265) (-680.229) -- 0:00:18
      696500 -- [-680.798] (-680.212) (-680.935) (-681.839) * (-679.752) (-688.578) [-680.678] (-681.463) -- 0:00:18
      697000 -- (-683.576) (-681.997) (-680.608) [-681.505] * (-679.859) [-682.034] (-682.573) (-681.678) -- 0:00:18
      697500 -- (-680.731) [-680.835] (-684.742) (-681.308) * (-681.011) [-685.970] (-682.985) (-679.915) -- 0:00:18
      698000 -- [-685.882] (-682.348) (-683.962) (-683.841) * (-681.372) [-683.203] (-682.836) (-680.564) -- 0:00:18
      698500 -- (-680.817) (-681.132) (-680.992) [-681.877] * (-680.171) (-684.902) [-682.373] (-679.693) -- 0:00:18
      699000 -- [-680.304] (-681.575) (-683.085) (-681.071) * (-680.219) (-683.195) (-686.386) [-682.066] -- 0:00:18
      699500 -- (-680.193) [-680.680] (-686.764) (-681.084) * (-680.681) (-680.918) [-684.412] (-681.871) -- 0:00:18
      700000 -- (-681.197) (-682.129) [-680.777] (-680.737) * (-681.727) (-680.338) (-684.403) [-681.183] -- 0:00:18

      Average standard deviation of split frequencies: 0.009554

      700500 -- (-681.760) (-681.181) (-683.921) [-681.867] * (-682.376) (-680.786) (-685.034) [-679.877] -- 0:00:17
      701000 -- (-680.302) (-682.279) [-679.972] (-681.814) * (-684.146) [-680.444] (-681.202) (-679.574) -- 0:00:17
      701500 -- (-683.536) (-683.532) (-685.014) [-683.164] * (-679.964) [-680.454] (-680.346) (-680.720) -- 0:00:17
      702000 -- (-681.218) (-680.864) (-680.501) [-680.682] * (-680.889) [-681.360] (-681.510) (-679.970) -- 0:00:17
      702500 -- (-680.125) (-680.463) (-684.058) [-684.729] * (-682.465) [-687.621] (-680.653) (-687.576) -- 0:00:17
      703000 -- (-681.195) (-682.649) [-684.851] (-681.448) * (-680.462) (-684.961) (-685.450) [-681.299] -- 0:00:17
      703500 -- (-681.065) [-681.578] (-679.904) (-682.032) * (-681.727) (-680.578) [-682.840] (-681.571) -- 0:00:17
      704000 -- (-682.913) (-682.005) [-680.587] (-681.183) * (-686.771) (-679.985) [-680.513] (-683.475) -- 0:00:17
      704500 -- (-681.305) (-681.790) [-679.814] (-684.629) * (-682.307) [-679.942] (-682.421) (-682.904) -- 0:00:17
      705000 -- (-681.589) (-680.844) [-684.310] (-681.627) * (-684.042) (-682.603) (-681.326) [-680.633] -- 0:00:17

      Average standard deviation of split frequencies: 0.009125

      705500 -- (-685.067) (-681.158) (-683.078) [-680.967] * (-679.788) [-682.461] (-684.474) (-688.362) -- 0:00:17
      706000 -- [-687.803] (-681.587) (-681.819) (-680.927) * (-680.689) (-681.568) (-683.528) [-683.392] -- 0:00:17
      706500 -- (-682.964) [-680.145] (-685.102) (-682.463) * [-680.441] (-684.249) (-680.535) (-686.804) -- 0:00:17
      707000 -- (-680.842) [-681.757] (-685.808) (-681.910) * [-681.065] (-681.450) (-680.780) (-685.999) -- 0:00:17
      707500 -- (-680.881) [-683.491] (-680.897) (-680.777) * (-681.143) (-679.728) (-682.503) [-680.981] -- 0:00:17
      708000 -- (-682.151) (-680.417) (-682.405) [-681.796] * [-680.286] (-681.629) (-682.307) (-681.537) -- 0:00:17
      708500 -- (-681.684) (-680.501) [-681.879] (-682.667) * (-681.580) [-680.057] (-680.948) (-683.936) -- 0:00:17
      709000 -- [-680.818] (-684.986) (-680.769) (-681.096) * (-684.285) (-681.318) [-681.332] (-684.078) -- 0:00:17
      709500 -- (-681.847) (-683.061) (-680.364) [-680.840] * (-684.567) (-684.577) (-685.335) [-679.686] -- 0:00:17
      710000 -- (-681.640) (-686.383) (-680.393) [-681.093] * (-683.545) (-684.027) (-683.088) [-679.735] -- 0:00:17

      Average standard deviation of split frequencies: 0.008457

      710500 -- (-681.113) (-684.356) [-684.794] (-680.910) * (-681.780) (-682.748) (-683.348) [-681.409] -- 0:00:17
      711000 -- (-681.630) (-683.124) (-681.595) [-680.243] * (-680.914) (-680.768) (-683.047) [-681.820] -- 0:00:17
      711500 -- (-681.167) [-680.644] (-682.617) (-680.936) * (-683.538) (-682.653) (-682.180) [-682.031] -- 0:00:17
      712000 -- (-680.674) [-680.891] (-681.907) (-679.556) * (-687.076) (-683.545) [-683.638] (-682.258) -- 0:00:17
      712500 -- (-681.874) (-680.511) (-680.479) [-681.549] * (-685.431) (-681.741) (-681.809) [-681.935] -- 0:00:17
      713000 -- (-683.436) (-682.730) [-683.333] (-681.985) * (-681.024) (-681.146) (-680.728) [-680.741] -- 0:00:17
      713500 -- (-683.004) (-680.612) [-680.180] (-683.540) * [-680.545] (-682.516) (-682.428) (-684.809) -- 0:00:17
      714000 -- [-681.319] (-681.287) (-681.623) (-683.324) * (-680.903) (-683.257) [-681.180] (-683.972) -- 0:00:17
      714500 -- [-681.774] (-681.193) (-680.389) (-683.104) * (-681.243) (-681.958) [-683.591] (-685.391) -- 0:00:17
      715000 -- (-680.214) [-682.834] (-681.166) (-683.185) * [-681.958] (-684.009) (-684.900) (-683.906) -- 0:00:17

      Average standard deviation of split frequencies: 0.008394

      715500 -- (-681.880) (-680.068) (-683.828) [-680.951] * [-680.380] (-680.489) (-685.546) (-682.015) -- 0:00:17
      716000 -- (-682.825) (-681.001) [-681.916] (-682.006) * (-681.339) [-679.755] (-683.327) (-682.842) -- 0:00:17
      716500 -- (-682.035) [-679.724] (-681.215) (-685.700) * (-680.039) [-682.244] (-681.777) (-685.562) -- 0:00:17
      717000 -- (-685.890) (-680.018) [-681.337] (-683.757) * (-681.005) (-681.169) (-680.492) [-680.465] -- 0:00:16
      717500 -- (-685.633) (-682.012) [-680.351] (-680.152) * [-682.157] (-680.640) (-680.471) (-682.812) -- 0:00:16
      718000 -- [-684.972] (-680.646) (-680.360) (-681.537) * (-683.936) (-680.929) (-682.156) [-683.705] -- 0:00:16
      718500 -- [-681.377] (-684.832) (-680.372) (-686.049) * (-680.565) (-681.735) (-681.017) [-681.302] -- 0:00:16
      719000 -- (-681.092) (-682.329) [-680.399] (-686.503) * (-680.725) (-683.470) (-681.839) [-685.044] -- 0:00:16
      719500 -- (-681.023) [-690.920] (-685.368) (-681.681) * (-684.545) (-680.429) (-687.611) [-680.100] -- 0:00:16
      720000 -- (-682.202) (-681.302) (-682.783) [-682.547] * (-682.118) (-680.694) [-681.014] (-680.538) -- 0:00:16

      Average standard deviation of split frequencies: 0.008463

      720500 -- [-682.127] (-681.311) (-681.933) (-679.849) * (-680.755) [-681.945] (-683.017) (-680.730) -- 0:00:16
      721000 -- [-681.385] (-681.822) (-679.505) (-684.671) * [-680.468] (-682.125) (-681.591) (-680.455) -- 0:00:16
      721500 -- (-680.357) (-680.693) [-683.775] (-682.877) * [-682.031] (-681.708) (-685.384) (-682.773) -- 0:00:16
      722000 -- (-682.784) (-682.575) [-681.565] (-680.583) * (-684.465) (-680.189) [-681.610] (-680.857) -- 0:00:16
      722500 -- (-681.509) [-683.415] (-682.570) (-680.414) * [-683.929] (-682.074) (-685.739) (-683.666) -- 0:00:16
      723000 -- (-685.252) [-680.374] (-684.057) (-681.141) * (-682.339) [-682.185] (-681.367) (-683.918) -- 0:00:16
      723500 -- (-680.447) [-682.533] (-680.618) (-680.618) * (-680.665) (-681.060) (-685.889) [-682.303] -- 0:00:16
      724000 -- (-681.930) [-681.239] (-681.816) (-682.128) * [-680.579] (-683.020) (-683.457) (-682.029) -- 0:00:16
      724500 -- [-683.290] (-683.097) (-680.861) (-680.935) * (-680.291) (-685.309) [-684.910] (-682.720) -- 0:00:16
      725000 -- (-683.348) [-681.591] (-682.803) (-683.038) * (-681.903) (-683.380) (-680.444) [-681.658] -- 0:00:16

      Average standard deviation of split frequencies: 0.008976

      725500 -- (-684.698) (-686.062) [-682.650] (-682.045) * (-681.163) [-681.594] (-680.612) (-686.142) -- 0:00:16
      726000 -- (-681.348) (-687.068) [-681.047] (-682.338) * [-679.997] (-682.967) (-681.366) (-683.715) -- 0:00:16
      726500 -- [-681.034] (-680.608) (-681.717) (-681.171) * (-680.649) [-681.439] (-683.733) (-683.656) -- 0:00:16
      727000 -- (-680.094) [-681.209] (-683.146) (-679.653) * (-682.768) (-681.560) (-683.339) [-680.325] -- 0:00:16
      727500 -- (-685.290) (-680.073) [-682.297] (-682.449) * (-681.579) (-681.182) [-680.244] (-679.778) -- 0:00:16
      728000 -- (-685.209) [-681.055] (-681.541) (-683.154) * (-682.906) [-681.123] (-682.181) (-680.429) -- 0:00:16
      728500 -- [-685.322] (-680.680) (-686.017) (-681.115) * (-682.133) (-681.239) (-681.816) [-680.184] -- 0:00:16
      729000 -- (-685.301) (-682.230) [-684.112] (-682.174) * (-683.486) (-681.885) [-681.487] (-682.030) -- 0:00:16
      729500 -- (-684.178) (-680.580) [-681.652] (-684.589) * (-680.188) [-680.192] (-681.628) (-681.594) -- 0:00:16
      730000 -- (-684.382) [-681.001] (-680.661) (-681.016) * (-685.659) (-680.769) (-683.532) [-682.797] -- 0:00:16

      Average standard deviation of split frequencies: 0.008952

      730500 -- (-681.929) (-682.068) (-681.154) [-681.213] * (-680.546) (-681.783) [-682.922] (-682.751) -- 0:00:16
      731000 -- (-686.712) (-682.789) [-680.482] (-681.964) * (-683.938) (-683.300) [-682.863] (-682.970) -- 0:00:16
      731500 -- [-682.600] (-680.356) (-680.863) (-684.830) * [-683.361] (-681.909) (-681.870) (-686.964) -- 0:00:16
      732000 -- (-682.722) (-680.969) (-681.625) [-680.657] * (-687.423) (-683.265) [-680.655] (-683.531) -- 0:00:16
      732500 -- (-680.538) (-679.913) (-681.436) [-682.893] * (-683.208) (-681.361) (-680.180) [-681.953] -- 0:00:16
      733000 -- (-680.258) [-679.740] (-682.724) (-684.172) * (-683.099) (-683.233) (-680.982) [-680.280] -- 0:00:16
      733500 -- (-680.793) (-682.279) (-680.882) [-679.696] * (-681.206) (-683.193) (-683.848) [-682.309] -- 0