--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:21:54 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/ssb/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -681.14 -685.33
2 -681.08 -683.63
--------------------------------------
TOTAL -681.11 -684.81
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895974 0.090815 0.371161 1.495268 0.863542 1501.00 1501.00 1.000
r(A<->C){all} 0.166926 0.020006 0.000184 0.452825 0.127294 253.06 353.95 1.000
r(A<->G){all} 0.171694 0.021797 0.000006 0.469840 0.129298 119.21 183.40 1.016
r(A<->T){all} 0.169631 0.020561 0.000018 0.468419 0.131642 162.75 283.84 1.006
r(C<->G){all} 0.165455 0.020089 0.000066 0.459756 0.126715 198.78 232.72 1.009
r(C<->T){all} 0.163064 0.019326 0.000097 0.443348 0.125228 188.71 367.19 1.000
r(G<->T){all} 0.163230 0.019396 0.000044 0.444896 0.127410 254.69 260.11 1.011
pi(A){all} 0.181300 0.000294 0.147552 0.214284 0.181481 1193.84 1255.57 1.000
pi(C){all} 0.281695 0.000405 0.243359 0.322064 0.281318 1161.15 1298.38 1.000
pi(G){all} 0.348193 0.000463 0.306981 0.390400 0.347879 1179.87 1227.40 1.000
pi(T){all} 0.188811 0.000300 0.156388 0.222130 0.188357 1299.30 1372.18 1.000
alpha{1,2} 0.429274 0.221235 0.000213 1.393921 0.272420 1063.30 1177.32 1.000
alpha{3} 0.434938 0.217809 0.000104 1.385263 0.283970 1144.62 1211.69 1.002
pinvar{all} 0.996910 0.000014 0.989744 0.999996 0.998164 1188.53 1206.15 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -658.410048
Model 2: PositiveSelection -658.410105
Model 0: one-ratio -658.410126
Model 7: beta -658.410085
Model 8: beta&w>1 -658.410005
Model 0 vs 1 1.560000000608852E-4
Model 2 vs 1 1.1400000016692502E-4
Model 8 vs 7 1.6000000005078618E-4
>C1
VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
GSAPTSGSFGVGDEEPPF
>C2
VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
GSAPTSGSFGVGDEEPPF
>C3
VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
GSAPTSGSFGVGDEEPPF
>C4
VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
GSAPTSGSFGVGDEEPPF
>C5
VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
GSAPTSGSFGVGDEEPPF
>C6
VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
GSAPTSGSFGVGDEEPPF
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=168
C1 VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
C2 VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
C3 VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
C4 VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
C5 VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
C6 VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
**************************************************
C1 EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
C2 EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
C3 EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
C4 EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
C5 EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
C6 EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
**************************************************
C1 VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
C2 VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
C3 VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
C4 VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
C5 VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
C6 VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
**************************************************
C1 GSAPTSGSFGVGDEEPPF
C2 GSAPTSGSFGVGDEEPPF
C3 GSAPTSGSFGVGDEEPPF
C4 GSAPTSGSFGVGDEEPPF
C5 GSAPTSGSFGVGDEEPPF
C6 GSAPTSGSFGVGDEEPPF
******************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 168 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 168 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5040]--->[5040]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.461 Mb, Max= 30.695 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
C2 VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
C3 VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
C4 VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
C5 VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
C6 VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
**************************************************
C1 EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
C2 EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
C3 EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
C4 EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
C5 EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
C6 EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
**************************************************
C1 VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
C2 VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
C3 VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
C4 VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
C5 VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
C6 VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
**************************************************
C1 GSAPTSGSFGVGDEEPPF
C2 GSAPTSGSFGVGDEEPPF
C3 GSAPTSGSFGVGDEEPPF
C4 GSAPTSGSFGVGDEEPPF
C5 GSAPTSGSFGVGDEEPPF
C6 GSAPTSGSFGVGDEEPPF
******************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC
C2 GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC
C3 GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC
C4 GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC
C5 GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC
C6 GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC
**************************************************
C1 TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG
C2 TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG
C3 TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG
C4 TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG
C5 TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG
C6 TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG
**************************************************
C1 CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC
C2 CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC
C3 CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC
C4 CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC
C5 CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC
C6 CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC
**************************************************
C1 GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT
C2 GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT
C3 GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT
C4 GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT
C5 GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT
C6 GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT
**************************************************
C1 GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA
C2 GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA
C3 GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA
C4 GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA
C5 GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA
C6 GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA
**************************************************
C1 AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG
C2 AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG
C3 AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG
C4 AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG
C5 AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG
C6 AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG
**************************************************
C1 GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT
C2 GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT
C3 GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT
C4 GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT
C5 GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT
C6 GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT
**************************************************
C1 CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT
C2 CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT
C3 CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT
C4 CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT
C5 CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT
C6 CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT
**************************************************
C1 CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG
C2 CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG
C3 CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG
C4 CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG
C5 CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG
C6 CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG
**************************************************
C1 GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC
C2 GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC
C3 GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC
C4 GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC
C5 GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC
C6 GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC
**************************************************
C1 CTTC
C2 CTTC
C3 CTTC
C4 CTTC
C5 CTTC
C6 CTTC
****
>C1
GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC
TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG
CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC
GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT
GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA
AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG
GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT
CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT
CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG
GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC
CTTC
>C2
GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC
TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG
CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC
GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT
GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA
AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG
GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT
CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT
CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG
GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC
CTTC
>C3
GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC
TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG
CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC
GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT
GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA
AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG
GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT
CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT
CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG
GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC
CTTC
>C4
GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC
TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG
CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC
GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT
GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA
AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG
GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT
CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT
CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG
GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC
CTTC
>C5
GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC
TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG
CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC
GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT
GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA
AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG
GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT
CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT
CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG
GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC
CTTC
>C6
GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC
TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG
CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC
GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT
GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA
AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG
GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT
CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT
CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG
GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC
CTTC
>C1
VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
GSAPTSGSFGVGDEEPPF
>C2
VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
GSAPTSGSFGVGDEEPPF
>C3
VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
GSAPTSGSFGVGDEEPPF
>C4
VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
GSAPTSGSFGVGDEEPPF
>C5
VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
GSAPTSGSFGVGDEEPPF
>C6
VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
GSAPTSGSFGVGDEEPPF
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 504 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579789234
Setting output file names to "/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 626445359
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0515822061
Seed = 1770534124
Swapseed = 1579789234
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1127.976160 -- -24.965149
Chain 2 -- -1127.976095 -- -24.965149
Chain 3 -- -1127.976160 -- -24.965149
Chain 4 -- -1127.976160 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1127.975989 -- -24.965149
Chain 2 -- -1127.976095 -- -24.965149
Chain 3 -- -1127.976160 -- -24.965149
Chain 4 -- -1127.976160 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1127.976] (-1127.976) (-1127.976) (-1127.976) * [-1127.976] (-1127.976) (-1127.976) (-1127.976)
500 -- (-708.994) (-692.335) (-693.571) [-691.874] * (-695.002) (-702.618) [-697.280] (-691.146) -- 0:00:00
1000 -- (-703.404) (-699.811) (-690.229) [-690.313] * (-690.936) (-695.683) [-686.962] (-695.931) -- 0:00:00
1500 -- (-697.644) [-686.745] (-686.396) (-694.013) * (-696.012) (-692.392) [-692.614] (-693.573) -- 0:00:00
2000 -- (-695.631) (-691.487) (-693.543) [-689.498] * (-689.226) [-686.576] (-693.311) (-690.972) -- 0:00:00
2500 -- (-690.345) (-692.438) (-693.841) [-690.582] * [-688.627] (-685.732) (-690.043) (-690.087) -- 0:00:00
3000 -- [-691.278] (-691.873) (-689.165) (-684.937) * [-689.626] (-690.647) (-692.377) (-693.768) -- 0:00:00
3500 -- [-688.468] (-696.973) (-687.200) (-698.555) * (-686.831) [-687.531] (-690.502) (-691.828) -- 0:00:00
4000 -- (-693.021) (-691.049) [-683.077] (-701.917) * (-692.636) (-693.554) [-693.952] (-699.787) -- 0:00:00
4500 -- (-695.171) (-697.397) [-693.120] (-692.639) * [-687.068] (-686.813) (-693.953) (-695.009) -- 0:00:00
5000 -- (-694.210) [-688.824] (-700.938) (-691.130) * [-691.959] (-689.611) (-694.804) (-694.470) -- 0:00:00
Average standard deviation of split frequencies: 0.075151
5500 -- (-698.503) [-691.910] (-685.305) (-685.677) * (-697.120) [-693.765] (-692.969) (-686.270) -- 0:00:00
6000 -- (-688.977) [-690.760] (-689.183) (-689.916) * (-711.835) (-690.479) [-688.056] (-694.288) -- 0:00:00
6500 -- (-691.352) [-690.231] (-690.652) (-690.740) * [-682.055] (-688.970) (-693.655) (-687.802) -- 0:00:00
7000 -- (-698.065) (-692.473) (-697.243) [-689.306] * (-684.973) (-685.648) [-687.219] (-685.851) -- 0:00:00
7500 -- (-704.696) [-690.406] (-691.785) (-688.580) * (-682.920) [-689.023] (-688.340) (-692.622) -- 0:00:00
8000 -- (-695.235) [-687.919] (-693.508) (-691.726) * (-684.569) (-696.279) [-694.877] (-692.674) -- 0:00:00
8500 -- [-690.370] (-691.936) (-691.222) (-689.334) * [-680.804] (-694.438) (-691.766) (-692.336) -- 0:00:00
9000 -- (-692.508) [-690.457] (-687.486) (-694.856) * (-682.126) (-688.307) (-687.689) [-689.521] -- 0:00:00
9500 -- [-691.596] (-689.643) (-694.621) (-691.496) * (-682.393) (-689.792) (-687.336) [-687.488] -- 0:00:00
10000 -- (-700.798) (-704.257) [-687.719] (-701.676) * [-683.226] (-688.395) (-695.677) (-686.110) -- 0:00:00
Average standard deviation of split frequencies: 0.065239
10500 -- (-705.766) (-684.299) (-694.673) [-688.308] * (-682.125) (-700.325) [-693.763] (-687.341) -- 0:00:00
11000 -- (-702.284) [-681.594] (-691.155) (-697.268) * (-684.570) (-693.755) [-690.121] (-697.622) -- 0:00:00
11500 -- (-685.796) [-681.352] (-693.971) (-700.268) * (-681.212) (-690.286) [-688.398] (-699.781) -- 0:00:00
12000 -- (-680.760) [-687.342] (-694.561) (-707.515) * (-680.998) (-691.055) [-687.445] (-693.126) -- 0:00:00
12500 -- (-683.169) (-681.382) [-690.043] (-685.747) * (-681.996) (-693.640) (-696.628) [-683.051] -- 0:00:00
13000 -- [-682.177] (-684.548) (-694.720) (-682.916) * (-684.359) (-688.608) (-688.954) [-679.693] -- 0:01:15
13500 -- (-682.497) (-682.110) [-690.044] (-682.003) * (-682.102) (-687.967) [-689.093] (-680.048) -- 0:01:13
14000 -- (-681.328) [-680.769] (-693.390) (-679.696) * (-679.635) [-697.036] (-694.732) (-680.443) -- 0:01:10
14500 -- (-681.902) (-682.341) [-691.926] (-680.008) * (-680.483) [-690.889] (-705.802) (-684.030) -- 0:01:07
15000 -- (-682.489) (-683.789) (-690.667) [-685.012] * (-680.050) (-691.584) [-682.462] (-681.050) -- 0:01:05
Average standard deviation of split frequencies: 0.053033
15500 -- (-680.321) (-682.662) (-687.803) [-679.930] * (-681.916) (-684.153) [-682.084] (-680.841) -- 0:01:03
16000 -- (-680.305) [-681.087] (-695.291) (-680.764) * (-680.581) [-682.718] (-682.933) (-680.519) -- 0:01:01
16500 -- [-684.356] (-679.773) (-694.823) (-681.611) * [-682.964] (-684.070) (-686.557) (-682.111) -- 0:00:59
17000 -- [-682.566] (-685.373) (-688.019) (-682.157) * (-684.472) [-682.259] (-681.216) (-688.337) -- 0:00:57
17500 -- (-682.384) (-683.483) (-691.266) [-681.865] * (-684.051) [-689.127] (-681.476) (-681.658) -- 0:00:56
18000 -- (-681.952) (-684.779) (-693.741) [-680.982] * [-681.224] (-682.882) (-682.127) (-682.124) -- 0:00:54
18500 -- (-682.980) (-681.005) [-691.413] (-681.608) * [-680.340] (-682.735) (-680.061) (-682.737) -- 0:00:53
19000 -- [-681.893] (-683.932) (-691.746) (-681.258) * (-682.206) (-682.557) (-679.454) [-681.901] -- 0:00:51
19500 -- [-683.608] (-682.219) (-696.599) (-680.857) * [-686.652] (-682.554) (-679.651) (-681.672) -- 0:00:50
20000 -- [-682.775] (-686.181) (-691.046) (-679.987) * [-684.014] (-681.503) (-683.631) (-680.317) -- 0:00:49
Average standard deviation of split frequencies: 0.044278
20500 -- [-682.076] (-683.613) (-687.725) (-679.993) * (-681.545) (-681.138) (-685.263) [-681.511] -- 0:00:47
21000 -- (-682.268) (-680.136) [-690.063] (-682.051) * (-681.448) (-682.306) (-687.673) [-680.490] -- 0:00:46
21500 -- [-681.244] (-682.540) (-687.649) (-681.934) * (-679.563) (-682.061) [-681.589] (-682.011) -- 0:00:45
22000 -- (-680.943) (-680.946) (-691.117) [-682.589] * (-680.213) (-691.200) [-680.557] (-683.846) -- 0:00:44
22500 -- (-680.494) (-683.156) (-688.375) [-680.925] * (-682.438) (-686.424) (-680.122) [-680.407] -- 0:00:43
23000 -- [-684.326] (-681.437) (-691.849) (-684.550) * [-680.027] (-685.552) (-680.791) (-680.441) -- 0:00:42
23500 -- (-681.187) [-681.722] (-688.803) (-680.993) * (-679.876) (-681.239) (-681.228) [-683.523] -- 0:00:41
24000 -- [-683.509] (-681.758) (-692.713) (-680.232) * (-681.471) (-685.965) (-680.223) [-681.398] -- 0:00:40
24500 -- (-683.154) [-680.677] (-688.080) (-680.465) * (-681.103) (-680.699) (-681.353) [-680.226] -- 0:00:39
25000 -- (-680.131) [-683.028] (-698.428) (-681.945) * (-682.195) (-686.400) [-680.521] (-681.131) -- 0:00:39
Average standard deviation of split frequencies: 0.039558
25500 -- [-680.337] (-682.857) (-698.823) (-680.336) * (-681.790) (-682.843) [-680.141] (-682.764) -- 0:00:38
26000 -- (-682.190) (-683.181) (-689.669) [-680.401] * (-680.726) (-682.122) [-682.071] (-680.259) -- 0:00:37
26500 -- (-680.683) (-683.660) (-694.446) [-679.945] * [-680.481] (-680.944) (-682.289) (-682.951) -- 0:00:36
27000 -- (-684.287) [-684.757] (-700.570) (-682.503) * [-685.733] (-681.783) (-681.051) (-680.168) -- 0:00:36
27500 -- [-679.781] (-685.168) (-692.244) (-681.103) * [-687.097] (-684.885) (-682.424) (-682.629) -- 0:00:35
28000 -- (-680.858) [-681.999] (-696.335) (-682.205) * [-683.948] (-680.555) (-682.479) (-686.466) -- 0:01:09
28500 -- (-681.919) (-681.448) [-691.719] (-681.270) * (-680.487) [-681.531] (-682.407) (-683.344) -- 0:01:08
29000 -- (-680.645) [-682.991] (-690.573) (-681.383) * [-680.154] (-680.725) (-690.696) (-684.397) -- 0:01:06
29500 -- (-680.816) [-681.346] (-686.873) (-681.031) * (-680.636) (-680.824) [-684.888] (-684.294) -- 0:01:05
30000 -- (-681.331) [-681.537] (-689.414) (-682.167) * (-683.277) (-681.140) [-685.178] (-684.256) -- 0:01:04
Average standard deviation of split frequencies: 0.039198
30500 -- (-686.351) [-682.671] (-690.009) (-685.345) * (-681.080) (-681.955) [-680.593] (-680.276) -- 0:01:03
31000 -- (-680.170) (-682.756) (-693.462) [-681.052] * (-682.847) (-685.495) [-682.211] (-681.267) -- 0:01:02
31500 -- (-683.824) [-681.065] (-691.896) (-680.292) * (-681.855) (-682.598) (-680.992) [-680.322] -- 0:01:01
32000 -- (-682.277) (-683.018) [-697.134] (-681.188) * (-680.507) [-681.836] (-680.573) (-680.891) -- 0:01:00
32500 -- (-681.128) (-680.750) [-690.738] (-679.917) * (-682.522) (-681.105) (-680.942) [-682.834] -- 0:00:59
33000 -- [-681.681] (-680.620) (-688.767) (-680.137) * (-684.340) (-684.903) [-680.890] (-682.990) -- 0:00:58
33500 -- (-680.168) (-681.588) (-691.585) [-679.967] * (-681.987) (-683.277) [-682.080] (-683.321) -- 0:00:57
34000 -- (-685.304) (-682.515) (-697.942) [-680.708] * (-682.805) [-684.126] (-681.855) (-681.106) -- 0:00:56
34500 -- (-683.022) [-682.079] (-693.031) (-680.447) * [-681.707] (-681.034) (-688.635) (-682.631) -- 0:00:55
35000 -- (-680.815) [-682.890] (-689.007) (-681.569) * [-681.945] (-683.304) (-680.694) (-682.687) -- 0:00:55
Average standard deviation of split frequencies: 0.033391
35500 -- [-681.566] (-683.834) (-694.257) (-682.626) * (-680.063) [-683.908] (-681.221) (-684.790) -- 0:00:54
36000 -- (-680.730) [-682.812] (-699.559) (-681.043) * (-679.880) (-686.166) (-680.359) [-681.380] -- 0:00:53
36500 -- (-682.034) (-684.233) [-694.249] (-681.297) * [-681.486] (-683.942) (-682.319) (-680.943) -- 0:00:52
37000 -- [-683.204] (-684.129) (-683.941) (-680.697) * (-680.833) (-685.368) [-681.059] (-680.335) -- 0:00:52
37500 -- (-683.473) [-683.957] (-691.008) (-679.916) * [-680.344] (-683.806) (-681.704) (-684.381) -- 0:00:51
38000 -- (-682.624) (-681.471) [-698.189] (-680.129) * [-680.961] (-687.119) (-684.391) (-683.684) -- 0:00:50
38500 -- (-684.629) [-680.121] (-689.317) (-681.709) * [-681.091] (-688.627) (-680.912) (-681.643) -- 0:00:49
39000 -- (-683.545) [-680.403] (-698.068) (-683.111) * (-682.268) (-685.547) (-680.889) [-681.615] -- 0:00:49
39500 -- (-681.609) [-681.716] (-692.869) (-682.067) * (-681.505) (-679.997) [-680.681] (-682.365) -- 0:00:48
40000 -- (-680.574) (-682.057) [-687.041] (-682.217) * (-681.367) (-683.466) (-684.484) [-680.906] -- 0:00:48
Average standard deviation of split frequencies: 0.028675
40500 -- (-680.555) (-680.552) (-695.301) [-682.355] * (-682.052) [-687.381] (-684.673) (-681.331) -- 0:00:47
41000 -- (-680.935) (-685.615) (-686.400) [-685.348] * [-681.875] (-686.935) (-686.968) (-679.732) -- 0:00:46
41500 -- (-682.608) (-687.997) [-688.941] (-681.059) * (-686.808) [-682.206] (-684.346) (-680.029) -- 0:00:46
42000 -- (-684.499) (-686.237) [-699.575] (-681.090) * [-681.507] (-681.547) (-683.464) (-680.281) -- 0:00:45
42500 -- (-682.570) (-680.600) (-690.224) [-681.270] * [-680.626] (-679.812) (-682.796) (-680.017) -- 0:00:45
43000 -- (-680.420) (-681.089) (-691.465) [-683.516] * (-682.443) (-682.065) (-682.352) [-682.664] -- 0:00:44
43500 -- [-681.142] (-682.889) (-694.138) (-682.221) * [-682.467] (-683.125) (-682.597) (-685.523) -- 0:00:43
44000 -- (-679.492) [-683.122] (-696.288) (-681.673) * [-680.299] (-681.728) (-682.883) (-685.097) -- 0:01:05
44500 -- (-679.950) [-683.050] (-686.540) (-680.177) * (-680.160) (-682.071) (-681.759) [-681.608] -- 0:01:04
45000 -- (-682.638) (-682.153) (-696.049) [-682.052] * [-680.106] (-682.008) (-683.466) (-680.487) -- 0:01:03
Average standard deviation of split frequencies: 0.023291
45500 -- (-679.492) (-680.687) (-694.065) [-680.080] * (-680.429) (-679.954) [-681.996] (-682.130) -- 0:01:02
46000 -- (-680.721) (-680.148) [-688.986] (-682.661) * (-684.227) (-681.474) (-680.514) [-681.941] -- 0:01:02
46500 -- [-680.509] (-680.864) (-691.614) (-681.060) * (-681.454) [-683.545] (-680.381) (-683.150) -- 0:01:01
47000 -- [-682.201] (-683.487) (-691.956) (-681.270) * (-682.586) (-683.007) [-681.303] (-681.208) -- 0:01:00
47500 -- (-683.521) [-681.790] (-690.673) (-681.891) * [-680.867] (-682.923) (-684.453) (-683.253) -- 0:01:00
48000 -- [-683.884] (-684.196) (-692.377) (-682.807) * (-683.586) (-682.077) (-684.677) [-685.860] -- 0:00:59
48500 -- [-682.039] (-682.761) (-689.870) (-683.632) * [-685.002] (-682.315) (-682.474) (-681.024) -- 0:00:58
49000 -- [-682.616] (-681.215) (-696.807) (-683.328) * (-689.852) (-680.128) (-683.991) [-680.062] -- 0:00:58
49500 -- (-684.911) (-683.813) [-689.435] (-683.062) * (-680.623) (-680.136) [-682.410] (-683.700) -- 0:00:57
50000 -- (-684.407) [-685.480] (-686.889) (-682.926) * (-679.925) [-679.542] (-683.605) (-682.006) -- 0:00:57
Average standard deviation of split frequencies: 0.030238
50500 -- (-683.513) [-686.527] (-694.587) (-683.770) * (-683.633) (-680.567) [-683.466] (-682.330) -- 0:00:56
51000 -- [-680.667] (-683.736) (-695.536) (-682.392) * (-681.480) [-679.760] (-681.252) (-680.890) -- 0:00:55
51500 -- (-681.252) (-681.221) [-685.218] (-685.368) * (-682.192) [-680.333] (-683.686) (-682.662) -- 0:00:55
52000 -- [-680.878] (-680.721) (-695.613) (-680.806) * (-682.319) [-679.449] (-681.291) (-681.119) -- 0:00:54
52500 -- [-681.222] (-681.176) (-689.579) (-681.962) * (-682.013) (-683.807) [-681.402] (-682.272) -- 0:00:54
53000 -- [-680.500] (-682.233) (-694.427) (-683.336) * [-682.073] (-681.910) (-681.177) (-680.415) -- 0:00:53
53500 -- (-681.355) (-681.800) [-687.407] (-681.754) * [-680.723] (-683.100) (-686.308) (-679.632) -- 0:00:53
54000 -- [-680.383] (-681.866) (-693.766) (-681.868) * [-683.890] (-681.601) (-682.984) (-680.469) -- 0:00:52
54500 -- [-679.904] (-681.899) (-696.238) (-682.745) * (-683.128) [-684.444] (-685.796) (-680.415) -- 0:00:52
55000 -- [-679.932] (-683.770) (-698.751) (-681.588) * [-682.105] (-681.755) (-688.290) (-680.027) -- 0:00:51
Average standard deviation of split frequencies: 0.032409
55500 -- (-680.982) [-681.540] (-696.562) (-681.102) * (-684.159) (-686.483) [-686.304] (-680.630) -- 0:00:51
56000 -- (-680.090) (-684.813) (-695.162) [-680.421] * (-683.649) (-686.031) [-683.578] (-681.232) -- 0:00:50
56500 -- [-680.844] (-679.612) (-686.357) (-687.977) * (-680.837) [-682.839] (-682.823) (-688.169) -- 0:00:50
57000 -- (-682.932) [-680.655] (-701.580) (-689.161) * (-681.694) (-686.428) (-681.834) [-681.248] -- 0:00:49
57500 -- [-681.347] (-684.602) (-698.551) (-683.375) * (-680.256) [-680.993] (-685.320) (-681.663) -- 0:00:49
58000 -- [-683.173] (-681.845) (-691.179) (-679.747) * (-681.115) (-681.608) [-682.303] (-681.945) -- 0:00:48
58500 -- (-683.666) [-681.040] (-693.298) (-681.402) * (-681.028) (-684.284) [-681.945] (-679.671) -- 0:00:48
59000 -- (-682.762) (-681.170) [-690.828] (-684.127) * [-680.904] (-682.802) (-682.394) (-682.758) -- 0:00:47
59500 -- (-682.268) [-682.507] (-687.587) (-682.808) * [-682.876] (-682.264) (-684.512) (-682.784) -- 0:01:03
60000 -- (-680.943) [-682.465] (-691.902) (-681.996) * (-683.730) (-680.860) (-682.621) [-682.595] -- 0:01:02
Average standard deviation of split frequencies: 0.035171
60500 -- (-681.532) (-681.178) (-694.280) [-680.488] * (-679.563) [-680.142] (-683.500) (-681.647) -- 0:01:02
61000 -- (-681.027) (-688.421) [-689.382] (-682.660) * (-680.832) (-685.186) [-679.844] (-682.595) -- 0:01:01
61500 -- (-681.032) (-682.300) (-686.176) [-681.014] * [-681.116] (-685.452) (-679.772) (-680.984) -- 0:01:01
62000 -- [-681.934] (-681.042) (-686.599) (-681.317) * (-681.189) (-686.686) [-681.861] (-680.011) -- 0:01:00
62500 -- (-685.228) (-681.693) [-690.917] (-684.521) * (-683.672) [-686.000] (-679.901) (-680.292) -- 0:01:00
63000 -- (-682.149) (-680.983) [-690.383] (-683.754) * [-683.020] (-684.673) (-683.757) (-680.292) -- 0:00:59
63500 -- (-681.778) [-682.713] (-692.684) (-682.781) * (-680.434) (-680.549) (-687.144) [-680.682] -- 0:00:58
64000 -- (-682.143) (-681.950) (-688.133) [-682.828] * (-681.297) [-682.881] (-682.290) (-680.432) -- 0:00:58
64500 -- (-680.925) (-681.461) [-694.801] (-684.242) * (-683.013) (-683.300) [-682.648] (-681.208) -- 0:00:58
65000 -- (-682.187) (-685.993) [-690.736] (-680.623) * [-683.620] (-684.705) (-683.711) (-682.733) -- 0:00:57
Average standard deviation of split frequencies: 0.031201
65500 -- [-683.409] (-682.936) (-709.531) (-679.959) * [-683.342] (-684.481) (-683.429) (-684.679) -- 0:00:57
66000 -- [-679.916] (-681.686) (-690.198) (-682.905) * (-682.688) (-687.661) (-684.208) [-681.869] -- 0:00:56
66500 -- (-682.369) (-680.878) [-683.629] (-680.728) * (-682.317) [-684.998] (-687.757) (-680.587) -- 0:00:56
67000 -- (-683.799) (-683.261) (-681.579) [-680.921] * (-684.386) [-681.100] (-681.651) (-681.753) -- 0:00:55
67500 -- (-680.575) (-685.098) [-681.852] (-680.653) * (-681.438) (-683.149) [-681.244] (-682.816) -- 0:00:55
68000 -- (-680.117) (-683.678) (-683.644) [-682.963] * [-683.898] (-683.401) (-684.240) (-681.611) -- 0:00:54
68500 -- [-681.322] (-684.838) (-680.029) (-685.586) * [-684.380] (-686.772) (-684.946) (-681.637) -- 0:00:54
69000 -- [-681.471] (-682.058) (-682.873) (-683.484) * (-684.910) [-679.812] (-682.804) (-680.405) -- 0:00:53
69500 -- (-683.154) [-682.994] (-682.806) (-682.701) * (-680.378) (-680.582) (-682.564) [-683.731] -- 0:00:53
70000 -- (-679.994) (-684.855) (-683.546) [-681.555] * (-681.217) (-681.137) [-682.419] (-681.387) -- 0:00:53
Average standard deviation of split frequencies: 0.033354
70500 -- (-681.004) (-683.171) [-682.470] (-682.771) * [-680.374] (-681.377) (-681.489) (-681.545) -- 0:00:52
71000 -- (-681.604) (-682.056) [-681.250] (-680.197) * (-684.763) (-680.834) (-683.405) [-680.975] -- 0:00:52
71500 -- (-684.276) [-683.886] (-680.707) (-680.218) * (-680.925) [-681.250] (-681.187) (-682.127) -- 0:00:51
72000 -- (-681.844) [-684.796] (-681.737) (-680.337) * (-681.477) (-680.071) (-680.566) [-684.467] -- 0:00:51
72500 -- [-682.244] (-682.951) (-681.241) (-684.635) * [-682.610] (-681.700) (-680.413) (-679.850) -- 0:00:51
73000 -- (-683.535) (-684.250) [-681.822] (-682.228) * (-682.253) (-682.473) (-684.051) [-679.985] -- 0:00:50
73500 -- [-686.070] (-681.803) (-685.581) (-679.786) * (-682.406) (-682.796) [-683.373] (-679.936) -- 0:01:03
74000 -- (-683.159) [-683.478] (-681.529) (-682.265) * (-681.774) (-683.637) [-680.157] (-681.925) -- 0:01:02
74500 -- [-679.781] (-680.888) (-681.376) (-680.798) * (-684.104) (-681.583) (-679.916) [-683.211] -- 0:01:02
75000 -- (-680.909) [-681.776] (-680.231) (-683.511) * (-683.913) (-683.105) (-681.002) [-680.968] -- 0:01:01
Average standard deviation of split frequencies: 0.035910
75500 -- (-681.514) (-680.653) (-681.370) [-682.001] * (-681.725) [-683.220] (-682.019) (-681.876) -- 0:01:01
76000 -- [-679.563] (-683.319) (-682.299) (-681.319) * (-680.570) (-680.840) (-681.938) [-680.703] -- 0:01:00
76500 -- (-681.360) [-683.220] (-681.575) (-683.204) * (-683.182) [-681.269] (-682.793) (-685.085) -- 0:01:00
77000 -- (-682.241) [-681.550] (-681.300) (-681.524) * (-683.763) (-679.803) (-680.332) [-683.529] -- 0:00:59
77500 -- (-683.824) (-683.941) [-681.438] (-681.616) * [-683.713] (-681.542) (-682.035) (-685.772) -- 0:00:59
78000 -- (-680.477) (-682.611) [-682.876] (-682.651) * (-680.286) (-684.788) [-681.535] (-683.255) -- 0:00:59
78500 -- (-684.031) [-685.238] (-683.492) (-683.446) * (-680.742) (-683.542) [-682.298] (-684.761) -- 0:00:58
79000 -- (-686.068) (-683.476) (-686.140) [-682.213] * [-682.802] (-682.870) (-683.250) (-683.896) -- 0:00:58
79500 -- [-681.587] (-681.936) (-684.612) (-681.945) * [-682.571] (-684.321) (-680.741) (-681.783) -- 0:00:57
80000 -- (-683.219) (-685.793) (-683.069) [-685.174] * (-686.582) (-684.044) (-680.667) [-680.961] -- 0:00:57
Average standard deviation of split frequencies: 0.037831
80500 -- (-682.071) (-680.605) [-682.238] (-681.015) * (-682.072) (-684.276) [-682.648] (-681.399) -- 0:00:57
81000 -- (-681.315) (-679.822) [-680.312] (-687.306) * (-681.835) (-682.461) [-682.922] (-682.890) -- 0:00:56
81500 -- (-679.752) (-685.138) (-681.448) [-682.259] * [-684.402] (-680.658) (-681.157) (-684.499) -- 0:00:56
82000 -- [-679.814] (-681.802) (-681.666) (-683.653) * [-680.506] (-681.084) (-682.367) (-680.157) -- 0:00:55
82500 -- (-683.914) [-682.814] (-681.315) (-681.445) * [-684.085] (-681.746) (-684.412) (-680.713) -- 0:00:55
83000 -- (-681.741) (-682.250) (-680.988) [-679.865] * (-684.537) (-683.867) (-681.750) [-680.103] -- 0:00:55
83500 -- [-679.521] (-680.600) (-684.634) (-681.352) * (-683.363) [-683.674] (-681.195) (-682.211) -- 0:00:54
84000 -- (-681.279) [-680.226] (-682.324) (-685.003) * (-683.465) [-681.951] (-681.331) (-681.732) -- 0:00:54
84500 -- (-681.932) (-682.228) [-685.012] (-685.449) * [-682.783] (-681.544) (-680.645) (-680.855) -- 0:00:54
85000 -- (-680.598) [-681.195] (-682.030) (-682.172) * [-683.414] (-684.176) (-680.166) (-681.434) -- 0:00:53
Average standard deviation of split frequencies: 0.031792
85500 -- [-681.614] (-682.180) (-680.765) (-685.081) * (-681.790) (-680.204) (-683.318) [-685.301] -- 0:00:53
86000 -- [-680.328] (-687.522) (-683.247) (-685.347) * (-683.980) [-680.691] (-682.273) (-683.313) -- 0:00:53
86500 -- (-681.052) [-682.513] (-684.610) (-682.548) * (-683.831) (-682.424) (-685.873) [-683.786] -- 0:00:52
87000 -- (-680.390) (-682.619) (-680.834) [-683.130] * (-681.185) [-683.324] (-679.776) (-687.697) -- 0:00:52
87500 -- [-679.943] (-682.938) (-682.543) (-683.313) * [-682.918] (-681.934) (-680.575) (-684.651) -- 0:00:52
88000 -- [-681.397] (-682.702) (-682.518) (-685.051) * [-680.481] (-681.745) (-682.131) (-684.130) -- 0:00:51
88500 -- (-681.915) [-681.364] (-684.010) (-684.272) * (-687.061) (-685.098) (-681.279) [-681.623] -- 0:00:51
89000 -- (-682.247) [-683.938] (-681.283) (-685.239) * (-684.713) [-686.167] (-680.805) (-683.650) -- 0:00:51
89500 -- (-682.011) (-681.671) (-681.976) [-683.084] * (-683.159) [-683.366] (-681.409) (-680.181) -- 0:01:01
90000 -- (-682.076) [-683.634] (-682.514) (-681.471) * [-682.400] (-682.701) (-681.049) (-681.766) -- 0:01:00
Average standard deviation of split frequencies: 0.032351
90500 -- (-684.254) (-680.360) (-679.915) [-680.898] * [-684.999] (-681.149) (-681.601) (-682.657) -- 0:01:00
91000 -- [-681.371] (-679.950) (-679.980) (-682.587) * (-683.461) (-681.479) (-680.917) [-683.320] -- 0:00:59
91500 -- (-683.225) [-680.051] (-681.036) (-680.854) * (-683.329) (-681.573) (-681.837) [-680.051] -- 0:00:59
92000 -- (-681.248) [-684.320] (-680.291) (-684.993) * (-681.689) (-681.145) [-682.368] (-680.410) -- 0:00:59
92500 -- (-681.829) [-679.939] (-680.847) (-685.236) * (-681.403) (-688.037) (-680.007) [-684.847] -- 0:00:58
93000 -- (-683.905) (-681.439) (-680.101) [-683.121] * [-681.873] (-684.827) (-680.907) (-683.870) -- 0:00:58
93500 -- (-683.325) [-681.097] (-680.086) (-682.873) * (-682.515) (-681.748) [-681.214] (-682.686) -- 0:00:58
94000 -- (-683.328) (-684.160) (-680.548) [-687.124] * (-681.878) (-682.158) [-681.690] (-682.959) -- 0:00:57
94500 -- (-683.564) [-679.990] (-680.554) (-682.405) * (-690.151) [-680.672] (-681.828) (-681.652) -- 0:00:57
95000 -- (-681.948) [-681.646] (-680.626) (-682.849) * (-686.445) (-683.811) (-683.889) [-680.770] -- 0:00:57
Average standard deviation of split frequencies: 0.028946
95500 -- (-682.356) [-682.512] (-681.086) (-681.181) * [-682.902] (-683.446) (-681.203) (-683.177) -- 0:00:56
96000 -- (-682.995) (-682.278) (-681.521) [-681.521] * (-682.889) (-681.620) (-682.075) [-683.773] -- 0:00:56
96500 -- (-679.752) (-680.252) [-682.290] (-682.586) * (-680.711) (-684.239) (-681.967) [-682.417] -- 0:00:56
97000 -- [-679.871] (-683.739) (-682.235) (-680.037) * (-681.128) [-679.978] (-681.053) (-684.331) -- 0:00:55
97500 -- (-681.022) (-684.469) (-681.381) [-681.976] * (-681.786) (-681.937) [-680.708] (-681.969) -- 0:00:55
98000 -- (-681.456) (-680.693) [-680.769] (-685.070) * (-685.345) (-681.378) (-682.125) [-682.187] -- 0:00:55
98500 -- (-679.986) [-680.369] (-686.571) (-686.450) * (-682.324) (-684.013) [-681.871] (-685.945) -- 0:00:54
99000 -- (-680.348) (-681.425) [-681.023] (-683.490) * (-680.873) [-681.707] (-683.721) (-682.233) -- 0:00:54
99500 -- (-680.794) (-681.095) (-685.307) [-681.477] * (-680.510) (-682.786) (-682.662) [-681.261] -- 0:00:54
100000 -- (-684.721) (-682.581) [-683.486] (-681.239) * (-682.902) (-681.653) (-683.746) [-684.469] -- 0:00:54
Average standard deviation of split frequencies: 0.025632
100500 -- (-684.679) [-681.794] (-682.236) (-680.445) * [-681.194] (-679.939) (-683.309) (-682.994) -- 0:00:53
101000 -- [-681.850] (-684.340) (-682.178) (-680.056) * (-682.352) [-683.085] (-682.872) (-682.082) -- 0:00:53
101500 -- (-684.114) [-681.142] (-681.856) (-680.788) * (-682.758) [-679.918] (-680.295) (-681.305) -- 0:00:53
102000 -- (-682.139) (-680.441) (-680.772) [-680.304] * (-681.279) [-681.886] (-681.180) (-680.821) -- 0:00:52
102500 -- (-682.523) [-681.742] (-680.644) (-680.649) * (-684.020) (-680.863) (-684.378) [-680.161] -- 0:00:52
103000 -- (-683.423) [-682.455] (-681.265) (-681.368) * (-682.148) [-681.563] (-681.542) (-681.356) -- 0:00:52
103500 -- (-682.304) (-680.999) (-682.158) [-684.448] * (-682.311) (-681.322) (-681.854) [-681.328] -- 0:00:51
104000 -- [-684.924] (-679.845) (-681.388) (-680.237) * (-680.259) (-682.614) (-680.598) [-681.955] -- 0:00:51
104500 -- (-683.784) [-682.857] (-680.531) (-682.340) * (-681.953) (-684.107) [-683.551] (-683.978) -- 0:00:51
105000 -- (-679.420) (-683.507) (-685.481) [-683.252] * (-683.899) (-684.177) [-682.659] (-681.559) -- 0:00:51
Average standard deviation of split frequencies: 0.023640
105500 -- [-680.521] (-681.799) (-682.864) (-681.826) * (-681.002) [-681.617] (-680.139) (-682.166) -- 0:00:50
106000 -- (-680.289) (-681.782) [-681.793] (-682.207) * (-681.611) [-683.892] (-681.235) (-683.234) -- 0:00:59
106500 -- (-684.299) [-679.946] (-680.353) (-685.031) * (-683.161) (-682.708) (-680.491) [-682.109] -- 0:00:58
107000 -- (-680.424) (-680.252) (-683.374) [-681.752] * (-683.305) (-680.971) [-680.596] (-680.684) -- 0:00:58
107500 -- (-680.391) (-681.272) [-679.861] (-683.085) * [-680.636] (-681.424) (-681.247) (-684.425) -- 0:00:58
108000 -- (-680.538) [-681.827] (-682.889) (-683.073) * (-680.859) (-680.220) [-684.101] (-681.760) -- 0:00:57
108500 -- [-683.306] (-683.278) (-680.425) (-680.642) * (-680.586) (-680.222) [-683.635] (-683.937) -- 0:00:57
109000 -- (-681.863) (-688.046) (-681.599) [-681.990] * [-680.397] (-680.886) (-680.921) (-681.251) -- 0:00:57
109500 -- (-681.557) [-687.073] (-682.727) (-680.664) * [-681.413] (-682.732) (-680.468) (-683.531) -- 0:00:56
110000 -- [-681.318] (-688.997) (-681.560) (-681.455) * (-680.555) (-689.884) [-682.272] (-683.759) -- 0:00:56
Average standard deviation of split frequencies: 0.025795
110500 -- (-681.213) [-684.253] (-682.350) (-684.612) * (-680.559) (-681.423) [-681.354] (-681.097) -- 0:00:56
111000 -- (-685.972) (-682.192) (-681.559) [-679.853] * [-681.647] (-683.769) (-680.045) (-680.160) -- 0:00:56
111500 -- (-680.862) [-681.778] (-683.951) (-681.332) * (-680.440) (-681.783) [-680.703] (-679.996) -- 0:00:55
112000 -- (-680.800) (-681.263) [-681.313] (-682.634) * (-680.085) [-684.287] (-684.458) (-679.773) -- 0:00:55
112500 -- (-682.351) (-681.034) (-681.214) [-680.469] * (-682.232) (-682.819) [-683.106] (-680.106) -- 0:00:55
113000 -- (-681.267) (-679.741) (-681.536) [-684.021] * (-682.741) (-680.254) [-680.627] (-681.375) -- 0:00:54
113500 -- [-681.929] (-682.904) (-680.232) (-681.625) * (-684.311) (-682.043) [-679.654] (-681.395) -- 0:00:54
114000 -- (-681.106) (-682.682) (-682.333) [-685.296] * [-681.651] (-684.618) (-681.881) (-684.607) -- 0:00:54
114500 -- (-685.775) [-680.510] (-684.726) (-686.600) * (-687.371) [-683.791] (-684.871) (-681.608) -- 0:00:54
115000 -- (-683.924) (-680.840) (-681.708) [-683.772] * [-681.265] (-684.193) (-683.345) (-681.340) -- 0:00:53
Average standard deviation of split frequencies: 0.023100
115500 -- (-682.212) (-680.150) (-682.871) [-683.930] * [-681.091] (-681.205) (-681.974) (-681.569) -- 0:00:53
116000 -- [-681.589] (-680.926) (-681.926) (-686.109) * (-679.903) [-682.518] (-683.734) (-680.594) -- 0:00:53
116500 -- (-684.191) [-680.219] (-680.055) (-685.922) * (-681.163) [-681.794] (-680.881) (-680.352) -- 0:00:53
117000 -- (-681.962) [-681.629] (-683.444) (-684.304) * (-681.313) (-680.086) (-683.041) [-680.406] -- 0:00:52
117500 -- (-682.091) [-686.831] (-685.109) (-686.808) * (-682.040) (-680.601) [-682.879] (-682.143) -- 0:00:52
118000 -- [-681.064] (-681.924) (-681.861) (-682.413) * [-680.222] (-680.982) (-685.628) (-679.569) -- 0:00:52
118500 -- (-681.878) (-681.803) [-679.555] (-682.647) * (-685.832) [-685.238] (-683.194) (-680.155) -- 0:00:52
119000 -- (-683.084) [-683.117] (-681.664) (-681.052) * (-680.267) [-688.600] (-685.836) (-680.479) -- 0:00:51
119500 -- (-683.207) (-683.035) (-680.944) [-681.785] * (-686.566) [-682.209] (-681.447) (-681.671) -- 0:00:51
120000 -- (-682.442) [-682.944] (-680.078) (-679.627) * (-684.165) (-685.479) [-681.140] (-681.207) -- 0:00:51
Average standard deviation of split frequencies: 0.021384
120500 -- [-684.280] (-682.631) (-680.263) (-679.707) * (-681.962) (-681.506) [-684.530] (-680.886) -- 0:00:51
121000 -- (-682.093) [-683.333] (-680.512) (-681.922) * [-683.074] (-685.953) (-682.168) (-681.668) -- 0:00:50
121500 -- (-681.148) (-685.327) [-681.851] (-680.122) * (-682.975) (-681.713) [-680.882] (-685.464) -- 0:00:50
122000 -- (-682.543) (-682.584) [-682.154] (-682.093) * (-687.061) (-680.782) (-682.027) [-683.534] -- 0:00:50
122500 -- (-683.793) (-680.528) [-681.638] (-683.704) * (-683.163) (-682.137) (-680.579) [-683.299] -- 0:00:57
123000 -- (-685.616) (-686.634) [-680.588] (-681.394) * (-680.480) [-681.547] (-681.821) (-690.091) -- 0:00:57
123500 -- [-683.283] (-682.782) (-684.311) (-680.745) * [-680.191] (-680.337) (-682.523) (-685.719) -- 0:00:56
124000 -- [-681.655] (-681.777) (-684.372) (-681.359) * (-683.080) [-680.770] (-682.005) (-681.748) -- 0:00:56
124500 -- [-685.150] (-681.469) (-684.786) (-682.619) * (-682.585) (-680.313) [-682.656] (-684.588) -- 0:00:56
125000 -- (-680.690) (-684.053) (-684.344) [-681.425] * (-681.530) (-680.203) [-683.113] (-680.594) -- 0:00:56
Average standard deviation of split frequencies: 0.020873
125500 -- (-682.387) (-681.693) [-680.969] (-681.812) * [-684.379] (-680.119) (-681.739) (-680.403) -- 0:00:55
126000 -- (-688.007) (-684.215) [-682.220] (-679.702) * (-682.303) (-680.434) [-680.506] (-684.683) -- 0:00:55
126500 -- (-686.066) [-682.173] (-681.849) (-681.420) * (-681.064) [-680.388] (-682.951) (-682.123) -- 0:00:55
127000 -- (-684.904) (-680.894) [-681.304] (-686.222) * (-682.380) (-681.957) [-680.457] (-682.670) -- 0:00:54
127500 -- [-680.204] (-681.731) (-679.822) (-682.348) * [-683.516] (-680.866) (-682.282) (-682.118) -- 0:00:54
128000 -- (-680.086) [-681.834] (-681.229) (-680.047) * (-681.948) (-681.110) [-681.197] (-682.329) -- 0:00:54
128500 -- (-681.475) (-681.261) (-680.592) [-684.706] * [-681.859] (-679.595) (-683.840) (-682.125) -- 0:00:54
129000 -- (-681.137) (-680.510) (-680.155) [-688.092] * [-685.376] (-679.861) (-682.259) (-682.053) -- 0:00:54
129500 -- (-679.652) (-681.926) (-682.526) [-683.688] * (-681.995) [-680.639] (-681.088) (-682.637) -- 0:00:53
130000 -- (-682.549) (-680.906) [-680.682] (-684.875) * (-683.881) (-679.960) [-681.631] (-681.876) -- 0:00:53
Average standard deviation of split frequencies: 0.022909
130500 -- [-681.137] (-680.717) (-681.367) (-680.178) * (-679.995) (-682.919) (-683.007) [-680.380] -- 0:00:53
131000 -- (-681.551) (-680.117) [-681.645] (-682.972) * (-682.438) (-681.406) (-680.980) [-679.874] -- 0:00:53
131500 -- (-680.294) [-680.028] (-683.368) (-681.404) * [-683.055] (-683.647) (-681.218) (-681.429) -- 0:00:52
132000 -- (-680.768) [-680.374] (-681.977) (-681.249) * [-684.884] (-681.184) (-681.716) (-680.736) -- 0:00:52
132500 -- (-682.079) [-682.961] (-681.321) (-684.594) * (-684.033) (-686.660) [-680.336] (-687.828) -- 0:00:52
133000 -- [-681.589] (-687.034) (-684.291) (-682.622) * [-685.811] (-683.804) (-683.303) (-687.919) -- 0:00:52
133500 -- (-680.333) (-681.861) [-683.032] (-683.903) * (-681.265) (-682.092) (-679.950) [-683.599] -- 0:00:51
134000 -- [-682.584] (-680.895) (-681.487) (-684.364) * (-681.070) [-681.511] (-679.846) (-682.145) -- 0:00:51
134500 -- (-681.416) (-681.013) (-682.254) [-683.862] * (-683.127) (-686.042) [-679.911] (-681.402) -- 0:00:51
135000 -- [-679.404] (-680.855) (-680.987) (-682.953) * (-682.889) [-681.633] (-681.252) (-686.096) -- 0:00:51
Average standard deviation of split frequencies: 0.021760
135500 -- (-683.499) [-680.807] (-680.412) (-681.219) * [-681.426] (-683.716) (-681.094) (-681.205) -- 0:00:51
136000 -- (-683.648) (-680.741) [-680.301] (-681.245) * (-681.867) (-680.955) (-679.936) [-681.679] -- 0:00:50
136500 -- (-685.004) [-680.899] (-680.531) (-681.283) * (-682.827) [-682.419] (-680.925) (-680.337) -- 0:00:50
137000 -- (-685.358) (-685.224) (-682.671) [-681.661] * [-684.714] (-683.752) (-682.095) (-680.421) -- 0:00:50
137500 -- (-683.348) [-681.507] (-682.503) (-683.761) * (-683.814) (-679.928) (-683.531) [-681.479] -- 0:00:50
138000 -- [-680.927] (-681.920) (-682.083) (-680.402) * (-680.776) (-682.667) [-681.824] (-690.653) -- 0:00:49
138500 -- (-680.414) [-680.370] (-683.345) (-682.907) * [-680.842] (-683.612) (-683.132) (-683.486) -- 0:00:49
139000 -- (-683.068) (-683.501) [-684.683] (-685.714) * (-682.216) [-679.608] (-679.959) (-687.670) -- 0:00:49
139500 -- (-680.717) (-681.722) (-680.537) [-682.086] * (-685.140) [-680.121] (-680.699) (-686.039) -- 0:00:55
140000 -- (-681.542) [-680.581] (-680.969) (-681.260) * [-681.198] (-683.261) (-684.563) (-683.842) -- 0:00:55
Average standard deviation of split frequencies: 0.022155
140500 -- (-685.455) (-680.979) (-682.156) [-680.692] * [-681.673] (-681.385) (-681.236) (-685.002) -- 0:00:55
141000 -- (-683.879) (-683.132) [-681.307] (-682.218) * (-681.632) (-683.643) [-680.136] (-684.574) -- 0:00:54
141500 -- (-681.905) (-682.399) (-683.909) [-681.540] * (-682.132) [-680.709] (-681.539) (-682.048) -- 0:00:54
142000 -- [-681.295] (-682.406) (-681.131) (-682.677) * (-680.226) [-680.668] (-683.591) (-681.119) -- 0:00:54
142500 -- (-682.338) (-682.573) (-681.050) [-682.738] * (-681.665) (-683.163) [-685.652] (-680.517) -- 0:00:54
143000 -- (-682.253) [-684.420] (-682.614) (-683.490) * (-686.335) (-681.052) [-687.390] (-683.774) -- 0:00:53
143500 -- (-681.313) (-680.925) (-682.789) [-683.295] * (-685.257) [-681.130] (-688.556) (-683.633) -- 0:00:53
144000 -- (-684.192) (-679.952) (-683.512) [-681.588] * (-685.800) [-680.619] (-685.675) (-685.391) -- 0:00:53
144500 -- (-681.753) (-680.086) (-682.818) [-681.870] * [-683.122] (-687.217) (-682.647) (-680.078) -- 0:00:53
145000 -- (-680.434) (-682.331) [-682.538] (-682.659) * (-682.233) [-682.085] (-680.706) (-682.047) -- 0:00:53
Average standard deviation of split frequencies: 0.020826
145500 -- (-683.194) (-683.685) [-682.984] (-684.087) * (-682.658) (-680.692) (-681.634) [-682.426] -- 0:00:52
146000 -- (-681.128) (-679.671) (-680.770) [-680.300] * (-684.470) [-680.950] (-681.825) (-684.125) -- 0:00:52
146500 -- (-683.482) [-680.374] (-681.014) (-681.038) * (-680.493) [-681.283] (-684.080) (-685.848) -- 0:00:52
147000 -- (-683.205) (-683.405) (-681.205) [-683.843] * [-685.940] (-681.966) (-680.713) (-683.481) -- 0:00:52
147500 -- [-684.165] (-683.992) (-681.029) (-680.319) * (-682.528) (-680.543) (-682.717) [-682.536] -- 0:00:52
148000 -- [-683.335] (-681.248) (-680.385) (-681.491) * (-679.706) (-683.559) [-679.732] (-682.004) -- 0:00:51
148500 -- (-681.886) [-681.275] (-682.122) (-680.613) * [-681.039] (-681.087) (-681.248) (-681.485) -- 0:00:51
149000 -- (-682.140) (-681.536) (-680.378) [-680.765] * (-681.272) [-682.869] (-681.947) (-685.696) -- 0:00:51
149500 -- [-683.110] (-685.419) (-683.403) (-682.379) * (-681.217) (-682.542) [-681.055] (-680.212) -- 0:00:51
150000 -- (-680.383) (-687.132) [-680.737] (-684.843) * [-680.542] (-679.882) (-680.419) (-683.501) -- 0:00:51
Average standard deviation of split frequencies: 0.020749
150500 -- (-681.196) (-684.712) (-681.943) [-681.593] * (-682.037) [-679.691] (-681.480) (-683.996) -- 0:00:50
151000 -- (-685.525) [-681.077] (-684.231) (-680.383) * [-682.907] (-682.098) (-683.139) (-680.120) -- 0:00:50
151500 -- [-684.006] (-681.751) (-685.820) (-684.502) * (-682.353) (-681.204) (-681.703) [-682.674] -- 0:00:50
152000 -- (-682.508) (-681.154) (-684.258) [-683.114] * (-683.376) (-683.035) [-680.762] (-684.348) -- 0:00:50
152500 -- [-680.725] (-680.191) (-683.702) (-683.241) * (-683.198) (-681.169) [-679.924] (-686.638) -- 0:00:50
153000 -- [-682.650] (-681.770) (-681.147) (-681.132) * (-684.866) (-680.011) [-682.231] (-682.111) -- 0:00:49
153500 -- (-679.869) [-681.293] (-680.139) (-681.267) * (-681.743) (-679.699) (-682.704) [-682.629] -- 0:00:49
154000 -- [-681.560] (-681.875) (-681.500) (-679.868) * (-687.347) (-682.119) (-684.966) [-682.639] -- 0:00:49
154500 -- (-684.273) (-681.784) [-681.174] (-680.537) * (-683.938) [-681.532] (-685.534) (-681.594) -- 0:00:49
155000 -- (-681.115) [-680.166] (-682.925) (-681.607) * (-685.112) [-681.016] (-679.897) (-684.961) -- 0:00:49
Average standard deviation of split frequencies: 0.017775
155500 -- (-680.332) (-680.516) (-683.045) [-680.693] * (-682.519) [-681.163] (-681.163) (-686.091) -- 0:00:48
156000 -- [-680.718] (-679.531) (-681.896) (-682.765) * [-682.024] (-685.137) (-683.259) (-680.688) -- 0:00:54
156500 -- (-681.069) (-680.047) [-679.903] (-682.303) * (-683.423) (-685.248) (-683.013) [-682.842] -- 0:00:53
157000 -- (-681.572) (-685.131) [-681.902] (-682.961) * (-682.471) [-681.596] (-682.775) (-680.985) -- 0:00:53
157500 -- (-687.101) [-680.786] (-685.186) (-681.604) * (-680.558) (-682.563) (-680.309) [-683.964] -- 0:00:53
158000 -- (-684.353) [-680.140] (-683.268) (-681.388) * [-680.216] (-680.694) (-683.613) (-685.884) -- 0:00:53
158500 -- [-683.834] (-682.821) (-682.697) (-681.750) * (-681.005) (-680.112) (-681.144) [-684.523] -- 0:00:53
159000 -- (-685.768) (-684.081) (-681.443) [-680.763] * [-680.508] (-682.706) (-681.113) (-683.365) -- 0:00:52
159500 -- (-681.656) (-680.953) [-683.602] (-682.290) * [-681.868] (-681.558) (-680.019) (-683.252) -- 0:00:52
160000 -- (-684.971) (-680.633) [-682.104] (-684.233) * (-681.307) (-680.840) [-681.812] (-685.346) -- 0:00:52
Average standard deviation of split frequencies: 0.018295
160500 -- [-681.491] (-680.388) (-682.598) (-681.526) * [-681.678] (-681.320) (-681.461) (-685.650) -- 0:00:52
161000 -- (-680.965) (-682.482) [-680.607] (-680.031) * (-683.455) (-681.784) [-680.666] (-683.179) -- 0:00:52
161500 -- (-682.709) [-680.172] (-684.226) (-688.294) * [-682.256] (-682.310) (-681.647) (-692.472) -- 0:00:51
162000 -- [-681.054] (-681.528) (-682.429) (-685.577) * (-682.292) (-680.726) [-680.972] (-682.895) -- 0:00:51
162500 -- (-682.490) [-680.714] (-680.896) (-684.719) * (-683.957) (-683.200) (-680.795) [-682.472] -- 0:00:51
163000 -- (-681.991) [-682.517] (-682.139) (-684.392) * (-683.095) (-682.492) [-680.169] (-683.109) -- 0:00:51
163500 -- (-680.051) (-682.099) (-680.655) [-681.959] * (-683.747) (-680.881) (-682.686) [-683.200] -- 0:00:51
164000 -- (-682.964) (-684.784) [-681.704] (-680.368) * (-679.853) (-679.793) [-682.319] (-682.422) -- 0:00:50
164500 -- (-681.668) [-682.289] (-683.203) (-680.785) * (-680.860) [-680.954] (-681.353) (-683.909) -- 0:00:50
165000 -- (-685.654) [-682.495] (-679.713) (-688.962) * [-680.104] (-682.523) (-682.824) (-686.457) -- 0:00:50
Average standard deviation of split frequencies: 0.017985
165500 -- (-682.572) (-683.285) [-681.781] (-681.003) * [-682.712] (-684.393) (-680.379) (-682.226) -- 0:00:50
166000 -- (-681.836) (-681.530) (-681.533) [-679.958] * (-683.325) (-683.142) (-680.006) [-680.170] -- 0:00:50
166500 -- (-682.684) (-681.616) (-683.712) [-679.974] * (-683.204) (-682.253) [-679.709] (-682.214) -- 0:00:50
167000 -- (-687.110) (-683.113) [-682.051] (-680.965) * (-681.976) (-684.274) [-681.876] (-682.524) -- 0:00:49
167500 -- (-681.784) [-683.289] (-681.480) (-684.483) * (-683.137) (-685.185) [-682.750] (-685.682) -- 0:00:49
168000 -- (-682.343) [-681.967] (-681.370) (-680.931) * (-688.175) (-680.567) (-684.810) [-684.565] -- 0:00:49
168500 -- (-682.436) [-682.341] (-681.080) (-680.782) * [-684.030] (-680.640) (-682.723) (-680.591) -- 0:00:49
169000 -- (-681.639) (-682.366) [-682.738] (-683.631) * (-682.048) (-683.047) (-681.070) [-682.125] -- 0:00:49
169500 -- [-681.767] (-680.777) (-685.370) (-684.898) * (-685.068) (-680.091) (-680.510) [-681.871] -- 0:00:48
170000 -- [-683.205] (-681.697) (-680.745) (-680.005) * [-681.625] (-679.968) (-682.681) (-680.525) -- 0:00:48
Average standard deviation of split frequencies: 0.019480
170500 -- (-682.331) (-684.032) [-680.643] (-681.051) * (-681.117) (-680.026) (-681.052) [-682.377] -- 0:00:48
171000 -- [-681.105] (-681.119) (-685.556) (-682.446) * (-683.064) [-680.305] (-680.764) (-684.681) -- 0:00:48
171500 -- (-682.772) (-683.711) [-679.666] (-682.683) * [-680.212] (-680.437) (-679.975) (-684.590) -- 0:00:48
172000 -- (-683.771) [-683.749] (-681.703) (-680.895) * [-682.485] (-680.904) (-680.400) (-680.906) -- 0:00:48
172500 -- [-682.356] (-681.266) (-685.351) (-688.294) * (-684.306) [-680.916] (-681.709) (-681.940) -- 0:00:47
173000 -- (-682.492) (-683.206) [-681.379] (-688.396) * (-682.327) (-680.760) [-682.367] (-687.817) -- 0:00:52
173500 -- (-684.800) (-682.046) (-680.017) [-680.423] * (-680.134) (-680.668) (-684.603) [-682.626] -- 0:00:52
174000 -- (-683.417) (-679.837) [-682.428] (-680.249) * (-679.947) (-681.177) (-683.880) [-682.191] -- 0:00:52
174500 -- (-681.904) [-682.870] (-682.203) (-681.476) * (-680.202) [-686.742] (-682.414) (-682.561) -- 0:00:52
175000 -- (-681.991) [-682.746] (-680.722) (-680.648) * (-683.199) (-685.003) (-682.508) [-681.115] -- 0:00:51
Average standard deviation of split frequencies: 0.020018
175500 -- (-686.328) [-682.620] (-682.694) (-679.998) * (-680.999) [-681.313] (-681.546) (-682.060) -- 0:00:51
176000 -- (-684.036) [-681.919] (-684.331) (-681.342) * [-680.098] (-681.843) (-682.435) (-681.202) -- 0:00:51
176500 -- (-684.288) (-681.647) (-680.373) [-681.651] * (-679.816) (-679.571) [-681.082] (-680.905) -- 0:00:51
177000 -- (-684.150) (-682.065) [-682.449] (-682.878) * [-682.637] (-683.914) (-680.817) (-679.630) -- 0:00:51
177500 -- [-680.944] (-679.609) (-682.264) (-681.806) * (-681.870) (-682.911) (-680.462) [-679.893] -- 0:00:50
178000 -- (-681.422) (-681.153) [-683.919] (-680.442) * (-681.493) (-680.408) [-684.367] (-681.490) -- 0:00:50
178500 -- (-680.792) (-686.003) [-682.162] (-681.851) * (-685.047) (-680.005) (-684.878) [-679.500] -- 0:00:50
179000 -- [-681.431] (-681.769) (-685.119) (-681.811) * (-681.606) (-681.047) (-680.118) [-680.451] -- 0:00:50
179500 -- [-680.500] (-682.583) (-681.552) (-681.299) * (-681.452) (-686.390) (-680.609) [-680.318] -- 0:00:50
180000 -- (-684.018) (-681.337) (-682.862) [-681.291] * (-680.806) (-679.785) (-681.225) [-679.566] -- 0:00:50
Average standard deviation of split frequencies: 0.021019
180500 -- (-681.147) [-680.358] (-679.965) (-681.494) * (-685.475) (-683.867) [-682.318] (-681.806) -- 0:00:49
181000 -- (-680.642) (-683.157) (-680.098) [-682.099] * (-680.369) (-681.168) [-683.200] (-681.393) -- 0:00:49
181500 -- (-682.529) (-681.508) (-683.758) [-681.139] * (-680.645) (-680.787) (-685.022) [-680.204] -- 0:00:49
182000 -- (-682.801) (-680.441) [-681.002] (-679.664) * (-682.780) [-683.687] (-684.062) (-683.312) -- 0:00:49
182500 -- (-684.683) (-682.323) [-681.370] (-681.222) * (-681.276) (-682.110) [-685.750] (-684.527) -- 0:00:49
183000 -- (-684.109) (-682.473) [-682.303] (-681.101) * (-684.860) [-681.352] (-681.433) (-682.326) -- 0:00:49
183500 -- (-680.196) [-683.668] (-683.860) (-681.726) * (-687.300) (-680.704) [-682.437] (-680.745) -- 0:00:48
184000 -- (-681.186) [-682.669] (-680.437) (-680.592) * (-682.382) (-679.815) (-680.852) [-680.989] -- 0:00:48
184500 -- (-680.043) (-680.577) [-680.812] (-684.071) * (-684.020) [-681.461] (-681.821) (-684.276) -- 0:00:48
185000 -- [-681.761] (-680.552) (-682.906) (-682.310) * (-686.553) [-682.399] (-682.694) (-682.842) -- 0:00:48
Average standard deviation of split frequencies: 0.020009
185500 -- (-685.434) (-680.052) [-681.931] (-682.721) * (-680.570) (-682.493) [-683.734] (-681.036) -- 0:00:48
186000 -- (-685.221) (-681.434) [-681.353] (-684.037) * (-681.750) (-685.425) (-682.129) [-681.448] -- 0:00:48
186500 -- (-682.563) (-680.181) [-682.263] (-683.601) * (-681.853) (-680.894) [-684.214] (-685.430) -- 0:00:47
187000 -- (-681.015) [-680.489] (-679.540) (-683.403) * (-681.982) (-683.238) (-681.724) [-684.531] -- 0:00:47
187500 -- (-685.104) (-681.401) [-680.249] (-684.987) * (-680.837) (-685.060) (-682.187) [-682.141] -- 0:00:47
188000 -- [-680.563] (-680.428) (-680.914) (-681.173) * (-680.679) (-683.782) [-685.202] (-684.679) -- 0:00:47
188500 -- (-680.334) [-680.226] (-683.331) (-684.785) * (-682.164) [-684.573] (-684.639) (-681.307) -- 0:00:47
189000 -- (-681.838) [-681.303] (-680.755) (-685.321) * (-682.085) [-682.453] (-685.724) (-683.802) -- 0:00:47
189500 -- (-681.368) (-680.755) (-682.394) [-685.564] * (-681.654) [-684.058] (-681.480) (-682.675) -- 0:00:47
190000 -- [-685.422] (-682.921) (-679.919) (-686.637) * (-682.272) (-684.465) (-680.891) [-680.387] -- 0:00:51
Average standard deviation of split frequencies: 0.019504
190500 -- [-687.306] (-681.549) (-680.903) (-679.882) * (-683.070) (-684.813) (-682.804) [-680.830] -- 0:00:50
191000 -- (-683.057) [-680.632] (-680.161) (-680.665) * [-682.022] (-681.372) (-681.913) (-680.294) -- 0:00:50
191500 -- (-680.345) [-679.911] (-680.739) (-680.186) * [-682.101] (-682.533) (-683.882) (-681.327) -- 0:00:50
192000 -- (-681.229) (-683.677) (-683.593) [-684.652] * (-681.014) (-681.992) (-683.233) [-680.165] -- 0:00:50
192500 -- (-680.134) (-682.060) (-683.465) [-681.490] * (-684.121) (-682.936) (-681.062) [-685.157] -- 0:00:50
193000 -- (-683.556) (-681.270) [-681.434] (-682.906) * (-681.932) (-682.830) (-680.343) [-684.078] -- 0:00:50
193500 -- [-683.781] (-680.976) (-682.357) (-683.489) * (-680.510) (-681.143) [-680.775] (-683.875) -- 0:00:50
194000 -- [-684.489] (-681.561) (-684.692) (-681.042) * (-681.108) (-680.933) [-681.613] (-682.751) -- 0:00:49
194500 -- (-681.823) [-682.893] (-681.160) (-684.890) * (-683.705) [-682.744] (-681.874) (-682.490) -- 0:00:49
195000 -- [-680.453] (-681.397) (-680.550) (-692.154) * (-683.783) [-683.111] (-683.259) (-680.185) -- 0:00:49
Average standard deviation of split frequencies: 0.020514
195500 -- (-680.931) [-681.965] (-681.444) (-682.986) * [-681.838] (-680.800) (-685.068) (-680.772) -- 0:00:49
196000 -- (-682.447) (-681.443) (-680.803) [-685.877] * (-679.542) (-679.753) [-684.039] (-680.988) -- 0:00:49
196500 -- (-686.365) (-680.414) (-683.442) [-681.381] * [-681.659] (-680.127) (-680.399) (-691.879) -- 0:00:49
197000 -- [-686.035] (-685.624) (-691.742) (-682.552) * [-680.578] (-681.672) (-680.058) (-683.388) -- 0:00:48
197500 -- (-684.281) [-683.148] (-681.532) (-684.152) * (-683.808) (-681.200) (-680.432) [-681.287] -- 0:00:48
198000 -- (-682.938) (-682.540) (-682.407) [-682.997] * (-682.277) (-689.129) [-680.440] (-682.509) -- 0:00:48
198500 -- (-682.550) (-682.432) (-681.690) [-684.148] * (-680.782) (-687.399) [-680.755] (-679.569) -- 0:00:48
199000 -- [-682.640] (-681.352) (-680.786) (-684.153) * (-680.087) (-688.787) (-685.288) [-679.514] -- 0:00:48
199500 -- (-681.829) (-683.483) [-680.483] (-683.333) * (-683.049) (-680.806) (-682.902) [-681.410] -- 0:00:48
200000 -- (-680.590) (-681.919) [-680.412] (-680.990) * [-684.578] (-681.304) (-682.119) (-681.507) -- 0:00:48
Average standard deviation of split frequencies: 0.019968
200500 -- (-683.167) (-681.926) [-680.740] (-685.545) * (-682.774) (-681.102) [-681.520] (-682.465) -- 0:00:47
201000 -- (-681.853) (-680.366) [-681.264] (-680.734) * (-681.436) [-680.267] (-679.619) (-680.464) -- 0:00:47
201500 -- [-682.268] (-682.963) (-681.026) (-680.923) * (-683.923) (-686.274) (-682.130) [-682.668] -- 0:00:47
202000 -- (-681.200) (-682.322) [-681.267] (-681.047) * (-682.230) [-680.878] (-683.526) (-680.150) -- 0:00:47
202500 -- [-681.036] (-681.272) (-681.975) (-685.241) * (-681.026) (-685.477) (-680.892) [-680.923] -- 0:00:47
203000 -- (-680.355) (-682.528) [-681.511] (-681.772) * (-681.930) (-683.024) (-682.205) [-680.892] -- 0:00:47
203500 -- (-679.838) (-685.780) (-682.940) [-683.382] * (-681.868) (-682.264) [-681.837] (-680.935) -- 0:00:46
204000 -- (-680.249) (-681.936) (-680.690) [-683.441] * [-681.592] (-683.407) (-681.581) (-681.871) -- 0:00:46
204500 -- (-680.882) (-681.073) [-682.668] (-680.419) * [-681.564] (-682.589) (-682.066) (-681.535) -- 0:00:46
205000 -- [-680.894] (-679.901) (-683.296) (-681.226) * (-683.901) [-684.292] (-684.916) (-680.662) -- 0:00:46
Average standard deviation of split frequencies: 0.018576
205500 -- [-682.478] (-684.017) (-680.832) (-680.908) * (-681.825) [-680.449] (-683.491) (-682.283) -- 0:00:46
206000 -- (-683.294) (-684.616) [-683.005] (-681.504) * (-681.897) (-679.886) (-682.541) [-680.229] -- 0:00:46
206500 -- (-682.506) (-683.548) [-679.954] (-680.826) * (-681.998) [-679.591] (-680.996) (-681.790) -- 0:00:46
207000 -- [-682.384] (-681.400) (-682.065) (-682.196) * [-681.144] (-680.189) (-681.164) (-682.604) -- 0:00:49
207500 -- (-681.441) (-683.526) (-681.243) [-680.606] * (-680.456) (-680.189) [-682.590] (-688.196) -- 0:00:49
208000 -- (-680.497) [-684.472] (-681.907) (-681.355) * (-682.497) [-682.153] (-682.676) (-689.088) -- 0:00:49
208500 -- (-680.741) (-682.235) (-681.751) [-680.454] * (-680.704) (-682.161) (-680.975) [-682.831] -- 0:00:49
209000 -- (-683.644) (-681.040) (-682.341) [-681.798] * (-683.009) (-682.031) [-683.200] (-684.430) -- 0:00:49
209500 -- (-681.164) (-680.869) (-681.162) [-681.546] * (-679.908) (-683.879) [-681.446] (-682.420) -- 0:00:49
210000 -- [-680.335] (-682.217) (-685.846) (-684.158) * (-680.543) (-681.036) [-681.179] (-682.555) -- 0:00:48
Average standard deviation of split frequencies: 0.019720
210500 -- (-680.537) (-681.134) [-683.863] (-680.811) * [-683.442] (-681.739) (-681.354) (-683.127) -- 0:00:48
211000 -- [-683.270] (-682.671) (-680.553) (-680.199) * [-684.648] (-681.009) (-685.412) (-684.582) -- 0:00:48
211500 -- [-680.973] (-685.338) (-685.511) (-686.391) * (-682.237) (-681.230) [-680.189] (-683.310) -- 0:00:48
212000 -- [-680.888] (-684.847) (-682.102) (-682.197) * (-682.919) [-681.266] (-681.720) (-688.438) -- 0:00:48
212500 -- (-682.344) [-682.059] (-683.242) (-682.097) * (-683.497) [-682.247] (-681.455) (-682.977) -- 0:00:48
213000 -- (-686.564) [-680.417] (-679.722) (-681.436) * (-681.938) (-683.829) (-681.461) [-683.935] -- 0:00:48
213500 -- (-684.863) (-680.785) (-682.785) [-682.840] * (-680.778) (-681.778) (-682.212) [-680.381] -- 0:00:47
214000 -- (-682.537) (-687.773) (-680.141) [-681.957] * [-681.378] (-682.087) (-681.876) (-680.410) -- 0:00:47
214500 -- (-679.794) [-681.184] (-679.724) (-687.001) * (-681.279) (-682.215) (-680.766) [-680.362] -- 0:00:47
215000 -- [-680.459] (-681.670) (-680.249) (-684.387) * (-682.179) (-681.908) [-680.363] (-682.906) -- 0:00:47
Average standard deviation of split frequencies: 0.018687
215500 -- (-681.856) (-680.618) [-681.685] (-684.471) * [-682.544] (-682.543) (-680.939) (-684.449) -- 0:00:47
216000 -- (-681.405) (-680.883) [-680.914] (-687.354) * [-681.344] (-680.503) (-680.668) (-681.493) -- 0:00:47
216500 -- [-680.928] (-682.038) (-683.682) (-684.231) * (-682.021) (-681.203) (-680.895) [-685.402] -- 0:00:47
217000 -- (-683.785) (-681.876) [-684.142] (-680.771) * (-682.943) (-683.567) [-681.092] (-681.185) -- 0:00:46
217500 -- (-683.359) (-682.776) [-685.872] (-681.625) * [-681.123] (-684.301) (-680.750) (-681.754) -- 0:00:46
218000 -- [-682.522] (-684.337) (-685.645) (-681.293) * [-679.936] (-682.516) (-680.344) (-684.097) -- 0:00:46
218500 -- [-683.835] (-684.315) (-685.680) (-683.528) * (-680.898) (-681.191) [-682.868] (-681.663) -- 0:00:46
219000 -- (-682.613) [-680.506] (-679.957) (-684.498) * (-680.914) [-691.006] (-681.320) (-681.434) -- 0:00:46
219500 -- (-681.552) (-681.631) (-680.320) [-683.044] * [-683.332] (-685.517) (-682.185) (-681.936) -- 0:00:46
220000 -- (-684.741) (-681.889) [-683.466] (-681.292) * (-682.320) [-682.908] (-680.407) (-685.559) -- 0:00:46
Average standard deviation of split frequencies: 0.017945
220500 -- (-686.971) (-682.680) [-680.524] (-680.488) * (-681.828) (-681.636) (-681.528) [-679.535] -- 0:00:45
221000 -- (-682.553) (-682.445) (-681.213) [-680.631] * (-683.105) [-681.186] (-682.418) (-679.643) -- 0:00:45
221500 -- (-682.539) [-681.772] (-681.311) (-680.502) * [-682.293] (-683.088) (-681.585) (-680.952) -- 0:00:45
222000 -- (-682.287) (-680.947) (-683.991) [-680.956] * (-683.846) [-682.442] (-681.180) (-681.626) -- 0:00:45
222500 -- (-682.278) (-681.219) (-680.460) [-683.342] * (-682.601) (-680.548) (-681.471) [-684.553] -- 0:00:45
223000 -- (-680.370) [-683.081] (-683.925) (-682.050) * (-684.143) (-679.901) [-686.148] (-681.761) -- 0:00:45
223500 -- (-679.851) [-682.913] (-680.470) (-682.817) * (-679.957) (-680.433) (-681.472) [-680.886] -- 0:00:45
224000 -- (-680.793) (-683.576) (-685.423) [-680.504] * [-681.076] (-680.560) (-680.897) (-682.382) -- 0:00:48
224500 -- (-686.052) (-681.148) [-681.423] (-680.637) * (-679.917) [-680.812] (-681.132) (-686.471) -- 0:00:48
225000 -- [-685.172] (-683.766) (-684.871) (-680.612) * (-681.767) [-680.546] (-682.339) (-683.915) -- 0:00:48
Average standard deviation of split frequencies: 0.017521
225500 -- (-680.489) (-682.506) [-684.475] (-680.114) * [-680.726] (-680.958) (-681.851) (-683.426) -- 0:00:48
226000 -- (-680.609) (-683.674) [-682.734] (-679.946) * (-681.083) (-679.982) [-680.966] (-684.680) -- 0:00:47
226500 -- [-680.327] (-682.790) (-684.516) (-679.546) * (-683.930) (-682.432) (-683.893) [-680.109] -- 0:00:47
227000 -- (-681.986) (-682.160) [-680.685] (-679.442) * (-681.902) [-683.061] (-682.458) (-681.000) -- 0:00:47
227500 -- (-680.506) (-681.514) (-681.318) [-681.207] * [-683.886] (-679.837) (-683.969) (-684.094) -- 0:00:47
228000 -- (-684.656) (-683.787) (-681.742) [-681.378] * (-680.921) (-681.394) (-685.134) [-683.299] -- 0:00:47
228500 -- (-681.512) (-683.409) (-683.528) [-680.867] * (-680.555) (-680.581) [-684.782] (-680.384) -- 0:00:47
229000 -- (-682.694) (-684.209) (-682.372) [-680.870] * [-680.703] (-680.783) (-688.192) (-680.789) -- 0:00:47
229500 -- [-685.000] (-681.067) (-683.296) (-681.243) * (-684.869) (-682.302) (-689.645) [-680.380] -- 0:00:47
230000 -- (-681.324) (-681.787) [-682.176] (-686.617) * [-684.124] (-685.772) (-680.582) (-679.860) -- 0:00:46
Average standard deviation of split frequencies: 0.017848
230500 -- (-682.691) [-680.857] (-681.628) (-682.908) * (-682.778) (-680.697) [-683.128] (-679.776) -- 0:00:46
231000 -- (-679.619) [-680.751] (-684.780) (-684.989) * (-680.479) (-681.191) (-683.724) [-679.778] -- 0:00:46
231500 -- [-684.386] (-680.308) (-681.611) (-682.611) * (-688.015) (-689.669) [-680.895] (-680.575) -- 0:00:46
232000 -- (-682.658) [-682.755] (-686.055) (-680.922) * (-681.890) [-681.789] (-682.101) (-682.549) -- 0:00:46
232500 -- [-681.920] (-682.726) (-683.342) (-680.764) * [-680.722] (-681.314) (-682.743) (-680.608) -- 0:00:46
233000 -- [-681.097] (-681.454) (-680.945) (-681.218) * (-681.392) (-680.825) (-684.055) [-680.674] -- 0:00:46
233500 -- (-681.149) [-681.926] (-680.619) (-680.393) * (-682.417) [-681.359] (-682.181) (-681.674) -- 0:00:45
234000 -- (-681.129) (-684.158) [-680.947] (-680.903) * (-685.114) (-686.422) (-687.664) [-680.449] -- 0:00:45
234500 -- (-685.112) [-680.486] (-680.489) (-679.988) * (-687.133) (-680.637) [-685.326] (-681.587) -- 0:00:45
235000 -- [-685.336] (-680.475) (-681.086) (-679.974) * (-685.331) (-680.896) (-680.252) [-681.213] -- 0:00:45
Average standard deviation of split frequencies: 0.017844
235500 -- (-684.216) (-680.516) (-686.084) [-681.245] * (-680.777) [-680.755] (-684.985) (-684.835) -- 0:00:45
236000 -- (-684.804) (-681.799) [-686.543] (-683.581) * (-683.201) [-680.423] (-687.101) (-682.104) -- 0:00:45
236500 -- [-684.719] (-684.531) (-681.314) (-681.427) * (-683.549) (-681.180) [-685.198] (-681.087) -- 0:00:45
237000 -- (-684.261) [-680.188] (-681.445) (-681.560) * [-683.512] (-680.433) (-685.472) (-681.214) -- 0:00:45
237500 -- (-681.143) (-680.524) (-682.873) [-679.966] * (-683.638) [-680.157] (-682.691) (-680.660) -- 0:00:44
238000 -- (-682.279) (-679.674) (-681.773) [-681.893] * (-685.791) [-681.508] (-682.440) (-682.404) -- 0:00:44
238500 -- [-681.542] (-681.161) (-679.940) (-684.286) * (-681.685) [-681.399] (-681.320) (-684.348) -- 0:00:44
239000 -- (-681.169) (-681.678) [-681.792] (-681.767) * [-680.268] (-681.931) (-679.530) (-688.924) -- 0:00:44
239500 -- (-683.305) (-682.285) (-682.294) [-680.998] * (-681.318) [-681.573] (-682.595) (-685.873) -- 0:00:44
240000 -- (-680.707) (-684.545) (-687.176) [-680.568] * [-682.124] (-681.514) (-684.575) (-685.340) -- 0:00:44
Average standard deviation of split frequencies: 0.015670
240500 -- (-682.778) (-684.704) (-680.590) [-679.919] * (-682.577) (-679.782) (-684.063) [-682.990] -- 0:00:47
241000 -- (-682.729) (-680.888) [-680.934] (-680.103) * (-679.887) (-680.732) (-682.284) [-681.435] -- 0:00:47
241500 -- [-680.606] (-680.021) (-681.674) (-680.954) * (-684.904) [-681.473] (-682.463) (-682.637) -- 0:00:47
242000 -- (-680.331) (-681.490) (-686.023) [-682.522] * (-688.031) (-680.577) [-683.453] (-682.106) -- 0:00:46
242500 -- [-682.491] (-680.505) (-687.257) (-680.315) * (-688.437) (-682.662) [-681.909] (-681.796) -- 0:00:46
243000 -- (-684.171) (-680.430) (-685.172) [-680.148] * (-680.216) [-686.644] (-681.781) (-683.683) -- 0:00:46
243500 -- (-682.605) (-680.075) (-684.844) [-680.486] * (-683.344) (-681.846) (-684.277) [-680.513] -- 0:00:46
244000 -- (-682.367) [-679.774] (-681.764) (-685.957) * (-685.426) (-683.600) (-682.159) [-679.769] -- 0:00:46
244500 -- [-681.122] (-681.228) (-681.722) (-684.340) * [-681.282] (-679.982) (-681.955) (-682.811) -- 0:00:46
245000 -- [-682.889] (-683.045) (-679.951) (-681.924) * [-680.759] (-681.384) (-680.519) (-680.924) -- 0:00:46
Average standard deviation of split frequencies: 0.014316
245500 -- (-681.880) (-681.905) (-684.809) [-680.468] * (-682.259) (-682.026) (-683.559) [-682.176] -- 0:00:46
246000 -- (-682.596) (-681.612) (-681.625) [-683.445] * [-679.618] (-682.173) (-685.620) (-681.622) -- 0:00:45
246500 -- (-680.174) [-683.104] (-682.925) (-682.397) * [-684.133] (-681.222) (-685.221) (-680.602) -- 0:00:45
247000 -- (-679.835) (-681.027) (-681.812) [-682.434] * [-681.302] (-682.099) (-682.537) (-682.270) -- 0:00:45
247500 -- (-679.612) [-682.758] (-681.634) (-685.579) * [-680.463] (-684.620) (-680.490) (-686.732) -- 0:00:45
248000 -- (-681.751) [-680.896] (-681.578) (-683.166) * (-680.996) (-683.180) (-680.252) [-680.054] -- 0:00:45
248500 -- [-680.394] (-680.615) (-681.454) (-680.794) * (-679.907) (-682.524) (-686.057) [-680.214] -- 0:00:45
249000 -- [-680.020] (-680.480) (-684.181) (-681.066) * (-684.135) (-683.815) [-683.985] (-680.321) -- 0:00:45
249500 -- (-679.955) (-682.768) (-685.994) [-681.130] * (-681.361) (-680.692) (-682.145) [-682.117] -- 0:00:45
250000 -- (-681.295) [-680.525] (-680.575) (-686.927) * (-682.080) (-682.276) [-681.762] (-684.038) -- 0:00:45
Average standard deviation of split frequencies: 0.013496
250500 -- [-680.354] (-681.267) (-680.669) (-682.639) * [-680.397] (-686.491) (-683.194) (-682.909) -- 0:00:44
251000 -- (-682.737) [-680.904] (-683.611) (-686.795) * (-680.862) (-684.108) [-682.083] (-681.559) -- 0:00:44
251500 -- [-679.778] (-680.538) (-683.397) (-681.778) * (-681.487) (-684.956) [-687.201] (-688.431) -- 0:00:44
252000 -- (-684.086) (-683.852) [-682.092] (-686.735) * (-684.951) [-682.780] (-683.114) (-687.580) -- 0:00:44
252500 -- (-682.104) (-682.575) [-681.446] (-683.859) * (-680.978) [-679.685] (-682.744) (-681.455) -- 0:00:44
253000 -- [-685.689] (-683.688) (-682.757) (-681.130) * (-686.151) (-684.068) [-685.419] (-679.672) -- 0:00:44
253500 -- (-681.859) (-683.025) [-681.928] (-684.763) * [-681.600] (-682.564) (-684.731) (-680.353) -- 0:00:44
254000 -- (-685.448) (-681.088) (-679.992) [-683.096] * [-680.160] (-683.358) (-684.310) (-680.380) -- 0:00:44
254500 -- [-682.586] (-681.148) (-686.091) (-685.446) * [-682.204] (-682.505) (-680.957) (-679.836) -- 0:00:43
255000 -- (-680.284) (-680.844) [-686.263] (-680.445) * (-686.723) [-681.424] (-681.484) (-683.868) -- 0:00:43
Average standard deviation of split frequencies: 0.013107
255500 -- (-680.086) (-681.535) (-685.724) [-681.656] * [-683.311] (-680.696) (-682.712) (-680.699) -- 0:00:43
256000 -- (-680.592) [-686.657] (-681.801) (-683.602) * [-685.130] (-682.435) (-683.886) (-681.419) -- 0:00:43
256500 -- (-680.124) (-680.617) (-681.637) [-684.330] * [-685.917] (-684.142) (-681.362) (-681.153) -- 0:00:43
257000 -- [-679.784] (-680.300) (-682.811) (-693.486) * (-681.113) (-681.317) [-680.094] (-684.899) -- 0:00:43
257500 -- (-685.245) (-681.513) (-683.256) [-683.738] * (-681.509) (-681.312) [-681.493] (-684.822) -- 0:00:46
258000 -- [-681.898] (-682.480) (-682.046) (-686.043) * (-680.922) (-680.505) [-680.519] (-685.353) -- 0:00:46
258500 -- (-682.071) (-683.324) [-682.186] (-684.139) * (-681.512) (-680.633) (-680.153) [-681.133] -- 0:00:45
259000 -- (-684.776) (-682.146) [-679.836] (-680.546) * (-682.309) (-684.446) [-681.846] (-681.936) -- 0:00:45
259500 -- (-683.739) [-684.083] (-682.332) (-681.069) * (-684.052) (-679.977) (-681.034) [-680.515] -- 0:00:45
260000 -- (-684.578) (-682.884) (-683.059) [-680.482] * [-683.569] (-680.406) (-681.068) (-686.569) -- 0:00:45
Average standard deviation of split frequencies: 0.013936
260500 -- (-685.552) [-681.746] (-681.659) (-681.307) * (-681.439) [-680.235] (-680.664) (-680.200) -- 0:00:45
261000 -- (-682.341) [-681.133] (-681.394) (-682.116) * (-680.883) [-679.563] (-680.132) (-682.145) -- 0:00:45
261500 -- (-680.646) (-684.055) (-681.723) [-680.727] * (-683.916) [-679.907] (-680.266) (-682.541) -- 0:00:45
262000 -- (-681.136) [-682.022] (-680.670) (-680.857) * (-681.883) (-681.666) [-680.686] (-683.679) -- 0:00:45
262500 -- (-684.583) [-681.704] (-683.091) (-681.594) * (-681.058) (-680.519) [-682.220] (-684.677) -- 0:00:44
263000 -- (-681.931) [-683.551] (-688.456) (-680.923) * (-690.306) (-682.113) [-681.901] (-680.715) -- 0:00:44
263500 -- (-680.841) [-681.177] (-685.976) (-681.513) * (-681.554) (-680.527) (-680.698) [-680.418] -- 0:00:44
264000 -- (-685.302) (-682.197) (-680.703) [-683.481] * (-681.258) [-680.796] (-679.919) (-682.859) -- 0:00:44
264500 -- [-685.287] (-682.336) (-680.269) (-682.267) * (-681.152) (-680.785) [-680.571] (-680.242) -- 0:00:44
265000 -- [-684.575] (-680.663) (-681.433) (-682.085) * [-681.661] (-681.071) (-680.933) (-682.885) -- 0:00:44
Average standard deviation of split frequencies: 0.014276
265500 -- (-685.942) [-684.078] (-683.021) (-682.534) * (-683.939) (-682.462) (-681.243) [-680.889] -- 0:00:44
266000 -- [-684.062] (-680.675) (-681.791) (-682.665) * (-680.467) [-683.113] (-680.934) (-680.964) -- 0:00:44
266500 -- (-682.500) [-681.161] (-681.901) (-681.684) * [-682.382] (-680.727) (-683.642) (-681.561) -- 0:00:44
267000 -- [-681.079] (-681.657) (-681.524) (-681.903) * (-682.651) (-681.855) [-683.156] (-682.291) -- 0:00:43
267500 -- (-680.578) [-683.070] (-682.105) (-683.158) * (-682.741) [-683.560] (-682.902) (-683.496) -- 0:00:43
268000 -- (-679.888) (-682.407) (-682.357) [-682.645] * (-684.642) (-683.683) (-684.880) [-681.020] -- 0:00:43
268500 -- [-680.614] (-680.373) (-681.887) (-683.197) * [-682.592] (-680.111) (-684.415) (-681.384) -- 0:00:43
269000 -- [-680.584] (-682.406) (-680.312) (-684.210) * (-679.428) (-680.543) [-680.439] (-680.764) -- 0:00:43
269500 -- [-679.863] (-680.105) (-681.048) (-683.266) * (-681.816) (-679.846) (-680.640) [-680.171] -- 0:00:43
270000 -- (-680.832) (-681.346) [-679.925] (-680.823) * (-684.960) [-682.429] (-683.464) (-682.745) -- 0:00:43
Average standard deviation of split frequencies: 0.012675
270500 -- (-680.728) (-684.742) (-682.390) [-680.604] * (-683.540) (-680.196) [-681.943] (-683.977) -- 0:00:43
271000 -- (-681.912) (-681.377) (-680.331) [-680.780] * [-680.662] (-683.712) (-683.410) (-683.600) -- 0:00:43
271500 -- (-683.353) (-680.515) [-682.453] (-680.907) * (-680.064) [-683.610] (-680.901) (-680.262) -- 0:00:42
272000 -- (-682.128) [-680.173] (-681.240) (-680.298) * (-681.156) (-682.741) (-683.561) [-680.389] -- 0:00:42
272500 -- [-682.105] (-683.075) (-682.387) (-681.683) * [-682.267] (-682.383) (-682.759) (-684.994) -- 0:00:42
273000 -- [-680.120] (-680.112) (-683.030) (-681.481) * (-680.889) (-686.142) (-680.465) [-680.626] -- 0:00:42
273500 -- (-679.842) (-680.532) [-683.886] (-681.572) * (-682.320) [-680.328] (-682.590) (-682.612) -- 0:00:42
274000 -- (-680.559) (-683.948) (-681.614) [-682.367] * (-683.904) [-680.871] (-683.193) (-683.311) -- 0:00:42
274500 -- [-680.133] (-683.677) (-684.642) (-681.179) * [-682.332] (-679.821) (-680.738) (-683.121) -- 0:00:44
275000 -- (-680.136) [-686.573] (-679.725) (-679.896) * (-682.960) [-679.506] (-681.796) (-682.816) -- 0:00:44
Average standard deviation of split frequencies: 0.012157
275500 -- [-681.276] (-683.529) (-683.071) (-680.278) * (-684.223) [-680.459] (-682.965) (-684.021) -- 0:00:44
276000 -- (-679.955) (-682.199) (-684.029) [-679.819] * (-682.417) (-681.253) [-681.582] (-680.863) -- 0:00:44
276500 -- (-679.988) (-682.063) (-682.985) [-680.749] * (-683.088) (-681.707) [-683.310] (-682.430) -- 0:00:44
277000 -- [-685.619] (-682.713) (-681.151) (-683.300) * (-682.890) [-680.550] (-682.199) (-684.839) -- 0:00:44
277500 -- (-681.767) (-681.899) [-682.036] (-684.033) * [-681.275] (-682.902) (-683.222) (-680.296) -- 0:00:44
278000 -- (-682.234) (-680.100) [-683.830] (-683.033) * (-681.123) (-681.532) [-681.753] (-680.810) -- 0:00:44
278500 -- (-681.342) (-683.918) [-681.114] (-682.780) * (-680.639) [-680.233] (-682.263) (-681.625) -- 0:00:44
279000 -- [-682.020] (-681.235) (-680.669) (-684.869) * (-680.899) (-680.683) (-684.499) [-681.073] -- 0:00:43
279500 -- (-680.168) (-682.519) [-686.059] (-683.213) * (-680.310) [-680.245] (-686.342) (-681.572) -- 0:00:43
280000 -- (-680.342) [-682.398] (-691.837) (-682.816) * [-682.774] (-679.888) (-681.667) (-684.964) -- 0:00:43
Average standard deviation of split frequencies: 0.012492
280500 -- [-680.440] (-682.893) (-683.790) (-681.924) * (-682.939) (-680.239) (-681.096) [-682.139] -- 0:00:43
281000 -- [-682.440] (-682.097) (-682.265) (-680.232) * [-680.484] (-682.386) (-682.777) (-682.756) -- 0:00:43
281500 -- (-681.797) (-682.378) (-682.934) [-680.497] * (-681.455) [-685.374] (-685.038) (-682.807) -- 0:00:43
282000 -- (-684.994) (-680.268) [-683.276] (-682.925) * [-683.945] (-685.448) (-682.836) (-679.549) -- 0:00:43
282500 -- (-680.863) (-680.079) [-681.188] (-680.149) * [-680.462] (-682.192) (-680.691) (-681.657) -- 0:00:43
283000 -- (-682.087) (-680.275) [-681.321] (-681.300) * (-683.198) [-682.591] (-682.137) (-680.828) -- 0:00:43
283500 -- (-682.658) (-680.146) [-681.752] (-681.820) * (-680.794) (-685.222) (-680.340) [-680.461] -- 0:00:42
284000 -- (-681.594) [-681.040] (-680.553) (-681.604) * (-680.400) [-688.401] (-680.273) (-680.985) -- 0:00:42
284500 -- (-682.710) [-680.195] (-681.848) (-683.185) * (-679.954) (-682.741) [-680.273] (-682.627) -- 0:00:42
285000 -- [-681.719] (-682.716) (-683.117) (-681.057) * (-681.908) [-681.054] (-682.519) (-681.963) -- 0:00:42
Average standard deviation of split frequencies: 0.011441
285500 -- [-681.859] (-680.992) (-682.239) (-682.104) * (-684.883) (-680.590) [-680.259] (-681.582) -- 0:00:42
286000 -- [-683.285] (-681.095) (-680.830) (-681.269) * (-681.596) (-681.927) (-681.201) [-682.010] -- 0:00:42
286500 -- (-683.545) (-681.203) (-683.322) [-681.745] * (-686.396) [-683.740] (-680.934) (-680.629) -- 0:00:42
287000 -- (-687.248) (-680.909) [-680.522] (-685.961) * [-680.602] (-681.539) (-683.017) (-680.912) -- 0:00:42
287500 -- [-684.810] (-681.389) (-684.023) (-692.822) * [-680.384] (-681.619) (-682.952) (-682.015) -- 0:00:42
288000 -- (-681.611) [-680.994] (-682.561) (-685.362) * (-681.476) [-683.820] (-685.167) (-684.183) -- 0:00:42
288500 -- (-685.577) [-681.059] (-681.852) (-686.299) * (-682.170) (-683.535) (-681.418) [-684.132] -- 0:00:41
289000 -- [-680.641] (-682.051) (-681.008) (-681.411) * (-679.785) (-682.298) [-681.578] (-683.955) -- 0:00:41
289500 -- (-682.064) [-688.032] (-681.225) (-681.769) * (-683.730) (-682.025) (-688.429) [-682.161] -- 0:00:41
290000 -- (-682.713) (-682.146) (-683.697) [-682.070] * (-684.019) (-680.135) (-683.315) [-680.753] -- 0:00:41
Average standard deviation of split frequencies: 0.011830
290500 -- (-680.714) (-685.066) [-682.455] (-681.794) * [-683.924] (-684.497) (-681.415) (-683.355) -- 0:00:41
291000 -- (-680.209) (-681.228) (-681.935) [-680.673] * (-684.474) (-681.858) [-679.894] (-682.596) -- 0:00:41
291500 -- (-680.736) (-681.235) [-680.132] (-681.787) * (-681.345) [-681.174] (-681.249) (-680.068) -- 0:00:43
292000 -- [-682.325] (-681.671) (-682.908) (-684.134) * (-681.675) (-680.217) (-681.966) [-682.132] -- 0:00:43
292500 -- (-688.575) (-683.500) [-683.891] (-681.145) * [-680.535] (-681.899) (-682.476) (-680.912) -- 0:00:43
293000 -- (-683.944) (-683.352) (-684.311) [-681.645] * (-681.292) (-681.458) [-680.428] (-681.242) -- 0:00:43
293500 -- (-683.438) (-681.859) [-680.525] (-681.400) * (-681.872) (-681.302) (-680.857) [-681.144] -- 0:00:43
294000 -- [-680.735] (-683.952) (-679.649) (-681.061) * (-680.956) (-681.130) [-684.034] (-680.945) -- 0:00:43
294500 -- [-684.184] (-684.122) (-683.205) (-681.435) * (-684.967) [-680.541] (-684.032) (-685.999) -- 0:00:43
295000 -- (-681.950) (-684.786) (-689.739) [-681.201] * (-680.142) [-680.630] (-681.785) (-682.459) -- 0:00:43
Average standard deviation of split frequencies: 0.012085
295500 -- (-685.325) (-684.000) [-680.965] (-681.944) * [-681.171] (-683.560) (-681.044) (-680.548) -- 0:00:42
296000 -- (-680.246) [-682.563] (-681.779) (-682.800) * (-681.992) (-680.189) [-679.871] (-683.434) -- 0:00:42
296500 -- (-680.043) [-683.552] (-686.890) (-680.041) * (-681.035) (-680.646) (-680.413) [-681.545] -- 0:00:42
297000 -- (-683.359) [-681.304] (-683.428) (-681.447) * (-680.738) (-683.613) (-679.987) [-682.231] -- 0:00:42
297500 -- (-685.398) (-684.493) [-684.939] (-685.256) * (-680.729) (-682.650) [-683.088] (-682.652) -- 0:00:42
298000 -- [-685.090] (-682.959) (-684.346) (-684.164) * [-682.605] (-689.111) (-683.894) (-682.203) -- 0:00:42
298500 -- [-683.159] (-684.264) (-684.110) (-682.278) * (-682.423) (-690.389) (-681.098) [-683.594] -- 0:00:42
299000 -- (-682.030) [-682.613] (-683.263) (-688.943) * [-680.434] (-687.892) (-688.813) (-680.724) -- 0:00:42
299500 -- [-683.961] (-683.201) (-681.056) (-684.862) * (-681.745) (-682.462) [-682.527] (-682.803) -- 0:00:42
300000 -- (-681.335) (-682.045) (-682.657) [-683.723] * (-680.603) (-681.145) [-681.098] (-681.277) -- 0:00:42
Average standard deviation of split frequencies: 0.013033
300500 -- (-680.809) [-681.110] (-681.475) (-682.576) * (-681.290) (-681.153) [-682.970] (-681.813) -- 0:00:41
301000 -- (-680.987) (-682.358) [-681.607] (-681.704) * (-680.827) [-683.393] (-680.732) (-681.402) -- 0:00:41
301500 -- (-682.227) (-681.534) [-680.600] (-680.947) * (-683.242) (-686.206) (-681.829) [-682.374] -- 0:00:41
302000 -- (-680.338) [-681.964] (-682.728) (-681.277) * (-683.715) [-681.872] (-683.744) (-682.301) -- 0:00:41
302500 -- [-680.825] (-682.368) (-687.362) (-681.066) * (-683.653) [-680.378] (-681.315) (-684.555) -- 0:00:41
303000 -- (-684.488) (-680.831) [-682.094] (-681.476) * (-681.408) [-684.007] (-684.331) (-682.112) -- 0:00:41
303500 -- (-679.982) (-682.316) [-679.747] (-681.385) * [-682.903] (-680.971) (-680.764) (-680.883) -- 0:00:41
304000 -- (-685.052) (-682.393) [-679.966] (-684.114) * (-684.339) (-681.429) [-685.313] (-682.582) -- 0:00:41
304500 -- (-684.473) (-682.182) [-681.356] (-683.740) * [-683.767] (-684.520) (-680.662) (-681.948) -- 0:00:41
305000 -- (-682.860) (-680.464) (-679.917) [-682.986] * [-681.827] (-684.514) (-681.748) (-683.411) -- 0:00:41
Average standard deviation of split frequencies: 0.012596
305500 -- (-680.506) [-681.045] (-680.858) (-684.181) * (-681.617) [-682.554] (-680.462) (-680.260) -- 0:00:40
306000 -- (-683.670) [-680.297] (-680.595) (-687.504) * [-682.644] (-682.136) (-684.097) (-680.458) -- 0:00:40
306500 -- (-682.702) (-682.854) [-680.632] (-681.944) * (-683.353) [-685.251] (-680.940) (-686.376) -- 0:00:40
307000 -- (-683.607) (-682.482) [-680.674] (-683.263) * (-683.619) [-683.297] (-680.922) (-684.154) -- 0:00:40
307500 -- (-680.843) [-680.747] (-681.163) (-684.785) * (-682.050) [-680.718] (-682.960) (-680.424) -- 0:00:42
308000 -- (-680.615) [-681.131] (-685.502) (-683.790) * (-681.461) (-681.695) [-679.713] (-679.464) -- 0:00:42
308500 -- [-680.174] (-680.106) (-683.353) (-683.976) * (-685.855) (-680.825) [-680.868] (-681.444) -- 0:00:42
309000 -- [-679.939] (-681.197) (-684.349) (-681.699) * [-680.080] (-679.887) (-680.520) (-681.630) -- 0:00:42
309500 -- (-681.599) (-680.678) [-683.979] (-680.415) * (-684.900) [-680.927] (-682.313) (-685.701) -- 0:00:42
310000 -- (-682.294) [-680.729] (-682.423) (-682.022) * [-681.180] (-681.200) (-682.372) (-680.068) -- 0:00:42
Average standard deviation of split frequencies: 0.012942
310500 -- [-684.327] (-681.394) (-681.915) (-689.855) * (-679.858) (-682.685) [-680.770] (-683.665) -- 0:00:42
311000 -- (-680.991) (-682.155) (-681.259) [-682.238] * (-679.982) (-680.427) (-680.161) [-680.701] -- 0:00:42
311500 -- (-680.537) (-681.797) (-682.079) [-680.782] * (-679.746) (-679.580) [-682.213] (-680.844) -- 0:00:41
312000 -- (-682.357) (-680.750) (-681.552) [-680.990] * (-680.157) [-680.987] (-680.873) (-680.246) -- 0:00:41
312500 -- (-683.059) [-681.234] (-682.307) (-687.577) * (-683.395) [-681.181] (-681.141) (-681.859) -- 0:00:41
313000 -- [-680.687] (-680.213) (-681.570) (-680.752) * [-680.440] (-681.310) (-680.182) (-684.398) -- 0:00:41
313500 -- [-682.123] (-681.729) (-681.895) (-683.823) * (-684.690) [-683.706] (-681.973) (-681.580) -- 0:00:41
314000 -- (-679.618) (-682.075) [-680.982] (-681.490) * (-686.663) (-682.519) [-680.938] (-679.965) -- 0:00:41
314500 -- (-680.514) [-682.883] (-683.675) (-682.937) * (-682.116) (-682.823) (-680.196) [-681.395] -- 0:00:41
315000 -- [-681.318] (-682.612) (-682.376) (-683.291) * (-682.762) (-681.354) [-681.215] (-680.700) -- 0:00:41
Average standard deviation of split frequencies: 0.012900
315500 -- (-681.102) [-680.681] (-680.061) (-680.496) * (-681.881) (-681.550) (-683.077) [-680.338] -- 0:00:41
316000 -- (-680.962) (-684.483) [-681.793] (-683.010) * (-681.270) (-681.064) [-683.830] (-681.269) -- 0:00:41
316500 -- (-681.304) (-682.528) [-680.708] (-683.603) * (-684.464) (-684.714) [-683.441] (-684.209) -- 0:00:41
317000 -- (-681.249) (-685.041) [-680.968] (-683.997) * (-685.040) (-681.071) [-680.873] (-684.880) -- 0:00:40
317500 -- (-682.336) (-681.996) [-683.414] (-682.372) * (-682.104) (-681.561) [-680.570] (-682.156) -- 0:00:40
318000 -- [-681.177] (-684.782) (-681.465) (-682.458) * (-682.276) [-682.459] (-680.648) (-681.844) -- 0:00:40
318500 -- (-681.332) (-680.197) [-682.685] (-684.963) * (-682.904) [-683.220] (-681.290) (-680.365) -- 0:00:40
319000 -- (-685.364) [-680.772] (-681.412) (-681.072) * [-682.514] (-682.570) (-683.196) (-681.037) -- 0:00:40
319500 -- (-680.948) (-682.577) (-684.533) [-681.120] * [-682.308] (-682.714) (-682.006) (-680.911) -- 0:00:40
320000 -- (-681.471) [-680.979] (-680.650) (-680.986) * (-688.437) (-683.074) (-680.229) [-681.543] -- 0:00:40
Average standard deviation of split frequencies: 0.012798
320500 -- (-680.713) (-683.701) (-684.005) [-681.936] * (-684.264) (-680.482) [-684.391] (-682.891) -- 0:00:40
321000 -- (-684.324) (-692.160) [-682.642] (-684.566) * (-682.458) [-681.945] (-681.545) (-682.096) -- 0:00:40
321500 -- (-682.968) (-687.583) [-682.547] (-681.135) * (-682.128) (-684.126) (-681.315) [-681.677] -- 0:00:40
322000 -- (-685.554) [-682.639] (-681.455) (-680.965) * (-682.162) (-681.241) [-682.117] (-680.067) -- 0:00:40
322500 -- (-682.872) [-680.332] (-682.203) (-683.139) * (-681.294) (-681.152) [-681.563] (-680.517) -- 0:00:39
323000 -- [-680.743] (-680.031) (-683.667) (-681.176) * (-682.775) (-681.177) [-680.801] (-681.321) -- 0:00:39
323500 -- (-684.507) [-682.681] (-682.742) (-679.520) * (-681.592) [-682.018] (-681.258) (-686.064) -- 0:00:39
324000 -- (-684.454) (-683.176) (-685.151) [-680.169] * (-680.347) [-685.110] (-684.713) (-686.076) -- 0:00:41
324500 -- (-682.557) (-684.657) (-685.605) [-680.155] * [-682.461] (-684.143) (-684.851) (-682.969) -- 0:00:41
325000 -- (-681.428) (-682.932) (-680.384) [-680.124] * (-683.594) [-686.502] (-684.255) (-680.724) -- 0:00:41
Average standard deviation of split frequencies: 0.012674
325500 -- (-685.514) (-684.523) (-680.659) [-680.002] * (-682.434) [-687.637] (-683.847) (-682.918) -- 0:00:41
326000 -- (-679.623) [-681.685] (-681.940) (-681.194) * (-683.835) (-682.470) [-685.169] (-682.450) -- 0:00:41
326500 -- (-681.752) [-682.715] (-683.734) (-681.440) * [-680.998] (-681.767) (-684.069) (-683.403) -- 0:00:41
327000 -- [-683.059] (-682.782) (-680.792) (-681.553) * (-682.332) [-681.233] (-681.523) (-683.346) -- 0:00:41
327500 -- (-681.217) [-680.968] (-680.676) (-682.289) * (-681.718) (-682.376) (-681.208) [-683.030] -- 0:00:41
328000 -- (-681.220) [-685.290] (-681.547) (-680.691) * (-682.489) (-684.526) (-682.723) [-680.514] -- 0:00:40
328500 -- [-682.441] (-681.726) (-683.302) (-681.056) * [-683.352] (-680.643) (-681.101) (-683.452) -- 0:00:40
329000 -- (-682.274) (-682.417) [-682.604] (-682.279) * [-681.872] (-679.738) (-682.444) (-683.695) -- 0:00:40
329500 -- (-683.086) [-682.169] (-680.265) (-682.410) * (-683.447) (-679.989) [-682.184] (-681.687) -- 0:00:40
330000 -- (-684.127) [-680.998] (-681.833) (-686.586) * (-682.537) (-681.324) [-680.042] (-682.459) -- 0:00:40
Average standard deviation of split frequencies: 0.013227
330500 -- (-680.336) (-685.222) [-683.048] (-680.934) * [-681.544] (-682.309) (-680.676) (-682.858) -- 0:00:40
331000 -- [-683.578] (-681.682) (-683.300) (-682.267) * (-684.719) (-682.360) (-681.201) [-680.644] -- 0:00:40
331500 -- (-684.522) (-689.342) (-685.564) [-679.919] * [-681.600] (-680.282) (-682.639) (-680.989) -- 0:00:40
332000 -- [-681.375] (-684.696) (-689.472) (-682.703) * (-680.965) (-681.606) (-681.805) [-680.344] -- 0:00:40
332500 -- (-680.391) (-683.116) [-684.343] (-682.736) * [-683.314] (-680.401) (-690.419) (-681.251) -- 0:00:40
333000 -- (-680.798) (-680.183) [-682.767] (-684.383) * (-681.392) [-683.831] (-683.635) (-682.416) -- 0:00:40
333500 -- (-680.111) (-683.131) (-683.647) [-681.975] * (-681.517) (-683.009) (-684.473) [-683.621] -- 0:00:39
334000 -- (-682.214) (-681.690) (-679.928) [-684.941] * (-680.724) [-681.455] (-682.583) (-683.650) -- 0:00:39
334500 -- (-681.669) (-681.852) [-681.157] (-683.137) * (-682.537) (-682.027) (-680.227) [-682.722] -- 0:00:39
335000 -- [-682.956] (-684.825) (-680.694) (-683.247) * (-681.468) (-682.530) [-680.847] (-679.824) -- 0:00:39
Average standard deviation of split frequencies: 0.013173
335500 -- (-683.439) (-685.461) (-681.953) [-680.705] * (-686.093) (-680.735) (-682.183) [-680.970] -- 0:00:39
336000 -- (-680.379) (-681.691) [-681.845] (-681.329) * [-681.661] (-679.771) (-683.274) (-681.953) -- 0:00:39
336500 -- (-681.341) (-681.600) [-682.726] (-682.666) * [-682.446] (-681.786) (-681.186) (-680.067) -- 0:00:39
337000 -- (-685.554) (-684.815) (-681.350) [-681.754] * (-685.060) [-685.525] (-684.387) (-681.035) -- 0:00:39
337500 -- (-682.230) [-680.056] (-680.990) (-688.047) * (-682.792) (-684.649) [-683.113] (-681.716) -- 0:00:39
338000 -- (-681.843) [-680.598] (-685.920) (-685.069) * (-681.221) (-683.625) [-686.333] (-685.532) -- 0:00:39
338500 -- (-681.304) (-684.412) (-688.736) [-681.345] * (-684.265) (-683.921) [-680.413] (-679.868) -- 0:00:39
339000 -- (-684.446) [-685.248] (-689.845) (-686.916) * (-684.155) (-682.166) [-680.033] (-679.671) -- 0:00:38
339500 -- (-685.136) [-682.445] (-685.117) (-681.875) * (-682.889) (-681.362) (-681.313) [-682.797] -- 0:00:38
340000 -- (-683.998) [-682.924] (-680.464) (-683.779) * (-681.233) (-681.129) [-681.220] (-681.216) -- 0:00:38
Average standard deviation of split frequencies: 0.013530
340500 -- [-682.754] (-682.503) (-680.483) (-686.856) * (-684.858) [-680.843] (-682.916) (-680.700) -- 0:00:40
341000 -- (-681.097) (-681.287) [-681.483] (-681.448) * [-683.394] (-681.941) (-682.017) (-680.379) -- 0:00:40
341500 -- (-680.605) (-683.959) [-682.269] (-680.835) * (-681.451) (-688.910) [-682.720] (-682.617) -- 0:00:40
342000 -- [-680.312] (-679.837) (-684.607) (-681.846) * (-680.053) (-681.696) (-685.044) [-682.323] -- 0:00:40
342500 -- (-680.566) (-681.337) [-681.352] (-684.818) * [-682.382] (-682.704) (-683.242) (-683.231) -- 0:00:40
343000 -- [-687.679] (-682.619) (-680.876) (-683.441) * (-681.564) (-682.751) [-682.964] (-681.789) -- 0:00:40
343500 -- (-689.404) (-681.240) (-682.775) [-684.261] * (-682.778) [-686.294] (-682.279) (-681.751) -- 0:00:40
344000 -- (-680.591) (-680.620) [-680.070] (-680.910) * (-679.650) (-682.516) [-682.271] (-681.339) -- 0:00:40
344500 -- [-682.246] (-682.286) (-681.752) (-682.848) * (-680.114) [-682.882] (-685.087) (-681.646) -- 0:00:39
345000 -- (-681.764) (-680.609) (-681.949) [-681.759] * (-681.149) [-681.659] (-682.283) (-681.638) -- 0:00:39
Average standard deviation of split frequencies: 0.013397
345500 -- (-684.242) (-680.349) (-680.425) [-681.835] * [-681.242] (-680.552) (-683.104) (-685.847) -- 0:00:39
346000 -- (-684.586) (-680.549) (-680.521) [-679.814] * (-684.952) (-681.189) (-682.856) [-682.032] -- 0:00:39
346500 -- (-681.148) (-680.633) (-682.084) [-682.914] * (-680.600) (-680.983) [-681.463] (-681.416) -- 0:00:39
347000 -- (-681.343) [-681.871] (-683.742) (-682.492) * (-681.703) [-682.936] (-685.001) (-680.808) -- 0:00:39
347500 -- (-681.214) (-682.112) (-680.985) [-680.829] * [-682.626] (-683.544) (-681.254) (-681.640) -- 0:00:39
348000 -- (-681.270) (-681.438) (-683.601) [-683.146] * (-680.465) (-681.650) [-681.811] (-682.690) -- 0:00:39
348500 -- (-683.056) (-680.577) [-683.812] (-682.350) * [-680.431] (-680.633) (-680.883) (-681.504) -- 0:00:39
349000 -- (-681.742) (-680.059) [-681.281] (-682.535) * (-683.647) [-683.591] (-680.936) (-682.212) -- 0:00:39
349500 -- (-681.583) [-682.442] (-682.221) (-681.576) * [-680.186] (-682.868) (-681.175) (-681.828) -- 0:00:39
350000 -- (-683.800) (-680.568) (-681.155) [-681.520] * (-680.341) [-680.676] (-681.682) (-681.689) -- 0:00:39
Average standard deviation of split frequencies: 0.013231
350500 -- (-680.332) (-682.759) (-683.998) [-681.485] * [-680.473] (-682.801) (-682.024) (-680.559) -- 0:00:38
351000 -- (-685.278) [-681.666] (-681.846) (-681.126) * (-681.395) (-681.952) [-682.027] (-686.286) -- 0:00:38
351500 -- [-683.603] (-682.588) (-683.140) (-680.425) * (-680.441) (-680.800) [-680.111] (-687.173) -- 0:00:38
352000 -- [-680.283] (-680.825) (-681.448) (-681.575) * (-683.065) (-682.708) [-682.051] (-680.573) -- 0:00:38
352500 -- (-682.530) (-681.352) (-684.394) [-680.046] * [-680.718] (-680.331) (-680.862) (-682.840) -- 0:00:38
353000 -- (-682.712) [-681.338] (-680.998) (-680.645) * (-680.399) (-680.699) [-681.045] (-681.999) -- 0:00:38
353500 -- (-682.704) [-681.415] (-681.065) (-680.577) * (-681.863) [-682.379] (-681.714) (-683.184) -- 0:00:38
354000 -- (-679.706) (-684.868) (-683.038) [-681.353] * (-685.555) [-681.355] (-681.786) (-680.772) -- 0:00:38
354500 -- (-680.777) (-682.099) (-680.985) [-681.530] * (-683.931) [-679.844] (-682.925) (-680.429) -- 0:00:38
355000 -- [-682.006] (-681.250) (-681.768) (-682.251) * [-681.021] (-682.476) (-684.119) (-683.574) -- 0:00:38
Average standard deviation of split frequencies: 0.013008
355500 -- (-684.108) (-684.637) [-681.442] (-684.895) * [-680.441] (-681.075) (-680.833) (-683.711) -- 0:00:38
356000 -- (-679.862) (-682.221) [-680.176] (-681.662) * [-681.055] (-680.518) (-682.731) (-683.729) -- 0:00:37
356500 -- (-684.721) [-682.426] (-682.633) (-682.000) * (-679.966) [-680.150] (-681.510) (-683.429) -- 0:00:37
357000 -- [-679.661] (-685.606) (-682.157) (-681.188) * [-679.714] (-682.304) (-688.760) (-682.135) -- 0:00:37
357500 -- (-680.657) (-684.003) [-688.847] (-682.635) * (-681.887) (-682.347) [-682.173] (-684.969) -- 0:00:39
358000 -- (-680.716) (-681.539) [-681.338] (-681.762) * (-682.788) [-681.998] (-683.083) (-680.669) -- 0:00:39
358500 -- (-681.972) (-681.451) (-680.702) [-682.048] * (-684.573) (-680.295) [-681.579] (-684.234) -- 0:00:39
359000 -- (-685.454) (-682.439) [-680.304] (-681.527) * (-683.092) (-679.597) [-680.784] (-680.714) -- 0:00:39
359500 -- (-680.526) [-681.718] (-682.685) (-680.333) * [-681.641] (-684.560) (-680.438) (-680.098) -- 0:00:39
360000 -- (-680.542) [-681.295] (-680.488) (-680.240) * [-680.693] (-680.506) (-681.154) (-680.966) -- 0:00:39
Average standard deviation of split frequencies: 0.013651
360500 -- (-681.853) (-680.793) (-682.313) [-680.005] * (-682.519) (-680.569) [-684.733] (-681.557) -- 0:00:39
361000 -- (-685.505) (-680.999) (-681.765) [-680.463] * (-681.886) (-686.352) (-682.133) [-683.996] -- 0:00:38
361500 -- (-679.880) (-680.070) (-681.927) [-680.734] * (-679.933) [-681.963] (-683.982) (-682.041) -- 0:00:38
362000 -- (-681.602) (-680.798) [-679.955] (-682.663) * (-681.118) (-681.019) (-681.063) [-683.154] -- 0:00:38
362500 -- (-683.663) (-681.483) (-681.919) [-681.822] * (-680.869) [-680.853] (-680.975) (-679.784) -- 0:00:38
363000 -- (-685.131) (-681.869) [-683.013] (-682.199) * (-680.544) [-681.963] (-683.964) (-681.779) -- 0:00:38
363500 -- [-683.237] (-681.678) (-685.630) (-682.041) * [-681.574] (-684.745) (-684.132) (-681.458) -- 0:00:38
364000 -- (-687.577) (-680.836) (-682.632) [-681.646] * (-683.597) (-685.331) (-682.512) [-683.986] -- 0:00:38
364500 -- (-681.098) [-683.664] (-680.237) (-683.546) * [-680.794] (-682.004) (-680.893) (-684.265) -- 0:00:38
365000 -- [-680.600] (-684.080) (-680.347) (-682.733) * (-680.117) (-680.403) (-680.688) [-684.164] -- 0:00:38
Average standard deviation of split frequencies: 0.015027
365500 -- [-680.711] (-686.151) (-679.982) (-684.308) * (-682.747) (-682.361) [-683.968] (-684.530) -- 0:00:38
366000 -- (-683.580) (-684.602) (-680.157) [-681.477] * (-682.909) [-681.995] (-680.508) (-681.591) -- 0:00:38
366500 -- (-681.073) [-681.780] (-679.597) (-681.923) * (-682.628) (-681.656) (-684.533) [-680.440] -- 0:00:38
367000 -- (-681.288) (-682.535) (-686.954) [-680.380] * (-683.885) [-681.028] (-680.581) (-682.150) -- 0:00:37
367500 -- [-680.319] (-683.881) (-685.924) (-681.546) * (-685.051) (-684.957) [-683.822] (-681.313) -- 0:00:37
368000 -- (-682.173) (-681.442) (-683.481) [-680.420] * (-684.530) (-683.779) (-681.812) [-680.745] -- 0:00:37
368500 -- [-682.427] (-682.948) (-680.610) (-682.543) * (-682.436) (-681.476) [-681.610] (-691.555) -- 0:00:37
369000 -- (-684.389) [-683.164] (-679.953) (-682.628) * [-681.992] (-681.712) (-682.220) (-685.580) -- 0:00:37
369500 -- (-684.186) [-686.011] (-681.549) (-684.327) * [-681.964] (-682.169) (-681.495) (-681.777) -- 0:00:37
370000 -- (-682.201) (-680.328) (-681.498) [-683.613] * (-681.733) (-683.525) [-680.540] (-683.938) -- 0:00:37
Average standard deviation of split frequencies: 0.013919
370500 -- (-681.263) (-681.068) (-686.403) [-681.925] * (-681.802) [-680.666] (-682.361) (-682.340) -- 0:00:37
371000 -- (-680.433) (-681.994) (-681.227) [-681.723] * (-682.454) [-680.397] (-684.494) (-681.492) -- 0:00:37
371500 -- (-681.863) (-686.088) [-681.880] (-681.760) * (-684.647) (-684.504) [-681.033] (-681.634) -- 0:00:37
372000 -- (-680.335) [-680.986] (-680.878) (-685.173) * (-681.431) (-683.910) [-680.939] (-683.204) -- 0:00:37
372500 -- (-682.839) (-684.104) [-683.237] (-681.134) * (-684.215) [-679.669] (-680.640) (-681.451) -- 0:00:37
373000 -- (-685.445) [-682.472] (-681.713) (-680.451) * (-683.314) [-679.790] (-680.908) (-681.319) -- 0:00:36
373500 -- (-681.650) (-681.299) [-680.802] (-682.402) * (-681.436) (-681.431) (-680.016) [-680.415] -- 0:00:36
374000 -- [-681.827] (-681.597) (-681.955) (-680.963) * (-680.572) (-680.763) (-682.087) [-681.761] -- 0:00:36
374500 -- [-680.538] (-680.950) (-681.976) (-682.673) * (-681.425) [-685.026] (-682.858) (-681.151) -- 0:00:38
375000 -- (-680.409) (-681.585) (-680.604) [-682.143] * (-680.954) (-682.208) [-680.859] (-681.138) -- 0:00:38
Average standard deviation of split frequencies: 0.013025
375500 -- (-681.997) (-680.787) (-680.375) [-683.349] * (-680.954) (-681.091) (-680.581) [-682.464] -- 0:00:38
376000 -- (-683.293) (-681.980) [-680.397] (-687.088) * [-681.830] (-682.793) (-682.729) (-686.448) -- 0:00:38
376500 -- [-682.610] (-680.982) (-685.597) (-679.967) * (-688.738) [-681.554] (-680.496) (-687.633) -- 0:00:38
377000 -- (-682.762) (-681.428) (-679.771) [-682.003] * (-685.078) (-681.513) [-681.747] (-683.190) -- 0:00:38
377500 -- (-683.511) (-680.710) [-680.304] (-681.988) * [-680.772] (-683.309) (-680.660) (-682.115) -- 0:00:37
378000 -- (-684.323) (-680.422) [-684.327] (-681.625) * (-682.127) (-682.749) (-680.827) [-683.956] -- 0:00:37
378500 -- [-685.667] (-681.354) (-684.025) (-680.854) * [-683.024] (-681.894) (-685.269) (-680.990) -- 0:00:37
379000 -- (-679.963) (-681.173) (-681.551) [-681.659] * (-681.170) (-682.722) [-682.534] (-681.157) -- 0:00:37
379500 -- [-681.282] (-682.466) (-681.167) (-682.954) * [-687.338] (-682.166) (-683.692) (-683.252) -- 0:00:37
380000 -- (-682.997) (-681.484) [-680.760] (-681.457) * (-684.112) (-683.887) (-683.193) [-682.450] -- 0:00:37
Average standard deviation of split frequencies: 0.013331
380500 -- (-684.577) (-685.294) (-681.922) [-680.643] * (-682.817) (-683.506) (-682.772) [-681.770] -- 0:00:37
381000 -- (-682.297) (-683.917) [-683.191] (-682.184) * (-682.543) (-682.781) [-680.323] (-681.847) -- 0:00:37
381500 -- (-683.819) (-683.599) [-682.936] (-681.739) * (-680.320) [-681.807] (-683.040) (-681.011) -- 0:00:37
382000 -- (-682.922) (-680.932) [-683.024] (-682.027) * [-680.578] (-681.800) (-683.869) (-683.138) -- 0:00:37
382500 -- (-683.795) (-680.731) [-682.033] (-681.521) * [-680.603] (-686.762) (-681.817) (-681.967) -- 0:00:37
383000 -- (-681.499) [-681.442] (-680.693) (-683.404) * [-680.582] (-683.538) (-680.613) (-683.109) -- 0:00:37
383500 -- (-680.469) [-681.752] (-683.357) (-683.370) * [-680.104] (-683.191) (-682.837) (-680.417) -- 0:00:36
384000 -- (-683.760) (-680.712) [-681.949] (-684.615) * (-681.167) (-681.276) [-681.999] (-683.140) -- 0:00:36
384500 -- (-684.744) [-680.781] (-681.268) (-682.241) * (-683.351) [-683.120] (-681.766) (-683.016) -- 0:00:36
385000 -- (-682.205) [-680.101] (-681.804) (-682.779) * (-680.356) [-682.298] (-680.656) (-682.085) -- 0:00:36
Average standard deviation of split frequencies: 0.013003
385500 -- (-682.764) (-681.353) [-681.190] (-683.186) * [-683.142] (-682.373) (-682.315) (-680.936) -- 0:00:36
386000 -- [-682.919] (-685.649) (-681.935) (-682.899) * (-685.772) [-680.321] (-683.141) (-681.070) -- 0:00:36
386500 -- (-681.342) (-683.172) [-681.332] (-681.519) * [-681.736] (-682.644) (-682.100) (-681.637) -- 0:00:36
387000 -- (-681.333) (-682.129) (-684.950) [-682.866] * [-680.389] (-681.811) (-684.449) (-682.228) -- 0:00:36
387500 -- (-681.472) (-681.560) [-681.449] (-679.950) * (-681.236) [-682.446] (-682.065) (-682.266) -- 0:00:36
388000 -- (-684.239) (-683.453) [-680.311] (-681.147) * [-681.154] (-681.471) (-679.724) (-684.367) -- 0:00:36
388500 -- (-681.357) [-681.440] (-681.279) (-683.232) * (-680.684) (-681.502) (-682.357) [-681.986] -- 0:00:36
389000 -- (-681.703) [-685.015] (-684.558) (-685.129) * [-681.202] (-681.534) (-682.135) (-681.493) -- 0:00:36
389500 -- (-680.555) (-680.341) [-680.376] (-680.808) * (-680.590) (-681.606) (-685.200) [-681.308] -- 0:00:36
390000 -- (-682.044) [-682.808] (-681.412) (-684.128) * [-681.568] (-682.397) (-682.053) (-680.659) -- 0:00:35
Average standard deviation of split frequencies: 0.013131
390500 -- (-691.508) (-680.377) (-681.185) [-680.377] * (-683.243) (-682.269) [-680.743] (-681.631) -- 0:00:35
391000 -- (-680.372) [-680.219] (-684.818) (-686.650) * (-680.233) (-680.675) [-680.389] (-682.980) -- 0:00:37
391500 -- (-681.965) (-681.174) [-682.794] (-681.504) * (-680.720) [-682.334] (-681.626) (-688.336) -- 0:00:37
392000 -- (-682.232) (-681.299) [-683.634] (-681.256) * (-691.471) (-681.018) (-683.323) [-684.641] -- 0:00:37
392500 -- (-681.988) (-680.651) (-680.914) [-680.392] * (-685.396) [-680.956] (-682.865) (-681.146) -- 0:00:37
393000 -- [-680.752] (-680.869) (-681.046) (-682.040) * (-681.861) [-684.004] (-681.631) (-682.503) -- 0:00:37
393500 -- (-682.141) [-683.013] (-680.028) (-685.257) * (-680.555) (-682.651) (-679.754) [-680.164] -- 0:00:36
394000 -- (-685.888) (-684.684) (-685.486) [-690.000] * (-681.249) [-681.799] (-679.501) (-681.391) -- 0:00:36
394500 -- (-682.694) (-683.648) [-686.509] (-691.578) * (-680.604) [-682.300] (-685.902) (-680.391) -- 0:00:36
395000 -- (-682.997) (-682.789) [-686.714] (-690.117) * [-682.236] (-685.274) (-683.280) (-682.301) -- 0:00:36
Average standard deviation of split frequencies: 0.012276
395500 -- (-681.878) (-680.214) [-684.012] (-684.386) * (-688.735) (-680.048) (-681.119) [-681.867] -- 0:00:36
396000 -- [-681.176] (-680.553) (-683.962) (-685.084) * (-681.385) [-680.112] (-683.591) (-682.858) -- 0:00:36
396500 -- (-683.274) [-681.309] (-682.701) (-683.540) * (-682.301) (-680.952) [-681.936] (-681.837) -- 0:00:36
397000 -- [-684.265] (-682.929) (-685.018) (-680.703) * (-680.319) (-683.355) (-683.603) [-683.180] -- 0:00:36
397500 -- (-681.297) (-680.964) [-683.114] (-684.525) * (-682.698) (-681.693) (-684.724) [-680.908] -- 0:00:36
398000 -- [-681.417] (-680.910) (-682.798) (-682.015) * (-680.289) (-680.457) [-683.983] (-683.216) -- 0:00:36
398500 -- (-681.349) (-680.026) (-683.253) [-684.107] * (-684.406) [-680.253] (-682.810) (-682.724) -- 0:00:36
399000 -- (-683.630) [-681.501] (-680.865) (-680.176) * [-684.256] (-680.135) (-683.989) (-680.433) -- 0:00:36
399500 -- (-683.007) (-682.973) (-680.373) [-684.012] * (-681.113) (-682.207) (-683.178) [-679.979] -- 0:00:36
400000 -- (-683.939) (-682.500) (-680.044) [-681.175] * (-680.343) (-681.706) [-680.187] (-684.921) -- 0:00:36
Average standard deviation of split frequencies: 0.012079
400500 -- (-680.301) (-683.578) [-681.970] (-681.858) * (-682.154) [-681.551] (-682.371) (-684.163) -- 0:00:35
401000 -- (-680.430) (-681.255) [-683.010] (-681.812) * (-684.748) (-683.385) [-682.189] (-683.591) -- 0:00:35
401500 -- (-680.382) (-684.204) [-680.063] (-681.062) * (-682.164) (-684.604) [-680.389] (-682.736) -- 0:00:35
402000 -- (-686.565) [-680.668] (-683.616) (-684.920) * (-681.957) [-684.033] (-680.176) (-682.578) -- 0:00:35
402500 -- (-680.637) (-680.820) [-681.967] (-681.691) * [-684.375] (-679.529) (-681.187) (-684.068) -- 0:00:35
403000 -- (-681.046) (-680.983) (-682.024) [-681.346] * [-680.486] (-688.066) (-683.545) (-682.044) -- 0:00:35
403500 -- (-682.910) (-680.391) [-681.742] (-680.418) * (-681.419) (-684.688) [-682.770] (-680.124) -- 0:00:35
404000 -- (-682.525) (-682.222) [-681.302] (-682.250) * [-680.843] (-683.197) (-680.281) (-680.663) -- 0:00:35
404500 -- (-683.990) (-682.128) [-681.782] (-683.452) * [-680.953] (-684.433) (-681.908) (-689.145) -- 0:00:35
405000 -- (-681.293) (-681.207) (-683.207) [-680.665] * (-682.229) [-681.652] (-680.675) (-683.312) -- 0:00:35
Average standard deviation of split frequencies: 0.012482
405500 -- [-680.537] (-680.950) (-684.442) (-682.616) * (-681.967) (-681.463) [-680.674] (-683.558) -- 0:00:35
406000 -- (-681.287) (-681.635) (-680.854) [-679.418] * (-680.464) [-682.725] (-684.961) (-681.058) -- 0:00:35
406500 -- (-680.456) (-685.050) (-682.084) [-682.484] * (-683.264) [-680.846] (-683.929) (-681.840) -- 0:00:35
407000 -- (-684.697) [-686.662] (-686.169) (-681.230) * [-683.066] (-682.198) (-685.879) (-679.813) -- 0:00:34
407500 -- (-682.323) (-683.417) [-680.528] (-680.292) * [-682.853] (-682.556) (-680.847) (-682.111) -- 0:00:34
408000 -- [-683.595] (-684.449) (-679.493) (-679.571) * (-684.316) (-682.003) [-685.518] (-684.538) -- 0:00:36
408500 -- [-682.460] (-680.693) (-682.173) (-679.990) * (-682.459) (-688.912) (-689.234) [-679.974] -- 0:00:36
409000 -- (-683.372) (-681.474) (-683.023) [-683.376] * (-681.844) [-681.543] (-679.733) (-682.830) -- 0:00:36
409500 -- (-681.679) [-680.487] (-681.252) (-682.019) * [-680.073] (-680.811) (-681.239) (-685.060) -- 0:00:36
410000 -- (-681.754) [-681.772] (-681.430) (-682.646) * (-681.105) (-681.411) [-683.466] (-682.577) -- 0:00:35
Average standard deviation of split frequencies: 0.012125
410500 -- (-681.790) (-683.314) (-683.213) [-681.363] * [-679.689] (-684.642) (-681.565) (-684.042) -- 0:00:35
411000 -- (-683.866) (-682.984) (-680.584) [-681.357] * (-681.665) [-684.323] (-681.033) (-681.905) -- 0:00:35
411500 -- [-682.968] (-680.160) (-686.575) (-682.258) * (-683.465) (-682.903) [-681.509] (-683.944) -- 0:00:35
412000 -- (-679.955) [-681.355] (-687.978) (-680.689) * [-683.213] (-683.600) (-681.095) (-682.494) -- 0:00:35
412500 -- (-680.699) (-684.079) [-681.442] (-682.378) * [-680.309] (-682.416) (-681.057) (-682.296) -- 0:00:35
413000 -- (-682.225) (-681.726) (-680.578) [-680.500] * (-684.796) [-680.610] (-681.515) (-682.016) -- 0:00:35
413500 -- (-679.781) [-680.366] (-681.419) (-681.851) * [-682.896] (-679.673) (-680.922) (-683.483) -- 0:00:35
414000 -- (-681.508) [-682.921] (-684.032) (-686.183) * [-684.199] (-679.568) (-680.719) (-681.909) -- 0:00:35
414500 -- (-682.027) (-679.531) (-680.407) [-680.386] * [-681.371] (-679.797) (-684.329) (-683.330) -- 0:00:35
415000 -- (-686.358) (-682.682) [-681.170] (-683.435) * (-683.206) (-680.276) [-680.380] (-680.054) -- 0:00:35
Average standard deviation of split frequencies: 0.011686
415500 -- (-682.562) [-682.253] (-683.910) (-681.483) * (-684.428) [-680.052] (-684.973) (-680.908) -- 0:00:35
416000 -- (-680.927) (-684.341) (-683.627) [-685.303] * [-681.384] (-681.380) (-686.622) (-680.659) -- 0:00:35
416500 -- (-679.763) (-682.460) [-681.663] (-680.668) * (-683.522) (-680.477) [-679.897] (-682.881) -- 0:00:35
417000 -- (-684.059) (-683.105) (-683.041) [-685.205] * (-681.717) (-680.210) (-683.364) [-683.961] -- 0:00:34
417500 -- [-680.883] (-681.211) (-681.667) (-684.332) * [-681.490] (-682.488) (-680.919) (-681.981) -- 0:00:34
418000 -- (-680.163) (-681.741) (-680.767) [-681.922] * [-681.059] (-682.139) (-682.918) (-681.222) -- 0:00:34
418500 -- (-680.715) (-682.292) (-683.950) [-680.784] * (-681.523) [-682.600] (-685.614) (-681.762) -- 0:00:34
419000 -- [-681.373] (-680.608) (-680.804) (-686.128) * (-682.980) (-681.232) (-680.347) [-680.687] -- 0:00:34
419500 -- (-681.400) (-680.133) (-679.874) [-686.077] * (-681.959) [-682.635] (-681.059) (-682.594) -- 0:00:34
420000 -- (-684.538) (-680.074) [-680.783] (-683.375) * (-681.411) (-683.870) [-682.902] (-679.801) -- 0:00:34
Average standard deviation of split frequencies: 0.012117
420500 -- [-683.535] (-680.703) (-680.113) (-681.583) * [-682.043] (-681.108) (-682.714) (-679.607) -- 0:00:34
421000 -- [-684.600] (-681.530) (-684.866) (-682.477) * (-681.374) (-681.437) (-684.727) [-679.980] -- 0:00:34
421500 -- [-684.845] (-680.726) (-680.787) (-681.601) * [-680.215] (-681.051) (-683.619) (-681.475) -- 0:00:34
422000 -- (-685.219) (-680.825) [-681.436] (-682.365) * (-679.975) (-680.390) [-682.124] (-679.785) -- 0:00:34
422500 -- (-682.698) (-681.759) [-683.665] (-681.070) * (-683.652) (-681.325) [-680.313] (-682.672) -- 0:00:34
423000 -- (-683.416) [-680.290] (-680.953) (-685.322) * (-681.719) (-679.930) [-681.570] (-681.042) -- 0:00:34
423500 -- (-681.753) (-680.188) [-682.273] (-683.324) * (-680.720) [-681.658] (-686.163) (-681.723) -- 0:00:34
424000 -- (-681.535) (-683.019) (-682.532) [-681.875] * (-681.905) [-681.132] (-685.368) (-687.616) -- 0:00:33
424500 -- (-681.604) [-680.004] (-683.690) (-681.040) * (-682.829) [-684.734] (-685.431) (-682.143) -- 0:00:33
425000 -- [-683.968] (-681.355) (-681.273) (-683.319) * (-683.161) (-681.377) [-683.447] (-680.605) -- 0:00:35
Average standard deviation of split frequencies: 0.012246
425500 -- (-685.234) (-680.010) [-680.271] (-684.205) * (-681.267) (-681.755) [-681.505] (-680.471) -- 0:00:35
426000 -- (-683.010) (-681.069) [-679.967] (-683.777) * (-686.127) [-679.713] (-680.299) (-682.363) -- 0:00:35
426500 -- [-682.403] (-682.096) (-679.950) (-683.032) * (-683.160) (-680.625) [-686.356] (-682.417) -- 0:00:34
427000 -- [-680.914] (-679.916) (-682.051) (-681.959) * [-680.893] (-683.606) (-683.582) (-681.835) -- 0:00:34
427500 -- (-681.541) [-679.632] (-681.503) (-684.787) * [-683.414] (-680.371) (-683.310) (-680.572) -- 0:00:34
428000 -- (-682.357) [-679.738] (-682.929) (-681.405) * (-686.771) (-679.531) (-681.732) [-682.514] -- 0:00:34
428500 -- (-680.750) (-679.673) (-681.436) [-681.913] * (-683.358) (-681.758) [-680.908] (-688.036) -- 0:00:34
429000 -- (-681.846) [-683.608] (-683.096) (-687.071) * (-683.550) (-681.335) (-683.231) [-684.380] -- 0:00:34
429500 -- (-680.101) (-680.771) [-681.901] (-689.369) * (-683.052) (-680.586) (-680.885) [-683.580] -- 0:00:34
430000 -- (-681.377) (-680.199) (-681.088) [-680.809] * (-680.850) (-681.312) [-681.604] (-680.966) -- 0:00:34
Average standard deviation of split frequencies: 0.011311
430500 -- [-681.569] (-682.094) (-684.922) (-681.598) * [-684.438] (-681.466) (-682.951) (-682.451) -- 0:00:34
431000 -- (-681.649) (-683.594) [-682.794] (-684.575) * [-687.098] (-681.408) (-680.492) (-682.055) -- 0:00:34
431500 -- (-686.529) (-684.523) (-682.976) [-681.623] * (-688.621) (-681.670) (-680.787) [-681.743] -- 0:00:34
432000 -- (-685.907) (-683.642) (-683.123) [-681.957] * (-685.325) [-682.074] (-680.810) (-688.114) -- 0:00:34
432500 -- (-682.981) [-686.724] (-682.849) (-684.654) * (-683.779) [-683.692] (-680.836) (-685.451) -- 0:00:34
433000 -- (-680.642) (-683.355) (-683.261) [-681.124] * (-684.026) [-681.659] (-682.359) (-687.441) -- 0:00:34
433500 -- (-680.798) (-684.445) (-680.065) [-680.844] * [-683.354] (-679.591) (-683.189) (-685.445) -- 0:00:33
434000 -- (-686.579) [-682.723] (-683.223) (-680.561) * (-680.792) (-680.771) (-687.389) [-683.814] -- 0:00:33
434500 -- (-680.925) (-680.793) (-682.340) [-683.917] * (-682.463) (-681.715) (-682.508) [-680.329] -- 0:00:33
435000 -- (-681.148) (-679.792) (-681.611) [-682.041] * (-682.266) [-680.301] (-680.996) (-682.486) -- 0:00:33
Average standard deviation of split frequencies: 0.011555
435500 -- (-680.549) (-682.781) [-683.885] (-680.559) * (-681.819) (-679.997) (-681.456) [-682.931] -- 0:00:33
436000 -- [-679.949] (-681.149) (-682.041) (-685.724) * (-681.305) (-679.842) [-683.638] (-681.878) -- 0:00:33
436500 -- (-681.017) (-681.869) (-681.438) [-681.120] * (-682.388) [-680.601] (-684.017) (-683.981) -- 0:00:33
437000 -- (-680.406) (-680.176) [-683.304] (-681.298) * [-681.720] (-682.408) (-682.499) (-679.798) -- 0:00:33
437500 -- [-680.685] (-680.158) (-681.908) (-684.913) * (-681.784) [-680.457] (-681.077) (-680.026) -- 0:00:33
438000 -- [-681.468] (-680.771) (-681.199) (-680.875) * (-680.719) (-680.266) (-682.468) [-681.330] -- 0:00:33
438500 -- [-681.596] (-681.998) (-683.036) (-681.642) * (-681.189) (-682.017) (-680.293) [-681.972] -- 0:00:33
439000 -- (-682.494) (-682.136) [-679.977] (-680.893) * [-683.591] (-680.215) (-683.958) (-680.419) -- 0:00:33
439500 -- (-680.769) [-679.810] (-682.562) (-684.733) * (-682.479) (-680.009) [-683.400] (-680.454) -- 0:00:33
440000 -- [-680.221] (-683.044) (-680.647) (-684.515) * (-683.391) [-679.540] (-681.250) (-682.446) -- 0:00:33
Average standard deviation of split frequencies: 0.012235
440500 -- (-681.670) [-681.774] (-683.328) (-680.313) * (-679.902) [-679.528] (-680.272) (-683.326) -- 0:00:33
441000 -- (-690.685) [-682.487] (-680.304) (-682.480) * (-682.198) (-680.451) (-680.807) [-681.122] -- 0:00:32
441500 -- (-682.775) (-688.734) [-682.191] (-682.428) * [-683.655] (-683.935) (-682.425) (-681.024) -- 0:00:34
442000 -- (-681.111) (-686.509) [-681.691] (-685.641) * [-682.123] (-681.096) (-684.334) (-681.343) -- 0:00:34
442500 -- (-682.476) (-680.531) (-682.128) [-681.528] * [-680.050] (-684.127) (-683.114) (-683.078) -- 0:00:34
443000 -- (-683.980) (-683.348) [-683.911] (-681.225) * [-679.824] (-682.442) (-683.438) (-680.867) -- 0:00:33
443500 -- [-683.718] (-680.457) (-682.675) (-680.481) * (-683.323) (-686.421) (-682.879) [-683.932] -- 0:00:33
444000 -- (-681.713) (-684.940) [-681.118] (-679.787) * [-680.357] (-681.300) (-681.733) (-681.200) -- 0:00:33
444500 -- (-685.720) (-682.986) (-681.962) [-680.366] * (-684.352) (-679.915) [-681.690] (-682.904) -- 0:00:33
445000 -- (-685.750) (-681.521) (-681.430) [-682.361] * [-682.796] (-679.863) (-686.505) (-682.563) -- 0:00:33
Average standard deviation of split frequencies: 0.012062
445500 -- (-685.348) (-680.752) [-681.255] (-681.567) * (-682.744) [-680.320] (-686.653) (-680.673) -- 0:00:33
446000 -- (-685.494) [-681.080] (-681.614) (-682.677) * [-681.805] (-681.446) (-684.777) (-680.254) -- 0:00:33
446500 -- (-681.834) (-683.342) [-685.153] (-680.422) * (-684.938) [-680.957] (-682.514) (-679.777) -- 0:00:33
447000 -- (-682.900) (-681.158) [-682.232] (-680.004) * [-683.389] (-682.579) (-679.896) (-680.752) -- 0:00:33
447500 -- (-685.534) (-682.692) (-681.427) [-680.997] * (-682.541) [-681.585] (-681.306) (-687.945) -- 0:00:33
448000 -- (-686.175) (-682.148) [-680.650] (-681.164) * (-683.013) (-680.606) [-680.059] (-680.950) -- 0:00:33
448500 -- (-680.758) [-684.359] (-680.387) (-681.205) * (-688.584) [-679.670] (-680.261) (-680.536) -- 0:00:33
449000 -- (-681.823) [-683.135] (-683.738) (-681.327) * (-681.900) (-682.790) [-682.754] (-682.516) -- 0:00:33
449500 -- [-680.935] (-685.877) (-682.352) (-684.461) * (-689.454) (-681.035) (-682.303) [-681.823] -- 0:00:33
450000 -- [-680.837] (-682.325) (-682.101) (-681.544) * (-682.622) [-684.969] (-679.624) (-685.920) -- 0:00:33
Average standard deviation of split frequencies: 0.011998
450500 -- (-680.050) (-681.234) (-680.644) [-683.549] * (-682.337) [-680.373] (-682.850) (-681.202) -- 0:00:32
451000 -- (-682.255) (-683.356) [-680.172] (-683.183) * (-683.415) (-681.619) [-684.224] (-682.738) -- 0:00:32
451500 -- (-680.622) [-681.697] (-680.259) (-682.774) * [-681.095] (-681.904) (-681.820) (-680.241) -- 0:00:32
452000 -- (-681.243) (-682.388) [-681.258] (-684.032) * (-682.896) (-683.117) (-681.246) [-682.972] -- 0:00:32
452500 -- (-682.015) [-684.755] (-679.560) (-691.857) * (-682.922) (-686.384) [-680.884] (-685.734) -- 0:00:32
453000 -- (-683.495) (-685.582) [-684.066] (-680.396) * [-681.785] (-682.832) (-683.463) (-681.347) -- 0:00:32
453500 -- [-681.434] (-681.034) (-685.423) (-682.283) * [-679.978] (-687.186) (-681.794) (-682.665) -- 0:00:32
454000 -- (-684.572) (-680.399) [-688.977] (-682.645) * (-684.395) (-680.003) (-682.532) [-680.553] -- 0:00:32
454500 -- (-683.659) (-681.258) [-681.792] (-681.674) * (-685.160) [-682.200] (-682.990) (-680.734) -- 0:00:32
455000 -- [-679.883] (-682.573) (-683.847) (-681.166) * (-687.640) (-682.456) (-683.467) [-680.855] -- 0:00:32
Average standard deviation of split frequencies: 0.011919
455500 -- (-682.335) (-686.496) (-684.826) [-680.412] * (-680.989) [-680.326] (-686.282) (-686.598) -- 0:00:32
456000 -- (-680.777) [-682.047] (-681.854) (-680.269) * [-681.782] (-683.065) (-681.454) (-681.008) -- 0:00:32
456500 -- (-683.109) (-686.813) (-680.496) [-681.052] * [-679.584] (-686.501) (-683.747) (-682.101) -- 0:00:32
457000 -- (-680.210) (-686.095) (-683.841) [-682.567] * [-680.494] (-682.538) (-681.582) (-682.184) -- 0:00:32
457500 -- (-681.158) [-682.102] (-680.343) (-680.322) * (-679.675) (-683.242) (-681.401) [-680.838] -- 0:00:32
458000 -- [-683.021] (-680.430) (-687.118) (-681.186) * [-681.050] (-680.702) (-680.291) (-683.210) -- 0:00:31
458500 -- (-685.492) (-681.238) [-684.180] (-682.256) * (-683.545) (-682.219) [-682.970] (-685.292) -- 0:00:33
459000 -- (-687.694) [-679.965] (-682.414) (-683.579) * (-683.946) (-684.687) (-681.649) [-682.998] -- 0:00:33
459500 -- (-682.384) (-681.170) [-681.719] (-680.054) * (-681.485) (-683.313) [-683.483] (-682.525) -- 0:00:32
460000 -- (-680.022) (-680.359) (-683.304) [-683.032] * (-682.130) (-681.077) (-681.343) [-682.100] -- 0:00:32
Average standard deviation of split frequencies: 0.010895
460500 -- (-680.820) (-681.875) (-680.459) [-682.174] * (-686.455) [-683.540] (-681.066) (-681.742) -- 0:00:32
461000 -- (-680.395) (-681.656) [-691.742] (-682.146) * (-681.292) (-684.677) [-680.929] (-682.934) -- 0:00:32
461500 -- [-681.945] (-682.272) (-683.875) (-685.980) * (-685.072) (-684.222) (-680.871) [-682.667] -- 0:00:32
462000 -- (-680.483) (-680.755) [-681.294] (-681.664) * (-680.856) [-680.229] (-680.047) (-683.569) -- 0:00:32
462500 -- (-681.392) (-679.635) [-682.049] (-681.833) * (-681.394) (-683.323) (-680.163) [-682.343] -- 0:00:32
463000 -- (-679.964) (-679.707) [-680.566] (-682.211) * (-679.860) (-681.682) [-684.392] (-681.928) -- 0:00:32
463500 -- (-680.840) (-680.719) [-681.298] (-685.256) * (-683.676) [-682.947] (-682.997) (-681.085) -- 0:00:32
464000 -- (-681.382) (-681.486) (-681.538) [-683.877] * (-682.893) (-683.016) (-683.384) [-682.702] -- 0:00:32
464500 -- (-679.963) [-679.917] (-680.685) (-684.966) * (-682.378) (-683.955) [-681.547] (-680.571) -- 0:00:32
465000 -- (-685.295) (-684.932) [-680.758] (-686.374) * [-681.583] (-684.247) (-681.004) (-681.788) -- 0:00:32
Average standard deviation of split frequencies: 0.010592
465500 -- (-681.618) (-688.564) [-680.863] (-682.560) * (-682.870) (-680.195) (-682.124) [-680.351] -- 0:00:32
466000 -- (-682.106) [-684.192] (-681.474) (-680.074) * (-680.433) (-685.353) [-681.830] (-684.124) -- 0:00:32
466500 -- [-682.601] (-680.437) (-682.242) (-679.959) * (-681.145) [-681.992] (-680.368) (-684.531) -- 0:00:32
467000 -- (-684.911) (-679.639) (-683.346) [-680.716] * [-681.172] (-682.104) (-680.709) (-684.290) -- 0:00:31
467500 -- (-682.904) [-679.893] (-683.516) (-680.166) * [-681.284] (-683.920) (-681.396) (-681.161) -- 0:00:31
468000 -- (-686.224) [-681.524] (-682.106) (-682.507) * (-683.513) (-686.026) [-681.894] (-681.430) -- 0:00:31
468500 -- [-679.970] (-684.146) (-682.710) (-681.817) * (-683.307) (-682.627) (-679.659) [-679.866] -- 0:00:31
469000 -- (-683.069) [-682.600] (-682.253) (-682.328) * [-680.782] (-683.504) (-681.101) (-679.794) -- 0:00:31
469500 -- (-681.185) [-681.780] (-688.461) (-682.029) * (-682.939) [-682.412] (-679.883) (-680.746) -- 0:00:31
470000 -- (-685.034) (-682.324) [-683.607] (-683.539) * [-681.737] (-681.521) (-683.433) (-682.085) -- 0:00:31
Average standard deviation of split frequencies: 0.010428
470500 -- (-682.162) (-680.990) (-681.979) [-683.625] * [-686.308] (-679.827) (-681.665) (-682.653) -- 0:00:31
471000 -- (-684.547) (-680.995) [-680.763] (-679.845) * [-683.764] (-680.732) (-682.030) (-681.345) -- 0:00:31
471500 -- (-680.041) (-682.645) [-681.029] (-683.090) * [-682.174] (-681.870) (-681.826) (-680.275) -- 0:00:31
472000 -- (-682.268) (-681.647) [-680.279] (-681.796) * (-681.210) (-681.169) (-682.330) [-683.045] -- 0:00:31
472500 -- (-681.260) [-682.730] (-681.029) (-686.735) * (-680.018) (-683.743) [-681.569] (-685.263) -- 0:00:31
473000 -- (-681.341) [-679.442] (-680.285) (-679.730) * [-680.788] (-684.256) (-683.132) (-688.566) -- 0:00:31
473500 -- [-680.961] (-686.948) (-681.573) (-681.028) * (-681.889) (-681.632) (-681.492) [-681.863] -- 0:00:31
474000 -- [-682.168] (-681.415) (-681.053) (-680.847) * (-683.033) (-681.173) (-690.508) [-682.454] -- 0:00:31
474500 -- [-684.913] (-683.509) (-682.007) (-681.669) * (-680.592) [-683.305] (-684.395) (-681.490) -- 0:00:31
475000 -- (-681.970) (-683.579) (-683.386) [-682.793] * (-683.586) (-681.937) (-684.212) [-685.481] -- 0:00:30
Average standard deviation of split frequencies: 0.010777
475500 -- (-680.349) (-680.920) [-682.639] (-681.324) * (-681.843) (-683.982) [-682.205] (-681.346) -- 0:00:31
476000 -- (-682.696) (-681.754) [-681.241] (-680.300) * (-681.343) (-684.703) [-683.466] (-680.867) -- 0:00:31
476500 -- (-683.104) [-683.823] (-680.727) (-680.422) * (-683.385) [-682.368] (-680.027) (-680.769) -- 0:00:31
477000 -- (-682.673) (-681.864) (-681.429) [-680.210] * (-681.263) (-680.966) (-687.235) [-680.239] -- 0:00:31
477500 -- [-681.827] (-680.001) (-681.031) (-682.308) * (-681.047) [-683.402] (-682.487) (-685.191) -- 0:00:31
478000 -- (-680.030) (-687.319) (-681.832) [-683.750] * (-679.951) (-682.239) (-685.648) [-681.641] -- 0:00:31
478500 -- (-680.420) [-679.968] (-687.143) (-685.437) * (-682.156) (-681.346) [-682.015] (-681.273) -- 0:00:31
479000 -- (-680.984) [-680.773] (-683.831) (-681.150) * (-683.199) (-681.794) (-685.362) [-684.578] -- 0:00:31
479500 -- (-682.239) (-682.010) (-681.778) [-682.850] * (-682.286) (-680.609) (-687.433) [-680.788] -- 0:00:31
480000 -- (-684.200) (-686.233) (-683.654) [-680.946] * (-682.428) [-680.880] (-683.342) (-679.663) -- 0:00:31
Average standard deviation of split frequencies: 0.010384
480500 -- (-681.996) [-682.468] (-685.911) (-679.564) * [-683.045] (-682.419) (-685.973) (-680.521) -- 0:00:31
481000 -- (-684.155) (-682.270) [-680.993] (-681.256) * [-680.882] (-682.745) (-680.726) (-682.669) -- 0:00:31
481500 -- (-682.655) (-685.841) (-681.377) [-679.714] * (-682.997) (-682.652) [-680.483] (-682.847) -- 0:00:31
482000 -- (-680.186) (-684.277) [-680.793] (-682.678) * (-684.123) [-680.912] (-681.004) (-683.823) -- 0:00:31
482500 -- (-682.153) (-682.624) [-681.588] (-681.569) * (-680.751) (-681.334) (-681.770) [-681.215] -- 0:00:31
483000 -- (-683.309) (-684.866) [-681.568] (-681.665) * [-681.447] (-684.989) (-684.013) (-685.189) -- 0:00:31
483500 -- (-681.266) (-681.452) (-684.034) [-683.792] * [-680.447] (-685.763) (-683.116) (-684.338) -- 0:00:30
484000 -- [-682.454] (-681.186) (-682.759) (-684.202) * (-680.879) (-680.318) (-681.764) [-683.183] -- 0:00:30
484500 -- (-680.959) [-680.207] (-682.363) (-683.438) * (-682.577) (-682.393) [-681.250] (-684.712) -- 0:00:30
485000 -- (-682.071) [-680.929] (-681.676) (-681.738) * [-681.082] (-682.994) (-682.010) (-683.611) -- 0:00:30
Average standard deviation of split frequencies: 0.011069
485500 -- (-683.116) [-680.178] (-682.830) (-680.739) * [-683.819] (-683.487) (-680.730) (-681.661) -- 0:00:30
486000 -- (-687.826) (-680.342) [-682.570] (-679.628) * (-680.961) [-686.586] (-681.622) (-684.099) -- 0:00:30
486500 -- (-682.914) (-680.213) (-685.269) [-680.513] * (-681.133) (-684.549) [-680.442] (-681.453) -- 0:00:30
487000 -- [-680.790] (-680.955) (-682.787) (-679.645) * (-683.940) [-684.165] (-680.512) (-681.650) -- 0:00:30
487500 -- (-681.186) (-682.760) (-685.219) [-682.274] * [-681.019] (-682.616) (-681.467) (-682.296) -- 0:00:30
488000 -- (-680.922) [-681.408] (-681.391) (-683.391) * (-682.192) [-685.354] (-683.090) (-684.128) -- 0:00:30
488500 -- (-681.013) [-681.458] (-680.113) (-680.243) * (-682.863) (-684.330) [-680.962] (-680.852) -- 0:00:30
489000 -- [-681.693] (-681.099) (-682.272) (-680.729) * (-687.353) (-681.164) [-683.914] (-681.801) -- 0:00:30
489500 -- [-681.832] (-681.269) (-682.647) (-680.856) * (-682.002) (-680.390) [-680.884] (-684.403) -- 0:00:30
490000 -- (-683.385) (-680.574) (-679.926) [-680.438] * (-680.140) [-680.528] (-680.304) (-682.047) -- 0:00:30
Average standard deviation of split frequencies: 0.010738
490500 -- (-682.325) (-682.120) [-681.332] (-682.221) * [-680.337] (-680.121) (-681.372) (-680.605) -- 0:00:30
491000 -- (-680.374) (-684.596) [-681.595] (-680.132) * (-688.611) [-680.891] (-680.911) (-681.055) -- 0:00:30
491500 -- [-680.280] (-682.179) (-681.852) (-680.156) * [-683.813] (-680.145) (-680.127) (-681.908) -- 0:00:30
492000 -- (-684.835) [-681.257] (-680.943) (-683.063) * (-682.704) (-682.298) [-681.422] (-680.341) -- 0:00:29
492500 -- (-685.041) [-683.406] (-680.958) (-682.897) * (-686.151) (-682.327) [-685.978] (-680.260) -- 0:00:30
493000 -- (-683.430) (-680.611) (-680.862) [-681.031] * [-683.468] (-683.457) (-680.795) (-682.920) -- 0:00:30
493500 -- [-684.036] (-680.139) (-685.850) (-680.471) * (-687.454) [-682.738] (-685.752) (-682.945) -- 0:00:30
494000 -- (-685.462) (-680.581) [-679.746] (-684.550) * (-684.375) (-680.202) [-681.029] (-682.126) -- 0:00:30
494500 -- (-682.915) [-682.548] (-681.572) (-682.836) * (-683.229) (-681.652) (-681.745) [-680.992] -- 0:00:30
495000 -- (-681.702) (-682.790) (-683.223) [-680.420] * (-685.956) (-685.570) (-679.757) [-681.636] -- 0:00:30
Average standard deviation of split frequencies: 0.010455
495500 -- [-680.749] (-683.250) (-679.926) (-680.721) * (-683.960) [-683.488] (-684.062) (-681.141) -- 0:00:30
496000 -- (-685.014) (-685.304) [-679.764] (-679.705) * (-683.080) [-681.562] (-683.445) (-680.385) -- 0:00:30
496500 -- (-685.656) (-686.518) (-684.375) [-679.824] * (-681.227) [-681.601] (-681.307) (-682.435) -- 0:00:30
497000 -- (-682.675) (-682.099) [-681.763] (-680.404) * [-681.373] (-682.251) (-680.311) (-681.745) -- 0:00:30
497500 -- (-683.048) (-683.283) (-680.651) [-681.521] * (-683.510) [-680.602] (-682.300) (-682.118) -- 0:00:30
498000 -- [-681.369] (-683.394) (-681.166) (-681.813) * (-682.691) (-680.460) [-680.036] (-681.966) -- 0:00:30
498500 -- (-682.932) (-682.575) [-682.244] (-683.499) * [-680.322] (-682.684) (-680.940) (-682.427) -- 0:00:30
499000 -- (-684.553) (-680.312) [-687.290] (-681.523) * (-679.817) (-682.328) [-682.389] (-683.274) -- 0:00:30
499500 -- (-681.771) (-681.736) [-681.501] (-681.076) * [-680.298] (-682.243) (-680.848) (-681.392) -- 0:00:30
500000 -- [-682.358] (-682.769) (-685.027) (-680.184) * [-680.024] (-683.573) (-680.199) (-679.733) -- 0:00:30
Average standard deviation of split frequencies: 0.010191
500500 -- (-682.957) (-679.794) (-683.470) [-680.312] * [-680.486] (-683.868) (-681.424) (-686.433) -- 0:00:29
501000 -- (-680.983) (-679.606) (-683.308) [-679.840] * (-681.338) (-681.401) [-683.061] (-687.876) -- 0:00:29
501500 -- [-680.336] (-680.939) (-686.778) (-680.765) * [-681.871] (-681.143) (-684.823) (-687.752) -- 0:00:29
502000 -- [-681.382] (-685.798) (-681.668) (-680.933) * (-682.563) (-680.124) (-684.608) [-682.795] -- 0:00:29
502500 -- (-684.117) (-680.084) (-681.220) [-680.133] * (-681.007) (-682.063) (-680.848) [-684.193] -- 0:00:29
503000 -- (-683.918) [-683.471] (-687.368) (-682.384) * [-681.317] (-682.737) (-680.028) (-680.710) -- 0:00:29
503500 -- [-679.688] (-687.932) (-682.603) (-682.009) * (-682.758) (-683.807) (-682.654) [-681.223] -- 0:00:29
504000 -- (-681.404) (-684.136) [-680.247] (-680.430) * (-682.118) (-687.684) [-683.065] (-682.018) -- 0:00:29
504500 -- (-681.652) (-684.330) (-680.700) [-680.285] * (-682.553) (-682.626) [-679.575] (-684.753) -- 0:00:29
505000 -- (-680.550) (-684.053) [-681.406] (-680.103) * (-684.749) (-682.650) [-681.470] (-681.376) -- 0:00:29
Average standard deviation of split frequencies: 0.010084
505500 -- (-683.440) [-680.778] (-684.363) (-681.692) * (-682.033) (-684.466) [-682.269] (-681.738) -- 0:00:29
506000 -- (-682.672) (-685.263) [-682.892] (-681.015) * (-682.895) [-685.641] (-680.991) (-682.774) -- 0:00:29
506500 -- [-681.756] (-681.591) (-680.942) (-681.998) * (-684.507) [-681.372] (-684.313) (-684.259) -- 0:00:29
507000 -- (-681.248) (-682.577) [-682.336] (-683.769) * (-686.250) [-682.076] (-680.849) (-686.928) -- 0:00:29
507500 -- (-681.426) (-681.038) (-681.708) [-682.491] * (-680.813) [-682.401] (-680.768) (-682.844) -- 0:00:29
508000 -- (-680.339) [-682.212] (-680.876) (-684.235) * (-682.511) (-680.905) [-681.303] (-682.006) -- 0:00:29
508500 -- (-680.123) (-683.421) [-680.226] (-680.851) * (-684.416) (-680.133) (-681.420) [-680.789] -- 0:00:28
509000 -- [-680.011] (-684.526) (-682.371) (-681.075) * (-681.151) (-682.009) (-688.207) [-680.730] -- 0:00:28
509500 -- [-684.509] (-681.796) (-682.559) (-682.831) * [-683.292] (-682.296) (-682.601) (-680.680) -- 0:00:29
510000 -- (-682.137) (-682.833) (-681.597) [-681.500] * (-681.416) (-682.027) [-680.160] (-681.363) -- 0:00:29
Average standard deviation of split frequencies: 0.010643
510500 -- [-681.278] (-681.520) (-686.211) (-683.685) * (-682.482) [-680.730] (-679.852) (-681.116) -- 0:00:29
511000 -- (-685.591) [-679.814] (-684.651) (-683.481) * (-682.056) (-684.158) [-680.071] (-682.057) -- 0:00:29
511500 -- (-686.245) (-679.855) (-688.123) [-685.048] * (-683.832) (-683.480) [-684.406] (-682.603) -- 0:00:29
512000 -- [-682.364] (-680.895) (-681.580) (-680.320) * [-683.992] (-684.593) (-685.299) (-684.860) -- 0:00:29
512500 -- [-682.314] (-681.844) (-682.587) (-682.602) * [-683.571] (-679.671) (-682.422) (-681.966) -- 0:00:29
513000 -- [-681.638] (-684.850) (-680.567) (-682.963) * (-683.289) (-684.788) (-681.141) [-682.107] -- 0:00:29
513500 -- (-683.202) (-682.770) [-684.069] (-682.703) * (-683.125) (-680.882) (-684.773) [-682.564] -- 0:00:29
514000 -- [-682.054] (-683.908) (-679.837) (-679.439) * (-682.832) (-681.134) (-681.451) [-682.646] -- 0:00:29
514500 -- (-682.814) (-682.745) [-680.085] (-680.591) * (-682.480) (-683.558) [-681.661] (-682.037) -- 0:00:29
515000 -- [-681.813] (-682.489) (-681.736) (-680.202) * (-680.914) (-684.905) (-683.654) [-681.517] -- 0:00:29
Average standard deviation of split frequencies: 0.010278
515500 -- (-686.205) [-682.211] (-680.618) (-684.773) * [-680.486] (-681.578) (-683.732) (-687.998) -- 0:00:29
516000 -- (-682.631) [-680.834] (-682.630) (-682.709) * (-680.486) (-682.704) (-681.769) [-680.989] -- 0:00:29
516500 -- (-680.283) (-680.433) [-682.645] (-683.038) * (-683.213) (-681.128) [-682.540] (-681.889) -- 0:00:29
517000 -- (-682.272) (-680.364) (-685.021) [-681.387] * (-682.763) (-685.611) (-683.473) [-680.238] -- 0:00:28
517500 -- (-681.508) (-679.840) (-681.571) [-681.228] * (-681.144) (-681.039) [-682.530] (-680.255) -- 0:00:28
518000 -- (-689.886) (-683.062) [-683.829] (-682.631) * (-687.947) (-680.102) [-681.169] (-680.417) -- 0:00:28
518500 -- (-685.900) (-681.855) (-682.851) [-680.862] * (-681.931) [-681.288] (-681.190) (-681.010) -- 0:00:28
519000 -- (-682.602) (-681.533) (-683.702) [-683.123] * (-682.240) (-682.390) (-682.050) [-682.628] -- 0:00:28
519500 -- [-680.703] (-681.887) (-683.265) (-682.123) * (-681.872) (-684.173) [-680.795] (-685.339) -- 0:00:28
520000 -- [-679.791] (-681.911) (-680.570) (-682.854) * [-686.040] (-684.254) (-682.495) (-685.434) -- 0:00:28
Average standard deviation of split frequencies: 0.010758
520500 -- (-679.571) (-682.556) [-682.865] (-684.161) * (-682.469) (-685.217) (-684.791) [-682.580] -- 0:00:28
521000 -- (-688.435) [-680.677] (-680.914) (-680.573) * (-681.273) (-681.310) (-681.848) [-680.754] -- 0:00:28
521500 -- [-685.617] (-681.768) (-681.652) (-684.232) * (-681.839) [-683.740] (-684.632) (-684.850) -- 0:00:28
522000 -- (-682.146) (-681.682) (-684.623) [-685.631] * [-683.115] (-685.452) (-680.395) (-682.527) -- 0:00:28
522500 -- (-685.511) [-684.966] (-683.104) (-682.540) * (-679.769) (-685.248) (-680.395) [-680.827] -- 0:00:28
523000 -- [-679.917] (-684.291) (-684.102) (-686.321) * (-681.382) (-682.768) (-681.486) [-680.920] -- 0:00:28
523500 -- (-681.498) [-680.833] (-683.572) (-681.038) * (-682.394) (-681.445) (-681.134) [-681.751] -- 0:00:28
524000 -- (-680.938) (-683.380) [-682.321] (-681.090) * (-681.139) (-681.889) [-680.882] (-680.105) -- 0:00:28
524500 -- (-681.300) (-685.146) [-683.742] (-681.388) * (-680.088) [-683.338] (-681.617) (-681.763) -- 0:00:28
525000 -- (-680.196) (-684.021) [-685.151] (-680.220) * (-682.436) (-680.698) [-680.441] (-681.964) -- 0:00:28
Average standard deviation of split frequencies: 0.010544
525500 -- (-680.657) (-685.632) (-681.742) [-681.559] * (-682.361) (-680.668) [-679.388] (-681.088) -- 0:00:27
526000 -- (-680.987) (-681.743) [-681.858] (-680.282) * (-682.343) (-680.306) [-681.232] (-681.552) -- 0:00:28
526500 -- (-682.109) (-681.210) [-683.395] (-680.619) * (-683.424) (-685.807) (-681.291) [-682.141] -- 0:00:28
527000 -- (-682.320) (-680.724) (-682.890) [-683.309] * (-680.376) [-682.265] (-683.444) (-680.811) -- 0:00:28
527500 -- (-681.667) [-680.744] (-683.439) (-680.597) * [-679.782] (-682.517) (-682.916) (-682.254) -- 0:00:28
528000 -- [-681.869] (-683.195) (-683.625) (-680.980) * (-679.961) (-683.388) (-680.662) [-684.846] -- 0:00:28
528500 -- [-683.501] (-681.874) (-687.535) (-682.888) * (-679.819) (-680.889) (-680.911) [-682.859] -- 0:00:28
529000 -- (-681.787) [-679.922] (-682.851) (-680.059) * [-680.182] (-680.364) (-681.684) (-682.566) -- 0:00:28
529500 -- [-683.485] (-682.100) (-685.265) (-680.069) * [-685.608] (-683.021) (-683.388) (-681.479) -- 0:00:28
530000 -- [-681.553] (-681.041) (-682.072) (-680.181) * (-684.043) [-680.993] (-683.935) (-682.834) -- 0:00:28
Average standard deviation of split frequencies: 0.009883
530500 -- (-683.203) (-680.892) (-682.518) [-680.626] * (-680.747) (-681.435) (-683.017) [-680.084] -- 0:00:28
531000 -- (-682.175) [-681.144] (-681.223) (-681.442) * [-680.650] (-680.577) (-682.754) (-680.030) -- 0:00:28
531500 -- [-680.789] (-682.925) (-683.830) (-681.723) * (-681.628) (-682.162) (-679.837) [-679.878] -- 0:00:28
532000 -- (-683.929) (-680.947) [-680.968] (-680.405) * (-680.391) [-679.947] (-680.433) (-682.640) -- 0:00:28
532500 -- [-681.912] (-679.609) (-683.510) (-693.796) * (-682.503) [-680.734] (-680.243) (-682.189) -- 0:00:28
533000 -- [-680.717] (-679.920) (-684.513) (-682.890) * (-681.777) [-680.361] (-680.859) (-682.310) -- 0:00:28
533500 -- (-680.339) [-680.294] (-684.072) (-682.206) * (-682.171) (-679.883) [-682.795] (-680.090) -- 0:00:27
534000 -- (-681.150) (-681.046) (-685.506) [-680.891] * (-684.412) (-680.737) [-680.694] (-681.307) -- 0:00:27
534500 -- (-686.901) [-680.779] (-685.506) (-680.220) * [-681.627] (-681.458) (-681.074) (-682.500) -- 0:00:27
535000 -- [-679.862] (-680.330) (-681.376) (-683.985) * (-681.551) [-679.852] (-681.853) (-681.173) -- 0:00:27
Average standard deviation of split frequencies: 0.009345
535500 -- (-679.928) (-682.913) [-681.349] (-682.183) * (-683.843) (-684.036) [-680.463] (-682.969) -- 0:00:27
536000 -- (-682.213) (-681.136) (-681.991) [-680.721] * (-681.402) (-683.661) (-679.884) [-680.854] -- 0:00:27
536500 -- (-680.902) (-680.515) [-681.005] (-680.358) * (-683.670) (-680.019) (-684.829) [-683.428] -- 0:00:27
537000 -- (-683.045) (-682.728) (-680.802) [-680.571] * (-681.281) (-681.249) [-680.394] (-681.922) -- 0:00:27
537500 -- (-682.488) (-681.593) [-682.978] (-680.596) * (-680.999) (-683.059) [-681.113] (-682.932) -- 0:00:27
538000 -- [-681.981] (-682.837) (-683.347) (-681.994) * (-682.522) (-688.672) [-685.657] (-683.889) -- 0:00:27
538500 -- [-680.431] (-683.541) (-681.461) (-684.308) * [-681.774] (-685.401) (-684.550) (-683.421) -- 0:00:27
539000 -- (-680.580) (-681.222) [-684.440] (-683.620) * (-683.690) (-687.250) (-685.225) [-683.137] -- 0:00:27
539500 -- (-682.189) (-682.147) (-680.041) [-680.609] * [-684.044] (-686.184) (-682.657) (-681.137) -- 0:00:27
540000 -- [-680.117] (-684.906) (-681.575) (-679.663) * (-686.979) (-680.770) [-682.442] (-681.887) -- 0:00:27
Average standard deviation of split frequencies: 0.009536
540500 -- [-682.974] (-682.973) (-682.851) (-681.453) * [-683.315] (-683.779) (-684.090) (-683.045) -- 0:00:27
541000 -- (-682.230) (-685.829) [-680.725] (-679.920) * (-685.632) (-683.331) (-680.400) [-684.295] -- 0:00:27
541500 -- (-681.753) (-682.328) (-681.807) [-680.165] * (-684.484) (-682.868) [-681.467] (-682.541) -- 0:00:27
542000 -- (-683.398) (-680.595) (-682.983) [-680.315] * (-682.265) (-681.489) [-680.560] (-681.360) -- 0:00:27
542500 -- (-683.466) [-680.991] (-684.877) (-684.695) * (-682.496) (-679.642) [-683.959] (-681.767) -- 0:00:26
543000 -- [-687.506] (-682.523) (-685.105) (-681.515) * [-682.120] (-682.884) (-683.173) (-680.131) -- 0:00:27
543500 -- [-681.006] (-683.309) (-680.615) (-685.105) * (-681.914) [-683.295] (-682.611) (-679.543) -- 0:00:27
544000 -- (-681.117) [-680.913] (-681.581) (-680.916) * [-680.504] (-682.556) (-681.948) (-682.513) -- 0:00:27
544500 -- (-683.225) [-687.013] (-679.844) (-683.167) * (-680.354) [-682.530] (-680.589) (-681.601) -- 0:00:27
545000 -- [-681.991] (-682.302) (-683.616) (-680.402) * (-680.442) (-680.058) [-681.904] (-684.802) -- 0:00:27
Average standard deviation of split frequencies: 0.009443
545500 -- [-684.075] (-681.891) (-683.269) (-680.404) * [-680.072] (-681.407) (-682.007) (-682.101) -- 0:00:27
546000 -- (-683.245) (-682.749) (-682.250) [-681.401] * (-682.292) (-681.360) (-680.359) [-684.440] -- 0:00:27
546500 -- [-680.696] (-679.508) (-680.695) (-681.955) * [-681.206] (-681.791) (-681.135) (-684.078) -- 0:00:27
547000 -- (-680.633) (-682.216) (-681.002) [-681.559] * (-680.659) [-680.464] (-680.795) (-681.546) -- 0:00:27
547500 -- (-680.046) (-680.279) (-680.682) [-680.180] * (-684.362) (-682.434) (-682.860) [-683.422] -- 0:00:27
548000 -- (-681.612) [-680.664] (-680.860) (-679.994) * (-682.784) (-684.208) [-680.611] (-680.872) -- 0:00:27
548500 -- (-684.379) [-682.949] (-680.374) (-682.885) * (-679.843) (-682.017) (-682.879) [-681.516] -- 0:00:27
549000 -- (-681.701) (-682.758) (-679.585) [-682.512] * [-681.463] (-684.304) (-681.416) (-681.885) -- 0:00:27
549500 -- (-680.821) [-681.937] (-679.830) (-680.546) * [-680.801] (-683.081) (-682.419) (-680.304) -- 0:00:27
550000 -- [-681.249] (-679.984) (-681.618) (-682.181) * (-680.773) (-680.037) [-681.179] (-681.040) -- 0:00:27
Average standard deviation of split frequencies: 0.009096
550500 -- [-684.075] (-679.884) (-686.496) (-682.960) * (-683.623) [-680.358] (-682.185) (-680.810) -- 0:00:26
551000 -- (-685.908) (-680.712) (-681.544) [-683.132] * [-680.813] (-681.406) (-683.981) (-681.158) -- 0:00:26
551500 -- [-682.504] (-682.055) (-681.569) (-680.483) * [-680.472] (-681.875) (-679.758) (-681.094) -- 0:00:26
552000 -- [-683.212] (-681.928) (-683.378) (-683.499) * (-679.970) (-685.720) (-680.570) [-680.606] -- 0:00:26
552500 -- (-681.470) [-682.255] (-681.542) (-682.440) * (-681.495) (-682.471) (-681.387) [-681.956] -- 0:00:26
553000 -- (-682.396) (-680.846) (-680.126) [-683.352] * (-683.537) (-683.339) [-682.154] (-681.789) -- 0:00:26
553500 -- (-681.297) (-683.670) (-680.100) [-683.877] * [-680.888] (-687.465) (-681.080) (-683.451) -- 0:00:26
554000 -- (-680.281) (-685.966) (-683.942) [-680.204] * (-681.172) (-681.322) [-680.399] (-684.597) -- 0:00:26
554500 -- (-680.684) (-685.120) [-680.832] (-685.921) * (-681.178) [-680.914] (-679.704) (-682.690) -- 0:00:26
555000 -- (-680.456) (-683.184) (-682.874) [-683.888] * (-680.712) (-685.236) [-682.317] (-679.898) -- 0:00:26
Average standard deviation of split frequencies: 0.009825
555500 -- [-680.456] (-681.160) (-682.575) (-681.458) * (-683.795) [-681.504] (-680.510) (-681.433) -- 0:00:26
556000 -- (-680.468) (-681.701) [-681.366] (-681.643) * [-680.946] (-681.024) (-682.660) (-682.594) -- 0:00:26
556500 -- [-683.446] (-682.228) (-681.723) (-682.212) * (-684.794) [-679.844] (-681.562) (-682.148) -- 0:00:26
557000 -- (-681.181) (-682.115) (-680.611) [-681.277] * [-680.960] (-681.470) (-682.072) (-682.161) -- 0:00:26
557500 -- (-681.382) (-681.916) [-681.047] (-681.079) * (-680.948) (-680.966) (-680.549) [-682.924] -- 0:00:26
558000 -- (-681.374) (-683.698) [-680.136] (-683.897) * (-685.325) (-679.542) [-681.754] (-681.562) -- 0:00:26
558500 -- (-679.908) [-686.666] (-680.252) (-682.861) * (-683.290) (-682.398) (-680.738) [-680.056] -- 0:00:26
559000 -- (-680.936) [-681.141] (-680.829) (-683.718) * [-681.176] (-681.661) (-682.211) (-681.432) -- 0:00:26
559500 -- [-680.768] (-681.586) (-681.347) (-682.096) * [-681.178] (-680.345) (-680.504) (-681.265) -- 0:00:25
560000 -- (-679.686) [-681.196] (-680.892) (-685.375) * (-682.332) (-681.317) [-680.248] (-681.804) -- 0:00:26
Average standard deviation of split frequencies: 0.009196
560500 -- (-682.108) (-685.640) (-680.755) [-683.261] * [-687.675] (-682.471) (-679.699) (-683.626) -- 0:00:26
561000 -- [-684.755] (-682.979) (-687.557) (-687.590) * (-682.955) [-680.403] (-682.332) (-685.962) -- 0:00:26
561500 -- [-682.246] (-684.024) (-682.726) (-686.573) * (-682.425) [-679.914] (-680.177) (-683.916) -- 0:00:26
562000 -- [-681.249] (-683.896) (-681.323) (-683.679) * (-681.600) [-680.055] (-681.829) (-683.949) -- 0:00:26
562500 -- (-682.862) (-688.792) [-680.528] (-679.970) * [-682.421] (-684.698) (-682.109) (-683.122) -- 0:00:26
563000 -- [-680.236] (-689.669) (-681.938) (-680.523) * (-681.103) (-685.073) (-680.349) [-681.761] -- 0:00:26
563500 -- [-680.012] (-683.643) (-681.663) (-680.654) * (-681.442) (-684.934) (-682.070) [-679.923] -- 0:00:26
564000 -- [-681.202] (-680.190) (-680.862) (-681.848) * (-681.129) (-684.548) (-687.129) [-680.467] -- 0:00:26
564500 -- (-682.169) (-685.183) (-684.842) [-686.246] * (-682.651) (-685.089) [-683.391] (-681.879) -- 0:00:26
565000 -- [-681.459] (-681.790) (-682.441) (-681.228) * (-681.745) [-680.368] (-681.184) (-683.420) -- 0:00:26
Average standard deviation of split frequencies: 0.009266
565500 -- [-680.964] (-681.846) (-681.238) (-682.396) * (-681.644) [-679.658] (-685.879) (-686.730) -- 0:00:26
566000 -- (-681.400) [-684.064] (-681.237) (-680.794) * [-679.597] (-681.162) (-681.152) (-681.256) -- 0:00:26
566500 -- [-680.428] (-683.115) (-681.079) (-681.029) * (-679.508) (-683.202) (-683.107) [-682.550] -- 0:00:26
567000 -- (-679.711) [-680.857] (-682.654) (-684.560) * [-680.531] (-686.735) (-681.677) (-682.042) -- 0:00:25
567500 -- (-680.573) (-680.995) [-681.914] (-685.602) * [-681.845] (-684.162) (-679.977) (-681.302) -- 0:00:25
568000 -- (-682.947) (-681.493) (-685.042) [-682.247] * (-682.949) (-680.069) (-680.794) [-682.983] -- 0:00:25
568500 -- (-681.856) (-680.243) (-682.339) [-683.497] * [-679.754] (-680.410) (-682.912) (-681.586) -- 0:00:25
569000 -- (-682.402) (-681.840) (-680.796) [-682.021] * (-681.468) (-680.639) [-680.259] (-682.721) -- 0:00:25
569500 -- (-680.908) (-683.953) [-681.464] (-681.337) * (-681.635) [-683.848] (-681.801) (-683.507) -- 0:00:25
570000 -- (-685.574) [-682.117] (-681.455) (-681.686) * (-680.988) (-680.536) [-682.095] (-685.338) -- 0:00:25
Average standard deviation of split frequencies: 0.009551
570500 -- (-681.434) (-681.719) [-680.864] (-682.296) * (-681.036) (-680.653) (-682.210) [-680.936] -- 0:00:25
571000 -- (-684.262) [-679.667] (-679.502) (-681.493) * [-682.458] (-680.895) (-680.456) (-680.584) -- 0:00:25
571500 -- (-682.266) (-683.363) [-681.117] (-680.458) * (-680.580) (-683.037) [-683.282] (-683.181) -- 0:00:25
572000 -- [-679.977] (-681.065) (-682.154) (-679.693) * [-679.999] (-682.558) (-682.007) (-679.475) -- 0:00:25
572500 -- (-681.166) (-683.869) [-680.721] (-680.790) * [-683.805] (-681.114) (-683.384) (-682.479) -- 0:00:25
573000 -- (-679.913) (-680.610) (-687.654) [-680.514] * (-679.978) [-680.911] (-682.215) (-684.813) -- 0:00:25
573500 -- [-681.958] (-681.937) (-682.186) (-680.547) * [-680.219] (-680.828) (-681.925) (-692.362) -- 0:00:25
574000 -- [-681.046] (-679.789) (-683.427) (-680.706) * [-680.227] (-684.730) (-681.954) (-693.940) -- 0:00:25
574500 -- [-682.460] (-680.258) (-680.288) (-684.481) * (-684.939) (-687.765) [-680.555] (-681.585) -- 0:00:25
575000 -- (-682.314) [-679.658] (-680.691) (-680.967) * (-688.726) (-687.629) (-683.880) [-681.816] -- 0:00:25
Average standard deviation of split frequencies: 0.009821
575500 -- (-683.464) (-680.594) (-684.160) [-680.806] * [-684.498] (-689.458) (-686.286) (-682.164) -- 0:00:25
576000 -- (-680.642) (-681.507) (-683.738) [-682.765] * (-682.005) (-681.148) (-681.601) [-685.587] -- 0:00:25
576500 -- [-681.037] (-679.979) (-683.443) (-689.245) * (-680.282) (-682.841) [-681.736] (-682.830) -- 0:00:24
577000 -- (-680.365) (-679.675) (-682.111) [-681.624] * (-679.421) (-683.967) [-679.579] (-683.919) -- 0:00:25
577500 -- [-679.992] (-682.100) (-684.347) (-682.309) * (-683.353) (-684.806) (-682.813) [-683.548] -- 0:00:25
578000 -- (-685.657) (-683.122) [-680.776] (-681.909) * (-682.702) [-681.294] (-682.627) (-682.233) -- 0:00:25
578500 -- [-680.574] (-681.393) (-681.732) (-682.666) * [-680.068] (-682.289) (-682.734) (-681.274) -- 0:00:25
579000 -- (-680.299) (-680.900) [-680.204] (-681.989) * (-682.591) [-683.037] (-688.980) (-680.905) -- 0:00:25
579500 -- (-680.825) (-679.674) (-680.349) [-685.473] * [-681.883] (-684.084) (-682.310) (-681.237) -- 0:00:25
580000 -- (-682.176) [-680.052] (-682.685) (-682.116) * (-681.220) (-683.457) [-683.246] (-681.370) -- 0:00:25
Average standard deviation of split frequencies: 0.009945
580500 -- (-683.388) [-682.718] (-681.837) (-681.560) * (-682.175) [-680.595] (-684.062) (-682.903) -- 0:00:25
581000 -- (-681.308) [-682.606] (-681.909) (-682.029) * (-681.172) [-683.153] (-684.542) (-686.352) -- 0:00:25
581500 -- [-679.894] (-679.577) (-680.782) (-688.337) * [-682.819] (-682.914) (-684.321) (-680.558) -- 0:00:25
582000 -- (-683.543) (-683.891) (-682.339) [-683.301] * [-681.045] (-681.028) (-688.060) (-682.858) -- 0:00:25
582500 -- (-682.055) [-681.574] (-680.434) (-681.125) * [-681.761] (-682.756) (-679.608) (-679.785) -- 0:00:25
583000 -- (-683.122) (-681.075) (-680.408) [-682.869] * [-683.444] (-681.511) (-680.513) (-680.503) -- 0:00:25
583500 -- [-682.496] (-682.748) (-681.667) (-681.339) * (-680.990) (-679.756) [-679.846] (-681.635) -- 0:00:24
584000 -- [-681.846] (-681.478) (-681.895) (-681.281) * (-681.338) (-682.529) (-679.934) [-682.870] -- 0:00:24
584500 -- (-687.695) (-681.324) [-681.306] (-680.610) * [-679.841] (-681.536) (-681.458) (-681.224) -- 0:00:24
585000 -- (-681.001) [-682.825] (-681.123) (-680.896) * (-684.573) [-681.579] (-686.028) (-681.816) -- 0:00:24
Average standard deviation of split frequencies: 0.009843
585500 -- (-681.806) [-686.414] (-681.141) (-682.658) * [-680.525] (-680.043) (-682.458) (-679.820) -- 0:00:24
586000 -- (-687.042) [-680.618] (-682.984) (-686.449) * (-686.183) (-680.285) (-681.174) [-682.224] -- 0:00:24
586500 -- (-683.900) [-682.619] (-685.064) (-681.995) * (-685.596) [-681.265] (-682.670) (-681.700) -- 0:00:24
587000 -- (-684.146) (-681.906) (-679.943) [-682.116] * (-687.841) (-680.973) (-679.839) [-681.725] -- 0:00:24
587500 -- (-684.476) (-679.989) [-681.435] (-682.190) * [-681.906] (-680.995) (-679.813) (-681.747) -- 0:00:24
588000 -- (-680.461) [-682.601] (-680.370) (-681.780) * (-681.309) [-681.695] (-684.674) (-680.571) -- 0:00:24
588500 -- (-681.442) [-681.110] (-681.427) (-681.218) * (-682.709) [-681.569] (-683.573) (-680.142) -- 0:00:24
589000 -- [-684.540] (-681.885) (-684.406) (-681.427) * (-682.290) (-685.569) (-683.045) [-683.430] -- 0:00:24
589500 -- (-683.711) (-680.570) [-681.778] (-683.406) * (-682.630) (-683.047) [-681.326] (-683.755) -- 0:00:24
590000 -- [-684.141] (-680.158) (-682.177) (-683.280) * (-683.130) (-682.484) [-680.440] (-684.029) -- 0:00:24
Average standard deviation of split frequencies: 0.009976
590500 -- (-684.142) (-682.282) [-681.335] (-682.697) * (-682.504) (-684.013) [-682.657] (-681.528) -- 0:00:24
591000 -- [-682.213] (-683.532) (-685.302) (-681.002) * (-681.858) (-683.169) [-683.245] (-682.990) -- 0:00:24
591500 -- [-681.305] (-681.933) (-685.417) (-680.921) * (-681.428) (-683.875) [-680.549] (-681.943) -- 0:00:24
592000 -- [-682.233] (-681.996) (-684.781) (-680.378) * (-680.124) (-683.215) [-681.889] (-683.782) -- 0:00:24
592500 -- (-680.830) (-680.772) (-686.608) [-680.531] * (-681.360) (-680.957) [-681.989] (-681.431) -- 0:00:24
593000 -- [-682.825] (-681.799) (-681.701) (-684.261) * [-683.016] (-680.877) (-680.615) (-680.855) -- 0:00:24
593500 -- (-681.758) (-683.479) [-682.400] (-684.842) * (-680.718) [-680.131] (-680.192) (-680.559) -- 0:00:23
594000 -- (-680.995) (-680.205) (-682.004) [-685.174] * (-683.742) (-682.681) [-682.982] (-682.030) -- 0:00:24
594500 -- (-681.247) (-680.202) (-684.990) [-683.563] * (-683.433) (-681.680) (-682.887) [-680.746] -- 0:00:24
595000 -- (-684.219) (-680.938) (-681.958) [-680.485] * [-684.410] (-684.916) (-680.933) (-680.844) -- 0:00:24
Average standard deviation of split frequencies: 0.009837
595500 -- (-688.327) [-679.964] (-683.417) (-682.424) * (-683.387) (-685.251) (-681.782) [-680.026] -- 0:00:24
596000 -- (-681.653) (-683.010) (-681.095) [-681.314] * (-682.268) (-685.960) [-683.783] (-681.149) -- 0:00:24
596500 -- (-682.459) [-680.795] (-681.877) (-681.270) * (-679.835) (-681.501) (-682.170) [-681.251] -- 0:00:24
597000 -- [-681.357] (-679.417) (-682.064) (-680.592) * (-681.787) (-679.949) [-682.989] (-681.814) -- 0:00:24
597500 -- (-680.741) (-684.002) (-683.117) [-681.538] * (-682.760) (-680.379) [-683.242] (-683.424) -- 0:00:24
598000 -- (-681.459) (-684.168) (-682.441) [-681.614] * (-682.793) (-685.979) (-685.357) [-680.707] -- 0:00:24
598500 -- (-680.549) (-680.317) [-681.995] (-680.197) * (-681.733) (-681.947) (-682.235) [-679.712] -- 0:00:24
599000 -- (-684.166) [-680.336] (-681.091) (-681.409) * (-684.068) (-681.651) [-681.510] (-679.943) -- 0:00:24
599500 -- (-681.139) [-681.436] (-684.485) (-680.139) * (-683.474) (-680.608) (-680.982) [-680.967] -- 0:00:24
600000 -- (-680.759) [-682.732] (-681.394) (-680.216) * (-680.386) (-681.741) (-683.096) [-682.958] -- 0:00:24
Average standard deviation of split frequencies: 0.009320
600500 -- (-680.760) (-683.042) [-682.846] (-680.718) * (-686.286) [-679.772] (-680.270) (-686.426) -- 0:00:23
601000 -- (-681.339) (-682.322) (-680.207) [-681.137] * [-681.291] (-680.554) (-681.384) (-682.609) -- 0:00:23
601500 -- (-680.216) (-682.308) [-681.695] (-691.743) * [-685.325] (-683.536) (-680.038) (-681.522) -- 0:00:23
602000 -- (-684.586) (-683.037) [-683.552] (-692.710) * [-686.920] (-681.566) (-681.813) (-681.854) -- 0:00:23
602500 -- [-681.185] (-682.972) (-682.060) (-688.256) * (-680.526) [-680.940] (-681.287) (-683.131) -- 0:00:23
603000 -- (-684.629) (-681.747) [-680.977] (-683.549) * [-681.816] (-685.513) (-682.169) (-682.336) -- 0:00:23
603500 -- (-681.209) (-681.290) (-685.694) [-681.735] * [-682.458] (-681.570) (-682.736) (-683.657) -- 0:00:23
604000 -- (-687.435) (-686.698) [-680.230] (-681.132) * (-683.852) (-680.934) (-683.447) [-684.872] -- 0:00:23
604500 -- (-682.870) (-680.725) [-680.059] (-681.418) * (-680.763) [-684.563] (-682.901) (-683.525) -- 0:00:23
605000 -- [-681.393] (-683.232) (-681.488) (-680.211) * [-682.495] (-680.763) (-682.963) (-682.350) -- 0:00:23
Average standard deviation of split frequencies: 0.009092
605500 -- (-684.912) (-686.983) (-680.458) [-680.696] * [-680.957] (-683.252) (-681.438) (-685.414) -- 0:00:23
606000 -- (-683.447) (-685.384) (-680.929) [-683.258] * (-681.385) [-681.658] (-682.714) (-682.945) -- 0:00:23
606500 -- (-682.138) [-679.677] (-681.346) (-682.788) * (-679.816) (-687.098) [-681.887] (-681.039) -- 0:00:23
607000 -- [-680.564] (-684.683) (-685.479) (-684.942) * (-680.675) (-681.285) [-680.416] (-681.298) -- 0:00:23
607500 -- (-685.679) (-681.113) [-680.682] (-681.619) * (-679.996) (-680.720) [-680.150] (-684.472) -- 0:00:23
608000 -- (-682.584) (-680.840) [-680.276] (-680.168) * [-680.004] (-680.672) (-681.138) (-683.345) -- 0:00:23
608500 -- (-681.805) (-680.401) [-682.845] (-684.371) * (-682.622) (-683.189) [-680.898] (-680.775) -- 0:00:23
609000 -- (-685.518) (-683.784) (-685.343) [-686.529] * (-680.507) [-682.809] (-680.921) (-683.774) -- 0:00:23
609500 -- (-682.406) (-680.389) (-683.355) [-684.427] * (-682.808) [-682.078] (-685.810) (-687.185) -- 0:00:23
610000 -- [-681.819] (-681.472) (-682.247) (-681.954) * (-685.839) (-681.654) [-681.456] (-687.033) -- 0:00:23
Average standard deviation of split frequencies: 0.009456
610500 -- (-681.074) (-680.978) [-685.114] (-681.638) * (-681.114) [-681.350] (-681.553) (-680.670) -- 0:00:23
611000 -- (-681.178) (-682.393) (-681.769) [-681.651] * (-680.756) (-682.722) (-685.498) [-680.689] -- 0:00:23
611500 -- (-680.778) (-680.156) (-680.261) [-683.482] * (-680.265) [-680.724] (-681.277) (-680.592) -- 0:00:23
612000 -- (-683.664) (-679.863) [-680.175] (-680.539) * (-684.860) (-682.242) [-682.598] (-680.074) -- 0:00:23
612500 -- (-683.322) (-679.910) [-680.056] (-681.255) * (-688.319) (-684.282) (-682.866) [-680.344] -- 0:00:23
613000 -- (-683.217) [-681.986] (-682.884) (-681.546) * (-689.174) (-682.021) [-680.269] (-681.082) -- 0:00:23
613500 -- [-683.622] (-681.699) (-682.776) (-682.322) * (-683.590) (-680.878) (-680.333) [-680.244] -- 0:00:23
614000 -- (-682.695) (-681.042) [-680.815] (-682.473) * [-680.259] (-681.043) (-685.701) (-685.488) -- 0:00:23
614500 -- (-681.936) [-684.012] (-680.655) (-681.445) * [-685.178] (-683.171) (-682.465) (-685.996) -- 0:00:23
615000 -- [-681.053] (-680.484) (-682.600) (-681.817) * (-683.141) [-680.700] (-682.983) (-681.927) -- 0:00:23
Average standard deviation of split frequencies: 0.009470
615500 -- (-682.882) (-681.139) [-685.291] (-682.456) * (-682.682) (-683.178) [-680.577] (-684.038) -- 0:00:23
616000 -- (-682.075) (-682.933) [-685.567] (-680.537) * [-684.223] (-680.671) (-681.184) (-680.699) -- 0:00:23
616500 -- (-684.042) (-680.465) [-680.473] (-682.134) * (-684.483) (-682.206) (-680.626) [-680.779] -- 0:00:23
617000 -- [-684.303] (-681.005) (-681.710) (-681.587) * [-682.690] (-681.381) (-681.861) (-684.119) -- 0:00:22
617500 -- (-680.739) (-683.044) [-683.447] (-680.614) * [-680.207] (-684.440) (-681.860) (-682.976) -- 0:00:22
618000 -- (-680.409) [-683.024] (-682.095) (-680.684) * (-682.350) (-681.828) (-680.380) [-679.834] -- 0:00:22
618500 -- (-682.289) (-685.495) (-681.641) [-680.486] * (-682.789) (-680.833) (-682.186) [-684.002] -- 0:00:22
619000 -- (-683.377) (-680.645) [-679.552] (-681.766) * (-681.383) (-681.432) [-681.109] (-682.975) -- 0:00:22
619500 -- (-684.692) [-683.076] (-682.123) (-682.636) * [-681.971] (-682.453) (-681.904) (-681.235) -- 0:00:22
620000 -- (-680.834) (-681.378) (-680.935) [-683.959] * [-681.732] (-681.774) (-681.589) (-680.294) -- 0:00:22
Average standard deviation of split frequencies: 0.008782
620500 -- (-680.920) [-681.282] (-680.540) (-681.631) * (-680.496) [-680.898] (-681.844) (-680.280) -- 0:00:22
621000 -- (-680.473) (-681.091) (-681.978) [-679.938] * (-681.253) (-680.073) (-680.698) [-683.170] -- 0:00:22
621500 -- [-681.863] (-680.314) (-681.185) (-683.327) * [-682.274] (-679.805) (-680.173) (-682.635) -- 0:00:22
622000 -- [-680.915] (-681.953) (-681.942) (-687.535) * (-681.224) [-682.663] (-683.517) (-681.680) -- 0:00:22
622500 -- (-680.743) (-681.245) [-681.266] (-685.323) * (-681.978) [-681.154] (-684.634) (-682.191) -- 0:00:22
623000 -- [-680.078] (-682.026) (-681.931) (-687.470) * (-680.537) (-680.345) [-683.114] (-683.190) -- 0:00:22
623500 -- (-682.158) [-682.273] (-681.280) (-686.312) * (-681.928) (-680.779) [-681.942] (-684.016) -- 0:00:22
624000 -- (-681.641) [-681.164] (-681.191) (-681.978) * (-682.600) (-682.274) (-682.547) [-681.875] -- 0:00:22
624500 -- (-680.725) (-680.737) [-680.628] (-685.400) * (-685.368) (-680.974) (-683.122) [-681.728] -- 0:00:22
625000 -- (-680.127) (-679.791) (-680.515) [-686.346] * (-682.755) (-684.337) (-680.054) [-680.898] -- 0:00:22
Average standard deviation of split frequencies: 0.008519
625500 -- (-680.750) (-680.240) [-683.110] (-679.922) * (-680.498) [-681.562] (-681.501) (-681.544) -- 0:00:22
626000 -- (-679.801) (-680.612) [-681.131] (-680.426) * [-681.645] (-683.890) (-680.797) (-683.699) -- 0:00:22
626500 -- (-683.411) (-685.364) [-680.002] (-680.310) * (-681.447) (-682.083) [-682.165] (-681.099) -- 0:00:22
627000 -- (-682.760) (-684.026) (-683.679) [-682.860] * (-680.956) [-680.730] (-681.675) (-681.632) -- 0:00:22
627500 -- (-679.894) (-684.521) (-682.985) [-680.249] * (-682.294) (-686.197) (-682.305) [-684.933] -- 0:00:22
628000 -- [-679.555] (-683.133) (-681.425) (-681.630) * (-680.514) [-679.506] (-689.561) (-683.390) -- 0:00:22
628500 -- (-681.577) (-681.642) [-682.298] (-683.071) * (-680.821) (-680.281) (-684.067) [-681.337] -- 0:00:22
629000 -- (-682.725) (-681.491) [-681.701] (-681.561) * (-682.473) [-685.514] (-680.747) (-683.987) -- 0:00:22
629500 -- [-683.126] (-683.944) (-681.003) (-681.953) * (-682.754) (-681.611) [-680.829] (-685.303) -- 0:00:22
630000 -- (-684.468) (-681.311) (-682.426) [-682.526] * (-685.048) [-680.578] (-685.952) (-684.227) -- 0:00:22
Average standard deviation of split frequencies: 0.008829
630500 -- (-682.194) [-680.625] (-681.805) (-681.994) * (-682.537) (-680.315) [-685.120] (-685.458) -- 0:00:22
631000 -- (-683.229) (-683.523) [-682.344] (-682.613) * (-682.185) (-682.763) [-684.031] (-684.029) -- 0:00:22
631500 -- (-682.558) (-679.729) [-680.163] (-684.479) * [-681.016] (-683.355) (-686.586) (-685.247) -- 0:00:22
632000 -- (-681.662) (-680.035) [-683.578] (-681.833) * (-684.679) [-684.431] (-682.911) (-689.068) -- 0:00:22
632500 -- (-685.071) (-682.378) [-680.665] (-681.044) * (-684.915) (-680.988) (-681.928) [-681.998] -- 0:00:22
633000 -- (-683.168) [-680.606] (-681.551) (-682.635) * (-682.185) [-681.404] (-680.070) (-683.485) -- 0:00:22
633500 -- (-684.500) (-680.338) (-682.904) [-680.522] * (-681.522) (-681.099) (-686.318) [-682.977] -- 0:00:21
634000 -- (-680.104) (-681.671) [-681.287] (-682.470) * [-683.722] (-680.764) (-681.037) (-681.901) -- 0:00:21
634500 -- [-681.026] (-683.068) (-683.737) (-681.884) * [-680.310] (-681.099) (-681.277) (-681.652) -- 0:00:21
635000 -- (-685.536) (-682.939) (-683.230) [-681.675] * (-682.484) (-680.786) [-680.763] (-684.059) -- 0:00:21
Average standard deviation of split frequencies: 0.009487
635500 -- (-681.666) (-682.020) [-683.312] (-684.483) * [-680.687] (-684.512) (-680.492) (-686.201) -- 0:00:21
636000 -- (-680.337) (-681.921) [-681.259] (-683.681) * [-681.583] (-684.545) (-680.804) (-684.250) -- 0:00:21
636500 -- (-681.589) (-682.173) [-680.860] (-685.956) * (-682.061) [-680.059] (-681.725) (-688.163) -- 0:00:21
637000 -- [-683.232] (-682.329) (-681.315) (-680.671) * (-680.520) [-680.497] (-684.676) (-685.189) -- 0:00:21
637500 -- (-682.366) (-682.914) [-680.201] (-681.816) * (-680.724) [-680.972] (-680.578) (-681.053) -- 0:00:21
638000 -- (-685.598) (-680.657) (-683.203) [-682.207] * (-682.109) (-682.350) [-680.579] (-684.547) -- 0:00:21
638500 -- [-682.940] (-684.811) (-682.843) (-680.302) * (-684.769) (-680.628) [-682.220] (-682.807) -- 0:00:21
639000 -- (-683.534) (-682.396) (-682.010) [-681.151] * (-682.260) (-683.319) [-682.087] (-680.166) -- 0:00:21
639500 -- (-683.108) [-680.801] (-684.688) (-683.035) * (-681.531) (-680.745) (-682.306) [-681.459] -- 0:00:21
640000 -- (-684.312) [-681.867] (-684.343) (-682.988) * (-681.269) (-683.505) [-681.037] (-680.951) -- 0:00:21
Average standard deviation of split frequencies: 0.009198
640500 -- (-681.946) (-684.932) [-685.868] (-681.410) * (-681.764) (-687.675) (-679.923) [-684.231] -- 0:00:21
641000 -- (-684.374) (-681.971) (-682.421) [-679.806] * (-683.937) (-681.836) (-681.833) [-680.369] -- 0:00:21
641500 -- (-681.342) (-681.827) [-681.985] (-684.674) * (-687.543) (-680.214) (-683.001) [-679.939] -- 0:00:21
642000 -- (-681.511) (-682.367) [-680.737] (-679.863) * [-681.693] (-683.822) (-687.909) (-680.796) -- 0:00:21
642500 -- [-680.309] (-681.214) (-680.874) (-680.935) * (-681.643) (-680.376) [-681.519] (-683.247) -- 0:00:21
643000 -- [-680.318] (-680.769) (-683.738) (-684.548) * (-682.405) [-680.662] (-683.454) (-683.636) -- 0:00:21
643500 -- (-680.289) (-680.123) [-680.006] (-681.632) * [-681.184] (-682.725) (-683.434) (-683.040) -- 0:00:21
644000 -- (-683.079) (-680.987) [-680.702] (-684.909) * [-681.478] (-681.462) (-681.360) (-682.290) -- 0:00:21
644500 -- (-681.799) [-683.201] (-681.052) (-683.611) * (-688.447) (-680.843) [-680.931] (-683.073) -- 0:00:21
645000 -- [-684.148] (-683.158) (-682.225) (-683.478) * (-681.894) (-681.356) [-680.382] (-684.137) -- 0:00:21
Average standard deviation of split frequencies: 0.009389
645500 -- (-687.803) (-687.254) [-680.619] (-683.369) * [-683.984] (-681.668) (-680.803) (-680.921) -- 0:00:21
646000 -- [-683.113] (-681.726) (-681.898) (-683.389) * (-683.254) (-681.579) (-681.152) [-682.677] -- 0:00:21
646500 -- [-683.554] (-680.719) (-682.986) (-683.403) * (-683.255) (-684.030) [-681.152] (-680.347) -- 0:00:21
647000 -- [-683.197] (-682.809) (-681.934) (-682.571) * (-679.944) [-683.896] (-682.393) (-680.131) -- 0:00:21
647500 -- (-683.425) (-680.934) [-683.666] (-684.744) * (-683.073) (-680.717) (-680.260) [-682.836] -- 0:00:21
648000 -- (-685.705) [-685.297] (-680.784) (-680.430) * (-683.724) (-681.875) [-681.401] (-682.690) -- 0:00:21
648500 -- (-680.645) (-681.572) [-682.128] (-681.066) * (-681.637) (-685.831) [-681.552] (-685.013) -- 0:00:21
649000 -- (-680.217) [-683.136] (-680.413) (-683.219) * (-679.853) [-682.141] (-680.100) (-683.718) -- 0:00:21
649500 -- (-680.512) [-682.934] (-679.786) (-683.266) * [-681.611] (-683.147) (-681.314) (-682.810) -- 0:00:21
650000 -- (-682.602) [-682.118] (-683.177) (-686.025) * (-680.949) (-681.386) (-680.875) [-681.640] -- 0:00:21
Average standard deviation of split frequencies: 0.008501
650500 -- (-681.106) (-681.501) [-680.754] (-683.023) * (-681.168) [-680.675] (-681.796) (-682.895) -- 0:00:20
651000 -- (-683.092) [-681.281] (-681.268) (-683.228) * (-681.290) [-683.218] (-682.819) (-682.919) -- 0:00:20
651500 -- (-682.649) [-680.488] (-679.581) (-685.652) * (-685.326) (-681.528) [-683.618] (-684.680) -- 0:00:20
652000 -- (-683.829) (-681.421) [-679.894] (-682.374) * [-680.208] (-685.902) (-682.960) (-682.759) -- 0:00:20
652500 -- (-683.486) [-681.890] (-680.960) (-680.234) * [-680.520] (-683.481) (-686.743) (-683.007) -- 0:00:20
653000 -- [-681.933] (-686.047) (-682.417) (-679.929) * [-682.783] (-681.034) (-684.597) (-682.775) -- 0:00:20
653500 -- (-680.476) (-683.645) (-682.181) [-682.491] * (-686.457) (-681.034) (-680.691) [-680.436] -- 0:00:20
654000 -- [-681.676] (-682.200) (-680.272) (-680.406) * (-686.796) (-682.257) (-679.752) [-681.270] -- 0:00:20
654500 -- (-684.634) (-680.556) (-682.524) [-681.957] * [-682.916] (-680.976) (-682.663) (-680.917) -- 0:00:20
655000 -- [-683.490] (-681.545) (-682.254) (-682.593) * [-683.379] (-681.681) (-680.794) (-680.309) -- 0:00:20
Average standard deviation of split frequencies: 0.009007
655500 -- (-680.341) (-680.002) (-682.075) [-680.595] * (-681.748) [-680.483] (-682.402) (-682.756) -- 0:00:20
656000 -- (-681.478) (-684.726) (-681.351) [-681.187] * [-682.240] (-681.656) (-685.674) (-680.805) -- 0:00:20
656500 -- [-679.752] (-682.504) (-679.974) (-679.891) * (-685.092) (-680.161) [-681.542] (-680.829) -- 0:00:20
657000 -- (-683.445) (-681.776) [-680.399] (-685.634) * (-683.232) (-683.474) (-683.124) [-681.681] -- 0:00:20
657500 -- (-681.120) [-684.475] (-681.377) (-686.173) * [-683.941] (-686.683) (-680.819) (-679.689) -- 0:00:20
658000 -- (-680.211) (-683.850) (-680.798) [-685.839] * (-683.198) (-684.082) [-681.388] (-684.023) -- 0:00:20
658500 -- [-680.739] (-685.905) (-680.271) (-682.854) * (-681.774) (-681.525) (-684.247) [-684.220] -- 0:00:20
659000 -- [-680.367] (-680.832) (-681.794) (-688.185) * [-681.392] (-682.072) (-680.836) (-684.371) -- 0:00:20
659500 -- (-680.154) [-685.042] (-682.984) (-685.839) * (-681.102) [-680.356] (-681.182) (-689.650) -- 0:00:20
660000 -- (-680.160) [-680.437] (-682.129) (-679.877) * (-680.319) (-683.829) [-680.859] (-683.747) -- 0:00:20
Average standard deviation of split frequencies: 0.009609
660500 -- (-679.617) (-682.737) (-681.180) [-681.038] * [-680.139] (-681.157) (-681.780) (-682.597) -- 0:00:20
661000 -- (-682.247) (-688.477) [-680.486] (-680.793) * (-683.343) (-680.957) [-681.668] (-683.717) -- 0:00:20
661500 -- [-680.476] (-685.589) (-685.359) (-680.815) * (-682.755) [-679.963] (-681.925) (-682.938) -- 0:00:20
662000 -- (-684.163) (-680.758) (-681.126) [-681.897] * [-679.607] (-679.830) (-680.187) (-679.992) -- 0:00:20
662500 -- (-682.739) (-681.545) [-681.763] (-682.653) * (-681.248) (-679.606) (-681.866) [-681.289] -- 0:00:20
663000 -- (-682.648) (-680.667) [-682.583] (-679.645) * [-681.350] (-680.758) (-682.849) (-683.654) -- 0:00:20
663500 -- (-685.279) [-681.713] (-684.535) (-681.812) * (-679.832) (-681.322) (-685.577) [-684.686] -- 0:00:20
664000 -- (-682.340) (-681.985) (-682.778) [-680.279] * [-679.852] (-683.239) (-681.931) (-680.642) -- 0:00:20
664500 -- (-681.096) [-681.921] (-680.938) (-682.747) * [-679.719] (-680.921) (-681.695) (-681.310) -- 0:00:20
665000 -- (-681.050) (-680.385) [-681.366] (-679.782) * (-679.895) [-679.665] (-682.456) (-681.198) -- 0:00:20
Average standard deviation of split frequencies: 0.009909
665500 -- (-682.623) (-682.253) (-681.149) [-684.673] * [-679.925] (-681.058) (-682.664) (-683.205) -- 0:00:20
666000 -- (-680.521) (-681.503) [-680.683] (-683.902) * (-681.318) (-687.883) (-682.078) [-683.200] -- 0:00:20
666500 -- (-679.547) [-680.958] (-679.688) (-680.554) * (-685.543) [-682.111] (-681.524) (-682.307) -- 0:00:20
667000 -- [-683.942] (-683.092) (-681.689) (-682.729) * [-682.670] (-681.789) (-681.721) (-682.949) -- 0:00:19
667500 -- (-680.616) (-682.210) (-685.338) [-681.150] * (-683.699) [-681.371] (-683.715) (-681.478) -- 0:00:19
668000 -- (-680.219) (-682.773) [-682.480] (-680.885) * [-682.794] (-687.794) (-681.013) (-680.014) -- 0:00:19
668500 -- [-683.659] (-680.705) (-680.532) (-680.731) * (-685.728) (-686.096) (-681.822) [-680.721] -- 0:00:19
669000 -- [-685.377] (-681.486) (-679.967) (-681.113) * (-684.176) (-683.845) (-685.832) [-684.879] -- 0:00:19
669500 -- [-681.624] (-680.479) (-683.035) (-680.846) * (-687.231) (-685.282) (-684.230) [-681.426] -- 0:00:19
670000 -- [-685.309] (-680.328) (-681.809) (-679.914) * (-684.187) (-683.498) (-688.909) [-681.420] -- 0:00:19
Average standard deviation of split frequencies: 0.009887
670500 -- (-683.305) [-680.003] (-680.393) (-680.080) * (-681.723) [-681.069] (-682.938) (-681.001) -- 0:00:19
671000 -- [-681.864] (-682.135) (-682.889) (-681.157) * [-682.626] (-682.017) (-684.309) (-681.052) -- 0:00:19
671500 -- (-685.166) (-681.733) [-682.537] (-681.818) * [-680.448] (-685.788) (-679.606) (-682.839) -- 0:00:19
672000 -- (-684.425) (-686.617) [-681.398] (-681.648) * [-680.083] (-684.803) (-681.254) (-685.060) -- 0:00:19
672500 -- (-682.975) (-691.098) [-681.695] (-684.082) * [-680.135] (-686.278) (-683.782) (-681.827) -- 0:00:19
673000 -- (-681.290) [-684.005] (-682.248) (-682.090) * [-683.552] (-683.377) (-683.100) (-683.936) -- 0:00:19
673500 -- (-682.795) (-685.473) [-680.952] (-683.024) * (-687.025) (-682.282) [-684.100] (-682.474) -- 0:00:19
674000 -- [-681.230] (-683.315) (-680.914) (-682.213) * (-682.722) (-680.806) [-681.529] (-683.143) -- 0:00:19
674500 -- [-682.634] (-680.111) (-681.748) (-684.970) * (-685.136) [-681.769] (-683.834) (-681.316) -- 0:00:19
675000 -- (-681.831) [-681.562] (-681.130) (-679.543) * [-684.502] (-682.856) (-682.438) (-683.778) -- 0:00:19
Average standard deviation of split frequencies: 0.009809
675500 -- (-681.134) (-682.262) (-681.872) [-679.772] * (-682.551) (-681.178) (-679.962) [-682.952] -- 0:00:19
676000 -- (-681.307) (-682.943) (-679.883) [-681.324] * (-681.723) (-681.358) (-680.102) [-681.931] -- 0:00:19
676500 -- (-680.473) (-680.927) (-682.922) [-680.133] * [-682.041] (-680.443) (-680.271) (-681.413) -- 0:00:19
677000 -- (-681.546) (-683.284) [-680.059] (-681.860) * (-686.827) (-684.147) (-680.280) [-681.069] -- 0:00:19
677500 -- (-680.495) (-681.098) [-683.276] (-687.029) * [-681.408] (-679.492) (-681.620) (-683.419) -- 0:00:19
678000 -- (-680.406) [-681.733] (-681.866) (-687.526) * (-682.337) (-680.176) [-681.257] (-684.373) -- 0:00:19
678500 -- (-682.412) (-680.821) (-681.538) [-681.849] * (-688.763) [-682.681] (-681.873) (-682.238) -- 0:00:19
679000 -- (-684.438) [-685.041] (-682.514) (-681.263) * (-681.180) (-681.831) (-680.853) [-681.730] -- 0:00:19
679500 -- (-684.846) (-682.902) (-684.112) [-682.701] * (-682.320) [-683.843] (-683.460) (-681.360) -- 0:00:19
680000 -- (-681.091) [-681.155] (-683.219) (-681.816) * [-681.200] (-682.715) (-680.832) (-681.948) -- 0:00:19
Average standard deviation of split frequencies: 0.009834
680500 -- [-679.589] (-680.612) (-683.527) (-680.538) * (-681.883) [-683.600] (-679.914) (-683.431) -- 0:00:19
681000 -- [-680.034] (-684.321) (-684.145) (-680.577) * (-684.143) (-683.487) [-683.976] (-684.117) -- 0:00:19
681500 -- (-682.121) (-682.919) [-682.181] (-684.204) * (-682.405) [-681.306] (-683.099) (-680.643) -- 0:00:19
682000 -- (-682.484) (-681.164) (-683.609) [-681.264] * (-683.289) (-679.514) [-681.997] (-679.643) -- 0:00:19
682500 -- (-681.957) (-680.956) (-682.835) [-683.387] * [-684.146] (-681.785) (-681.388) (-680.347) -- 0:00:19
683000 -- (-679.810) (-686.097) (-680.777) [-683.440] * [-679.542] (-680.326) (-683.415) (-681.060) -- 0:00:19
683500 -- (-680.395) (-679.930) (-684.447) [-688.364] * (-681.516) (-681.867) [-681.577] (-688.063) -- 0:00:18
684000 -- (-680.407) [-680.516] (-683.683) (-686.020) * (-682.705) (-683.073) [-683.897] (-683.245) -- 0:00:18
684500 -- (-686.216) (-680.395) (-682.806) [-682.807] * (-683.138) [-680.153] (-681.031) (-680.168) -- 0:00:18
685000 -- (-681.616) (-681.303) [-681.753] (-680.749) * (-685.753) (-681.886) [-680.109] (-682.494) -- 0:00:18
Average standard deviation of split frequencies: 0.009706
685500 -- (-680.709) [-682.826] (-686.906) (-684.459) * (-683.609) [-683.382] (-683.820) (-685.173) -- 0:00:18
686000 -- [-682.737] (-681.895) (-680.950) (-680.531) * [-680.365] (-686.577) (-680.576) (-681.920) -- 0:00:18
686500 -- (-679.620) [-682.586] (-680.836) (-682.453) * (-682.334) [-685.876] (-680.852) (-681.821) -- 0:00:18
687000 -- (-680.308) [-680.869] (-682.836) (-681.090) * (-682.699) (-684.599) [-680.754] (-681.749) -- 0:00:18
687500 -- (-681.300) (-680.302) [-682.468] (-682.849) * (-683.057) (-682.175) (-680.922) [-681.183] -- 0:00:18
688000 -- (-683.071) (-687.986) (-684.368) [-680.955] * (-682.971) (-682.986) (-681.589) [-679.932] -- 0:00:18
688500 -- (-680.490) (-682.301) (-685.268) [-682.688] * (-683.429) (-680.376) (-681.403) [-681.837] -- 0:00:18
689000 -- (-682.493) (-682.420) [-681.713] (-682.654) * (-684.084) (-680.747) [-680.509] (-684.263) -- 0:00:18
689500 -- (-681.517) (-683.562) [-683.876] (-683.530) * (-682.664) (-681.016) (-680.603) [-681.436] -- 0:00:18
690000 -- (-682.981) (-682.971) [-680.937] (-687.519) * (-682.154) (-681.084) (-680.239) [-680.118] -- 0:00:18
Average standard deviation of split frequencies: 0.009555
690500 -- (-682.968) (-683.145) [-681.063] (-680.771) * (-681.281) (-682.212) (-681.639) [-680.164] -- 0:00:18
691000 -- (-680.555) (-680.855) [-684.008] (-680.573) * (-681.887) (-680.058) [-683.497] (-682.262) -- 0:00:18
691500 -- (-680.556) (-679.592) (-680.740) [-682.019] * (-680.552) (-680.156) [-680.239] (-682.709) -- 0:00:18
692000 -- (-684.963) (-680.398) [-680.794] (-683.711) * (-684.142) [-681.170] (-680.405) (-681.262) -- 0:00:18
692500 -- [-681.673] (-681.926) (-682.555) (-681.599) * (-680.258) (-682.803) [-680.204] (-679.992) -- 0:00:18
693000 -- (-680.654) [-680.846] (-681.379) (-680.025) * (-685.017) (-682.319) [-681.324] (-681.716) -- 0:00:18
693500 -- (-681.928) (-680.819) (-682.560) [-681.178] * (-682.810) [-682.068] (-681.230) (-682.632) -- 0:00:18
694000 -- (-681.726) [-681.863] (-683.065) (-679.995) * [-684.720] (-681.480) (-682.914) (-682.342) -- 0:00:18
694500 -- (-682.262) [-684.126] (-683.990) (-680.617) * (-682.283) [-682.001] (-681.977) (-681.511) -- 0:00:18
695000 -- (-683.967) [-681.071] (-683.942) (-683.860) * (-681.705) (-682.550) (-680.540) [-680.416] -- 0:00:18
Average standard deviation of split frequencies: 0.009573
695500 -- [-682.657] (-680.386) (-687.263) (-681.699) * [-682.724] (-683.451) (-680.686) (-679.639) -- 0:00:18
696000 -- (-682.863) [-681.246] (-680.368) (-682.524) * (-680.051) [-683.056] (-684.265) (-680.229) -- 0:00:18
696500 -- [-680.798] (-680.212) (-680.935) (-681.839) * (-679.752) (-688.578) [-680.678] (-681.463) -- 0:00:18
697000 -- (-683.576) (-681.997) (-680.608) [-681.505] * (-679.859) [-682.034] (-682.573) (-681.678) -- 0:00:18
697500 -- (-680.731) [-680.835] (-684.742) (-681.308) * (-681.011) [-685.970] (-682.985) (-679.915) -- 0:00:18
698000 -- [-685.882] (-682.348) (-683.962) (-683.841) * (-681.372) [-683.203] (-682.836) (-680.564) -- 0:00:18
698500 -- (-680.817) (-681.132) (-680.992) [-681.877] * (-680.171) (-684.902) [-682.373] (-679.693) -- 0:00:18
699000 -- [-680.304] (-681.575) (-683.085) (-681.071) * (-680.219) (-683.195) (-686.386) [-682.066] -- 0:00:18
699500 -- (-680.193) [-680.680] (-686.764) (-681.084) * (-680.681) (-680.918) [-684.412] (-681.871) -- 0:00:18
700000 -- (-681.197) (-682.129) [-680.777] (-680.737) * (-681.727) (-680.338) (-684.403) [-681.183] -- 0:00:18
Average standard deviation of split frequencies: 0.009554
700500 -- (-681.760) (-681.181) (-683.921) [-681.867] * (-682.376) (-680.786) (-685.034) [-679.877] -- 0:00:17
701000 -- (-680.302) (-682.279) [-679.972] (-681.814) * (-684.146) [-680.444] (-681.202) (-679.574) -- 0:00:17
701500 -- (-683.536) (-683.532) (-685.014) [-683.164] * (-679.964) [-680.454] (-680.346) (-680.720) -- 0:00:17
702000 -- (-681.218) (-680.864) (-680.501) [-680.682] * (-680.889) [-681.360] (-681.510) (-679.970) -- 0:00:17
702500 -- (-680.125) (-680.463) (-684.058) [-684.729] * (-682.465) [-687.621] (-680.653) (-687.576) -- 0:00:17
703000 -- (-681.195) (-682.649) [-684.851] (-681.448) * (-680.462) (-684.961) (-685.450) [-681.299] -- 0:00:17
703500 -- (-681.065) [-681.578] (-679.904) (-682.032) * (-681.727) (-680.578) [-682.840] (-681.571) -- 0:00:17
704000 -- (-682.913) (-682.005) [-680.587] (-681.183) * (-686.771) (-679.985) [-680.513] (-683.475) -- 0:00:17
704500 -- (-681.305) (-681.790) [-679.814] (-684.629) * (-682.307) [-679.942] (-682.421) (-682.904) -- 0:00:17
705000 -- (-681.589) (-680.844) [-684.310] (-681.627) * (-684.042) (-682.603) (-681.326) [-680.633] -- 0:00:17
Average standard deviation of split frequencies: 0.009125
705500 -- (-685.067) (-681.158) (-683.078) [-680.967] * (-679.788) [-682.461] (-684.474) (-688.362) -- 0:00:17
706000 -- [-687.803] (-681.587) (-681.819) (-680.927) * (-680.689) (-681.568) (-683.528) [-683.392] -- 0:00:17
706500 -- (-682.964) [-680.145] (-685.102) (-682.463) * [-680.441] (-684.249) (-680.535) (-686.804) -- 0:00:17
707000 -- (-680.842) [-681.757] (-685.808) (-681.910) * [-681.065] (-681.450) (-680.780) (-685.999) -- 0:00:17
707500 -- (-680.881) [-683.491] (-680.897) (-680.777) * (-681.143) (-679.728) (-682.503) [-680.981] -- 0:00:17
708000 -- (-682.151) (-680.417) (-682.405) [-681.796] * [-680.286] (-681.629) (-682.307) (-681.537) -- 0:00:17
708500 -- (-681.684) (-680.501) [-681.879] (-682.667) * (-681.580) [-680.057] (-680.948) (-683.936) -- 0:00:17
709000 -- [-680.818] (-684.986) (-680.769) (-681.096) * (-684.285) (-681.318) [-681.332] (-684.078) -- 0:00:17
709500 -- (-681.847) (-683.061) (-680.364) [-680.840] * (-684.567) (-684.577) (-685.335) [-679.686] -- 0:00:17
710000 -- (-681.640) (-686.383) (-680.393) [-681.093] * (-683.545) (-684.027) (-683.088) [-679.735] -- 0:00:17
Average standard deviation of split frequencies: 0.008457
710500 -- (-681.113) (-684.356) [-684.794] (-680.910) * (-681.780) (-682.748) (-683.348) [-681.409] -- 0:00:17
711000 -- (-681.630) (-683.124) (-681.595) [-680.243] * (-680.914) (-680.768) (-683.047) [-681.820] -- 0:00:17
711500 -- (-681.167) [-680.644] (-682.617) (-680.936) * (-683.538) (-682.653) (-682.180) [-682.031] -- 0:00:17
712000 -- (-680.674) [-680.891] (-681.907) (-679.556) * (-687.076) (-683.545) [-683.638] (-682.258) -- 0:00:17
712500 -- (-681.874) (-680.511) (-680.479) [-681.549] * (-685.431) (-681.741) (-681.809) [-681.935] -- 0:00:17
713000 -- (-683.436) (-682.730) [-683.333] (-681.985) * (-681.024) (-681.146) (-680.728) [-680.741] -- 0:00:17
713500 -- (-683.004) (-680.612) [-680.180] (-683.540) * [-680.545] (-682.516) (-682.428) (-684.809) -- 0:00:17
714000 -- [-681.319] (-681.287) (-681.623) (-683.324) * (-680.903) (-683.257) [-681.180] (-683.972) -- 0:00:17
714500 -- [-681.774] (-681.193) (-680.389) (-683.104) * (-681.243) (-681.958) [-683.591] (-685.391) -- 0:00:17
715000 -- (-680.214) [-682.834] (-681.166) (-683.185) * [-681.958] (-684.009) (-684.900) (-683.906) -- 0:00:17
Average standard deviation of split frequencies: 0.008394
715500 -- (-681.880) (-680.068) (-683.828) [-680.951] * [-680.380] (-680.489) (-685.546) (-682.015) -- 0:00:17
716000 -- (-682.825) (-681.001) [-681.916] (-682.006) * (-681.339) [-679.755] (-683.327) (-682.842) -- 0:00:17
716500 -- (-682.035) [-679.724] (-681.215) (-685.700) * (-680.039) [-682.244] (-681.777) (-685.562) -- 0:00:17
717000 -- (-685.890) (-680.018) [-681.337] (-683.757) * (-681.005) (-681.169) (-680.492) [-680.465] -- 0:00:16
717500 -- (-685.633) (-682.012) [-680.351] (-680.152) * [-682.157] (-680.640) (-680.471) (-682.812) -- 0:00:16
718000 -- [-684.972] (-680.646) (-680.360) (-681.537) * (-683.936) (-680.929) (-682.156) [-683.705] -- 0:00:16
718500 -- [-681.377] (-684.832) (-680.372) (-686.049) * (-680.565) (-681.735) (-681.017) [-681.302] -- 0:00:16
719000 -- (-681.092) (-682.329) [-680.399] (-686.503) * (-680.725) (-683.470) (-681.839) [-685.044] -- 0:00:16
719500 -- (-681.023) [-690.920] (-685.368) (-681.681) * (-684.545) (-680.429) (-687.611) [-680.100] -- 0:00:16
720000 -- (-682.202) (-681.302) (-682.783) [-682.547] * (-682.118) (-680.694) [-681.014] (-680.538) -- 0:00:16
Average standard deviation of split frequencies: 0.008463
720500 -- [-682.127] (-681.311) (-681.933) (-679.849) * (-680.755) [-681.945] (-683.017) (-680.730) -- 0:00:16
721000 -- [-681.385] (-681.822) (-679.505) (-684.671) * [-680.468] (-682.125) (-681.591) (-680.455) -- 0:00:16
721500 -- (-680.357) (-680.693) [-683.775] (-682.877) * [-682.031] (-681.708) (-685.384) (-682.773) -- 0:00:16
722000 -- (-682.784) (-682.575) [-681.565] (-680.583) * (-684.465) (-680.189) [-681.610] (-680.857) -- 0:00:16
722500 -- (-681.509) [-683.415] (-682.570) (-680.414) * [-683.929] (-682.074) (-685.739) (-683.666) -- 0:00:16
723000 -- (-685.252) [-680.374] (-684.057) (-681.141) * (-682.339) [-682.185] (-681.367) (-683.918) -- 0:00:16
723500 -- (-680.447) [-682.533] (-680.618) (-680.618) * (-680.665) (-681.060) (-685.889) [-682.303] -- 0:00:16
724000 -- (-681.930) [-681.239] (-681.816) (-682.128) * [-680.579] (-683.020) (-683.457) (-682.029) -- 0:00:16
724500 -- [-683.290] (-683.097) (-680.861) (-680.935) * (-680.291) (-685.309) [-684.910] (-682.720) -- 0:00:16
725000 -- (-683.348) [-681.591] (-682.803) (-683.038) * (-681.903) (-683.380) (-680.444) [-681.658] -- 0:00:16
Average standard deviation of split frequencies: 0.008976
725500 -- (-684.698) (-686.062) [-682.650] (-682.045) * (-681.163) [-681.594] (-680.612) (-686.142) -- 0:00:16
726000 -- (-681.348) (-687.068) [-681.047] (-682.338) * [-679.997] (-682.967) (-681.366) (-683.715) -- 0:00:16
726500 -- [-681.034] (-680.608) (-681.717) (-681.171) * (-680.649) [-681.439] (-683.733) (-683.656) -- 0:00:16
727000 -- (-680.094) [-681.209] (-683.146) (-679.653) * (-682.768) (-681.560) (-683.339) [-680.325] -- 0:00:16
727500 -- (-685.290) (-680.073) [-682.297] (-682.449) * (-681.579) (-681.182) [-680.244] (-679.778) -- 0:00:16
728000 -- (-685.209) [-681.055] (-681.541) (-683.154) * (-682.906) [-681.123] (-682.181) (-680.429) -- 0:00:16
728500 -- [-685.322] (-680.680) (-686.017) (-681.115) * (-682.133) (-681.239) (-681.816) [-680.184] -- 0:00:16
729000 -- (-685.301) (-682.230) [-684.112] (-682.174) * (-683.486) (-681.885) [-681.487] (-682.030) -- 0:00:16
729500 -- (-684.178) (-680.580) [-681.652] (-684.589) * (-680.188) [-680.192] (-681.628) (-681.594) -- 0:00:16
730000 -- (-684.382) [-681.001] (-680.661) (-681.016) * (-685.659) (-680.769) (-683.532) [-682.797] -- 0:00:16
Average standard deviation of split frequencies: 0.008952
730500 -- (-681.929) (-682.068) (-681.154) [-681.213] * (-680.546) (-681.783) [-682.922] (-682.751) -- 0:00:16
731000 -- (-686.712) (-682.789) [-680.482] (-681.964) * (-683.938) (-683.300) [-682.863] (-682.970) -- 0:00:16
731500 -- [-682.600] (-680.356) (-680.863) (-684.830) * [-683.361] (-681.909) (-681.870) (-686.964) -- 0:00:16
732000 -- (-682.722) (-680.969) (-681.625) [-680.657] * (-687.423) (-683.265) [-680.655] (-683.531) -- 0:00:16
732500 -- (-680.538) (-679.913) (-681.436) [-682.893] * (-683.208) (-681.361) (-680.180) [-681.953] -- 0:00:16
733000 -- (-680.258) [-679.740] (-682.724) (-684.172) * (-683.099) (-683.233) (-680.982) [-680.280] -- 0:00:16
733500 -- (-680.793) (-682.279) (-680.882) [-679.696] * (-681.206) (-683.193) (-683.848) [-682.309] -- 0:00:15
734000 -- (-681.170) (-682.410) (-682.578) [-680.569] * [-680.021] (-681.184) (-686.898) (-683.011) -- 0:00:15
734500 -- [-683.167] (-681.327) (-683.293) (-681.548) * [-682.306] (-680.611) (-681.201) (-681.824) -- 0:00:15
735000 -- (-683.584) (-682.345) [-684.580] (-682.303) * [-682.355] (-682.382) (-683.074) (-680.091) -- 0:00:15
Average standard deviation of split frequencies: 0.009327
735500 -- (-683.195) [-681.752] (-685.083) (-685.400) * (-682.099) (-680.618) (-680.651) [-680.256] -- 0:00:15
736000 -- [-679.716] (-684.029) (-681.783) (-680.606) * (-684.799) (-682.667) (-681.072) [-682.227] -- 0:00:15
736500 -- (-681.014) (-682.162) (-684.889) [-681.005] * (-682.959) (-683.005) (-684.672) [-681.362] -- 0:00:15
737000 -- (-682.215) (-682.313) (-680.419) [-681.040] * (-680.059) (-684.702) [-683.379] (-680.013) -- 0:00:15
737500 -- (-680.680) (-683.346) [-682.287] (-682.994) * (-681.090) (-681.196) [-682.422] (-681.732) -- 0:00:15
738000 -- [-684.433] (-680.006) (-680.954) (-686.072) * (-680.296) (-680.459) [-688.071] (-680.610) -- 0:00:15
738500 -- (-682.727) [-679.523] (-681.306) (-688.712) * (-680.941) [-682.055] (-682.837) (-680.939) -- 0:00:15
739000 -- (-681.853) (-685.914) (-683.947) [-684.016] * (-680.578) (-684.259) [-682.448] (-681.996) -- 0:00:15
739500 -- (-681.150) (-684.721) [-684.996] (-681.283) * (-680.663) (-685.398) [-684.803] (-686.194) -- 0:00:15
740000 -- (-680.004) [-681.443] (-680.931) (-681.263) * (-682.363) (-680.985) (-681.109) [-682.105] -- 0:00:15
Average standard deviation of split frequencies: 0.009388
740500 -- (-680.264) (-681.588) (-684.017) [-681.119] * (-680.266) (-680.936) (-682.911) [-683.107] -- 0:00:15
741000 -- [-683.137] (-681.062) (-680.800) (-687.667) * (-684.513) [-682.087] (-685.137) (-685.442) -- 0:00:15
741500 -- (-687.880) (-682.495) [-680.734] (-680.290) * [-680.062] (-684.614) (-682.573) (-682.855) -- 0:00:15
742000 -- [-681.747] (-681.384) (-680.981) (-685.954) * [-680.450] (-681.616) (-682.512) (-681.241) -- 0:00:15
742500 -- (-681.052) [-680.906] (-681.209) (-679.765) * [-681.813] (-688.090) (-680.765) (-683.656) -- 0:00:15
743000 -- (-682.102) (-681.251) [-681.668] (-680.445) * (-681.448) [-682.440] (-684.566) (-682.914) -- 0:00:15
743500 -- (-681.050) (-682.734) [-680.738] (-681.942) * (-680.616) (-681.501) [-685.536] (-683.352) -- 0:00:15
744000 -- (-681.568) (-683.458) [-683.317] (-680.089) * [-681.771] (-682.887) (-682.379) (-683.434) -- 0:00:15
744500 -- (-680.703) [-683.764] (-680.977) (-680.985) * (-679.937) (-680.983) [-683.083] (-680.719) -- 0:00:15
745000 -- (-679.818) (-683.484) (-683.799) [-681.611] * (-681.443) (-681.201) [-683.943] (-682.442) -- 0:00:15
Average standard deviation of split frequencies: 0.009558
745500 -- (-680.552) [-680.850] (-680.343) (-682.326) * [-681.543] (-680.125) (-681.076) (-682.837) -- 0:00:15
746000 -- [-682.597] (-680.485) (-681.170) (-682.019) * (-682.419) (-681.884) (-683.814) [-681.086] -- 0:00:15
746500 -- (-681.813) (-683.680) (-681.693) [-683.581] * (-682.394) (-681.184) [-682.081] (-680.521) -- 0:00:15
747000 -- (-680.938) [-680.611] (-682.096) (-682.792) * (-680.504) (-681.727) [-681.880] (-681.825) -- 0:00:15
747500 -- (-683.177) (-681.046) (-685.583) [-686.450] * [-680.907] (-683.130) (-682.707) (-686.699) -- 0:00:15
748000 -- (-680.650) (-681.309) [-683.929] (-685.499) * [-681.106] (-685.418) (-687.426) (-679.924) -- 0:00:15
748500 -- (-682.495) (-682.811) [-682.971] (-682.072) * [-681.973] (-682.551) (-681.202) (-680.608) -- 0:00:15
749000 -- [-680.249] (-682.793) (-681.250) (-683.317) * [-680.202] (-681.715) (-681.150) (-681.871) -- 0:00:15
749500 -- (-680.580) [-686.948] (-682.318) (-680.433) * (-680.044) (-683.056) (-682.502) [-680.957] -- 0:00:15
750000 -- (-681.012) (-680.783) (-682.227) [-685.431] * (-680.616) (-682.969) (-682.950) [-680.173] -- 0:00:15
Average standard deviation of split frequencies: 0.009655
750500 -- (-680.375) [-683.852] (-680.332) (-680.048) * (-680.921) [-680.305] (-681.335) (-679.691) -- 0:00:14
751000 -- [-679.774] (-682.264) (-681.820) (-681.010) * [-682.180] (-682.827) (-682.525) (-681.536) -- 0:00:14
751500 -- (-679.937) [-680.361] (-685.978) (-682.579) * [-682.237] (-682.289) (-685.363) (-680.343) -- 0:00:14
752000 -- (-681.368) (-683.593) (-685.450) [-683.406] * (-681.143) [-680.738] (-684.502) (-681.774) -- 0:00:14
752500 -- (-683.007) [-680.205] (-682.889) (-683.014) * (-680.258) (-681.475) (-681.687) [-682.098] -- 0:00:14
753000 -- (-681.366) (-681.392) (-681.191) [-682.625] * (-681.135) (-680.876) [-681.694] (-680.821) -- 0:00:14
753500 -- (-681.454) (-686.669) [-681.031] (-682.987) * (-681.364) (-681.177) (-681.395) [-681.127] -- 0:00:14
754000 -- (-684.740) (-681.659) (-681.691) [-681.676] * (-683.325) (-680.104) (-682.458) [-680.315] -- 0:00:14
754500 -- (-682.081) (-683.356) [-683.043] (-689.335) * (-682.690) [-681.055] (-682.673) (-680.209) -- 0:00:14
755000 -- [-684.874] (-683.489) (-684.115) (-682.237) * (-680.932) [-681.601] (-683.511) (-681.021) -- 0:00:14
Average standard deviation of split frequencies: 0.009782
755500 -- (-680.597) [-685.134] (-687.726) (-686.572) * (-680.509) (-680.923) (-680.986) [-680.962] -- 0:00:14
756000 -- (-680.586) (-681.725) (-687.283) [-683.500] * (-686.361) (-682.735) [-681.980] (-681.380) -- 0:00:14
756500 -- (-679.567) (-680.070) [-681.913] (-682.089) * (-679.932) (-682.268) (-682.378) [-681.541] -- 0:00:14
757000 -- (-681.765) [-680.091] (-681.863) (-681.980) * [-679.827] (-679.970) (-682.232) (-683.336) -- 0:00:14
757500 -- (-680.763) [-680.639] (-681.300) (-680.062) * [-682.435] (-685.203) (-680.881) (-683.211) -- 0:00:14
758000 -- (-681.650) (-684.638) (-681.951) [-681.640] * (-685.458) [-682.189] (-684.266) (-684.265) -- 0:00:14
758500 -- [-680.582] (-681.437) (-682.380) (-684.468) * [-682.478] (-683.944) (-680.201) (-682.123) -- 0:00:14
759000 -- (-680.101) (-681.770) [-682.665] (-681.701) * [-682.427] (-683.787) (-680.353) (-683.181) -- 0:00:14
759500 -- (-680.113) (-680.024) [-679.716] (-681.133) * [-686.025] (-684.992) (-682.435) (-684.031) -- 0:00:14
760000 -- (-680.719) [-680.222] (-684.568) (-683.461) * (-681.324) (-682.489) (-684.959) [-682.533] -- 0:00:14
Average standard deviation of split frequencies: 0.009335
760500 -- [-683.959] (-683.999) (-680.302) (-683.856) * (-679.416) (-681.528) [-681.672] (-687.035) -- 0:00:14
761000 -- (-683.002) [-681.798] (-679.602) (-681.162) * [-681.113] (-680.653) (-684.554) (-683.366) -- 0:00:14
761500 -- (-681.348) (-680.794) (-684.030) [-681.097] * (-679.949) [-680.352] (-680.703) (-681.176) -- 0:00:14
762000 -- (-681.473) (-682.204) (-681.610) [-681.919] * [-682.303] (-680.465) (-682.668) (-681.578) -- 0:00:14
762500 -- (-680.357) (-681.328) (-680.250) [-681.949] * (-682.123) (-679.777) [-681.522] (-681.121) -- 0:00:14
763000 -- (-686.566) [-680.614] (-680.867) (-680.537) * [-681.143] (-682.659) (-683.707) (-680.732) -- 0:00:14
763500 -- (-679.881) (-693.222) [-681.200] (-682.290) * [-680.873] (-681.495) (-682.276) (-682.199) -- 0:00:14
764000 -- (-683.350) (-681.050) (-682.985) [-683.240] * (-684.399) (-681.258) [-681.477] (-687.623) -- 0:00:14
764500 -- (-680.319) (-685.960) [-683.751] (-680.895) * (-680.874) [-680.238] (-682.199) (-683.534) -- 0:00:14
765000 -- [-679.612] (-685.717) (-682.140) (-681.962) * [-680.511] (-683.521) (-681.653) (-681.437) -- 0:00:14
Average standard deviation of split frequencies: 0.009231
765500 -- (-680.824) (-687.576) [-680.054] (-683.975) * (-682.897) (-683.337) (-683.004) [-682.973] -- 0:00:14
766000 -- (-683.932) [-682.620] (-679.824) (-685.110) * (-679.932) (-683.363) [-680.330] (-682.142) -- 0:00:14
766500 -- (-681.501) (-681.856) (-681.337) [-681.879] * [-679.534] (-680.749) (-682.381) (-680.957) -- 0:00:14
767000 -- (-685.519) (-684.627) [-679.856] (-682.824) * (-683.217) (-680.736) [-681.578] (-680.057) -- 0:00:13
767500 -- (-680.013) [-680.385] (-681.957) (-681.283) * (-681.111) [-680.737] (-683.386) (-680.108) -- 0:00:13
768000 -- (-681.718) [-681.052] (-680.124) (-681.249) * (-682.767) [-679.951] (-684.551) (-680.502) -- 0:00:13
768500 -- [-682.089] (-682.733) (-680.505) (-684.494) * (-687.289) (-680.786) [-680.689] (-681.856) -- 0:00:13
769000 -- [-682.324] (-681.939) (-681.731) (-680.518) * (-685.239) (-681.052) (-680.027) [-682.501] -- 0:00:13
769500 -- (-681.589) (-684.238) (-680.679) [-682.640] * (-682.059) (-681.685) [-681.546] (-681.735) -- 0:00:13
770000 -- (-687.327) (-684.129) (-680.715) [-680.436] * (-681.414) (-682.472) (-681.244) [-682.641] -- 0:00:13
Average standard deviation of split frequencies: 0.009290
770500 -- (-684.079) (-682.205) (-683.082) [-680.154] * (-680.406) [-682.338] (-680.940) (-684.124) -- 0:00:13
771000 -- (-682.703) (-679.960) [-681.180] (-682.003) * (-684.714) (-679.725) (-680.930) [-679.935] -- 0:00:13
771500 -- (-680.357) (-684.389) [-680.231] (-683.973) * (-682.975) (-682.324) [-680.060] (-683.965) -- 0:00:13
772000 -- [-679.633] (-683.321) (-683.736) (-684.695) * (-682.602) [-681.110] (-680.391) (-683.060) -- 0:00:13
772500 -- [-681.019] (-683.174) (-681.342) (-684.989) * (-681.386) (-684.603) [-684.039] (-684.520) -- 0:00:13
773000 -- (-682.670) (-684.617) [-680.346] (-682.225) * [-682.501] (-685.143) (-681.673) (-681.445) -- 0:00:13
773500 -- (-681.591) (-681.116) (-682.915) [-682.008] * (-684.198) [-681.788] (-681.525) (-681.969) -- 0:00:13
774000 -- [-680.046] (-680.214) (-681.035) (-682.436) * (-681.706) (-680.160) (-680.915) [-683.892] -- 0:00:13
774500 -- (-681.376) [-686.229] (-681.571) (-681.027) * (-683.056) (-681.256) [-680.682] (-681.638) -- 0:00:13
775000 -- (-682.730) [-684.066] (-683.621) (-683.022) * (-686.355) (-683.831) (-680.604) [-682.312] -- 0:00:13
Average standard deviation of split frequencies: 0.009517
775500 -- (-682.990) (-683.364) (-682.066) [-683.759] * (-683.320) [-681.669] (-682.419) (-680.731) -- 0:00:13
776000 -- (-684.039) [-686.372] (-681.212) (-683.795) * (-680.221) (-682.340) (-679.897) [-680.850] -- 0:00:13
776500 -- [-680.994] (-681.578) (-683.595) (-682.619) * (-681.046) (-680.355) (-682.752) [-680.962] -- 0:00:13
777000 -- (-689.847) (-680.919) (-680.601) [-682.405] * (-680.500) (-683.289) [-680.524] (-682.445) -- 0:00:13
777500 -- (-683.043) (-682.590) [-683.295] (-681.035) * (-681.061) [-684.634] (-680.650) (-683.780) -- 0:00:13
778000 -- (-683.884) (-683.894) (-681.577) [-681.112] * (-683.284) (-681.746) [-679.916] (-683.770) -- 0:00:13
778500 -- [-681.654] (-686.199) (-684.633) (-681.189) * (-681.685) (-679.724) [-681.427] (-683.020) -- 0:00:13
779000 -- (-681.957) (-682.052) [-683.253] (-682.884) * [-683.949] (-679.659) (-681.951) (-684.024) -- 0:00:13
779500 -- (-684.648) (-680.410) (-679.780) [-683.004] * (-683.333) [-680.835] (-685.257) (-684.203) -- 0:00:13
780000 -- (-681.801) [-683.088] (-684.207) (-680.913) * (-681.177) [-681.455] (-680.690) (-680.872) -- 0:00:13
Average standard deviation of split frequencies: 0.009863
780500 -- (-682.926) (-679.644) (-684.325) [-679.964] * (-681.564) [-680.374] (-681.228) (-681.521) -- 0:00:13
781000 -- (-681.166) (-681.065) [-681.447] (-682.985) * (-684.319) (-681.577) [-685.555] (-682.226) -- 0:00:13
781500 -- [-681.987] (-690.227) (-682.172) (-680.291) * (-681.019) (-681.704) (-681.978) [-681.959] -- 0:00:13
782000 -- (-683.052) [-681.910] (-683.426) (-680.386) * (-681.557) (-680.966) (-681.286) [-682.669] -- 0:00:13
782500 -- (-682.643) (-683.022) (-682.070) [-681.679] * (-682.808) [-680.561] (-681.101) (-684.403) -- 0:00:13
783000 -- (-681.415) (-681.991) [-680.781] (-686.591) * (-681.548) (-680.599) (-680.378) [-682.406] -- 0:00:13
783500 -- (-680.665) [-680.572] (-681.925) (-681.990) * (-682.520) (-683.663) [-682.266] (-681.094) -- 0:00:12
784000 -- (-681.116) [-682.014] (-684.356) (-680.963) * (-680.737) (-680.342) (-681.288) [-680.086] -- 0:00:12
784500 -- (-682.581) [-680.214] (-683.172) (-680.975) * (-680.842) (-681.038) (-682.027) [-683.393] -- 0:00:12
785000 -- (-684.139) [-681.248] (-683.739) (-680.376) * [-680.450] (-680.127) (-680.219) (-681.972) -- 0:00:12
Average standard deviation of split frequencies: 0.009196
785500 -- (-683.397) (-682.289) (-683.929) [-687.925] * (-681.796) [-679.624] (-680.184) (-681.637) -- 0:00:12
786000 -- (-684.514) (-680.586) [-681.919] (-683.935) * (-680.015) (-682.469) [-684.474] (-682.477) -- 0:00:12
786500 -- (-685.607) (-683.188) (-681.396) [-683.846] * (-680.040) (-680.414) (-680.484) [-681.667] -- 0:00:12
787000 -- (-683.199) [-680.124] (-683.611) (-687.810) * (-680.835) (-682.860) [-680.339] (-687.566) -- 0:00:12
787500 -- (-683.328) (-681.102) (-680.319) [-682.244] * (-680.641) [-680.303] (-681.559) (-683.060) -- 0:00:12
788000 -- (-680.803) (-686.333) [-682.141] (-682.760) * [-681.113] (-682.453) (-684.027) (-683.092) -- 0:00:12
788500 -- (-680.238) (-680.877) [-680.688] (-681.463) * [-680.945] (-679.962) (-680.882) (-682.629) -- 0:00:12
789000 -- (-681.849) (-680.116) [-680.393] (-681.280) * [-680.557] (-680.767) (-681.745) (-684.862) -- 0:00:12
789500 -- (-684.653) [-679.982] (-680.023) (-683.360) * (-680.251) (-680.545) (-683.677) [-683.492] -- 0:00:12
790000 -- [-680.509] (-680.432) (-679.815) (-681.286) * (-684.293) [-681.654] (-683.550) (-684.036) -- 0:00:12
Average standard deviation of split frequencies: 0.009380
790500 -- (-680.305) [-681.066] (-680.599) (-684.257) * (-680.395) [-681.871] (-688.133) (-683.722) -- 0:00:12
791000 -- (-680.644) (-681.651) (-680.558) [-681.642] * (-681.862) [-682.343] (-681.053) (-682.205) -- 0:00:12
791500 -- (-681.036) [-680.206] (-682.444) (-680.319) * (-680.728) (-681.878) [-685.048] (-681.626) -- 0:00:12
792000 -- (-681.023) (-680.877) [-682.724] (-681.815) * (-682.044) (-683.231) [-682.965] (-683.515) -- 0:00:12
792500 -- (-680.245) [-684.713] (-683.202) (-681.103) * (-689.517) [-683.846] (-682.887) (-682.153) -- 0:00:12
793000 -- (-680.526) (-683.455) (-682.659) [-683.681] * (-686.676) (-684.059) (-682.616) [-683.807] -- 0:00:12
793500 -- (-681.396) (-683.302) [-680.125] (-685.278) * (-686.166) [-682.102] (-681.084) (-681.444) -- 0:00:12
794000 -- (-680.923) (-681.498) [-681.845] (-682.036) * (-684.428) (-685.932) [-680.463] (-681.071) -- 0:00:12
794500 -- (-681.585) [-682.600] (-681.903) (-683.367) * [-679.744] (-683.875) (-683.525) (-683.424) -- 0:00:12
795000 -- [-679.876] (-682.432) (-681.240) (-683.133) * (-685.381) [-683.574] (-683.598) (-680.759) -- 0:00:12
Average standard deviation of split frequencies: 0.009357
795500 -- (-679.905) (-683.940) [-682.851] (-683.184) * [-681.735] (-683.469) (-681.583) (-681.520) -- 0:00:12
796000 -- (-680.759) (-687.552) [-681.319] (-683.672) * (-682.041) [-684.439] (-680.271) (-681.056) -- 0:00:12
796500 -- [-682.048] (-681.338) (-681.161) (-684.142) * (-681.800) [-682.579] (-679.959) (-682.542) -- 0:00:12
797000 -- (-682.332) [-682.464] (-681.367) (-681.049) * [-680.529] (-680.435) (-682.846) (-680.598) -- 0:00:12
797500 -- (-680.806) (-679.760) [-679.850] (-680.738) * [-680.462] (-684.568) (-681.990) (-684.538) -- 0:00:12
798000 -- (-688.090) (-683.628) (-684.172) [-681.420] * (-682.443) (-682.394) [-685.873] (-681.106) -- 0:00:12
798500 -- [-681.988] (-685.194) (-681.064) (-682.095) * (-686.437) (-680.798) [-683.617] (-681.067) -- 0:00:12
799000 -- (-683.013) [-684.543] (-682.091) (-681.946) * (-680.203) (-679.930) (-683.772) [-681.393] -- 0:00:12
799500 -- (-683.364) (-683.782) [-685.177] (-686.430) * (-687.087) [-681.382] (-684.780) (-681.798) -- 0:00:12
800000 -- (-681.256) (-681.347) [-682.461] (-683.087) * (-684.183) (-681.040) (-683.268) [-680.476] -- 0:00:12
Average standard deviation of split frequencies: 0.009302
800500 -- [-681.454] (-681.576) (-680.410) (-680.615) * (-685.625) (-679.921) [-681.677] (-679.709) -- 0:00:11
801000 -- [-679.718] (-682.147) (-685.123) (-681.274) * (-682.267) (-681.036) (-680.600) [-680.341] -- 0:00:11
801500 -- (-681.384) [-682.973] (-681.243) (-682.126) * [-683.249] (-685.674) (-681.440) (-680.624) -- 0:00:11
802000 -- (-683.486) [-680.428] (-680.234) (-680.867) * [-680.931] (-681.008) (-681.329) (-681.335) -- 0:00:11
802500 -- (-681.915) (-680.279) [-680.571] (-682.898) * (-680.944) (-680.047) (-682.816) [-681.297] -- 0:00:11
803000 -- [-682.981] (-682.806) (-680.618) (-684.531) * [-683.133] (-680.302) (-686.416) (-680.742) -- 0:00:11
803500 -- (-682.017) [-681.838] (-684.287) (-682.850) * (-683.297) (-683.785) (-680.292) [-680.848] -- 0:00:11
804000 -- (-680.827) [-680.005] (-685.227) (-681.985) * (-685.090) [-681.491] (-680.690) (-681.960) -- 0:00:11
804500 -- [-680.387] (-682.819) (-684.200) (-681.223) * (-682.710) (-680.533) [-680.698] (-680.135) -- 0:00:11
805000 -- (-683.240) [-682.614] (-681.808) (-687.330) * (-684.616) (-680.951) (-680.692) [-682.584] -- 0:00:11
Average standard deviation of split frequencies: 0.009631
805500 -- (-681.406) (-684.254) [-682.303] (-686.144) * [-682.157] (-679.587) (-682.446) (-684.594) -- 0:00:11
806000 -- (-681.422) (-680.866) [-683.241] (-685.838) * [-679.820] (-680.607) (-683.148) (-682.882) -- 0:00:11
806500 -- (-684.912) (-683.040) (-681.058) [-679.922] * [-680.528] (-681.433) (-682.286) (-680.375) -- 0:00:11
807000 -- (-680.679) (-681.362) [-679.822] (-680.081) * (-680.301) [-681.026] (-685.339) (-680.614) -- 0:00:11
807500 -- (-686.359) [-681.733] (-681.927) (-682.022) * (-682.970) [-682.150] (-687.713) (-680.496) -- 0:00:11
808000 -- (-683.177) (-681.864) (-681.705) [-681.756] * [-682.688] (-680.079) (-681.804) (-680.530) -- 0:00:11
808500 -- (-685.214) (-683.066) [-681.544] (-680.499) * [-680.160] (-681.254) (-681.380) (-684.922) -- 0:00:11
809000 -- [-682.496] (-684.168) (-681.520) (-681.063) * (-680.304) [-681.394] (-680.495) (-681.564) -- 0:00:11
809500 -- (-681.609) (-684.087) [-685.001] (-680.111) * (-683.353) (-682.991) [-680.773] (-682.900) -- 0:00:11
810000 -- (-680.852) [-681.557] (-686.229) (-680.471) * (-680.519) [-681.450] (-681.823) (-682.774) -- 0:00:11
Average standard deviation of split frequencies: 0.009653
810500 -- (-684.834) [-683.507] (-683.237) (-681.382) * (-684.459) [-679.597] (-679.971) (-682.804) -- 0:00:11
811000 -- (-683.296) (-683.584) [-682.384] (-681.994) * [-680.488] (-681.656) (-683.254) (-685.100) -- 0:00:11
811500 -- (-685.075) (-684.610) [-683.095] (-683.674) * (-682.264) (-681.487) [-683.140] (-681.630) -- 0:00:11
812000 -- (-683.941) (-684.772) (-686.878) [-686.963] * (-683.055) (-682.926) [-682.381] (-681.493) -- 0:00:11
812500 -- (-681.522) (-682.661) [-684.499] (-683.356) * [-679.896] (-681.794) (-681.665) (-682.582) -- 0:00:11
813000 -- [-682.494] (-682.093) (-680.202) (-679.697) * (-684.361) [-682.622] (-681.867) (-681.911) -- 0:00:11
813500 -- (-682.423) (-684.203) [-679.939] (-682.143) * (-681.921) (-681.810) [-681.645] (-680.883) -- 0:00:11
814000 -- [-682.362] (-685.529) (-681.727) (-680.293) * [-679.769] (-684.303) (-682.624) (-685.797) -- 0:00:11
814500 -- (-685.043) (-681.783) [-680.801] (-682.207) * (-680.743) [-682.956] (-681.858) (-687.828) -- 0:00:11
815000 -- (-682.907) [-683.549] (-679.975) (-684.297) * (-680.864) [-682.000] (-682.403) (-687.270) -- 0:00:11
Average standard deviation of split frequencies: 0.009551
815500 -- [-680.734] (-682.108) (-681.140) (-682.214) * (-680.314) [-680.760] (-685.020) (-681.505) -- 0:00:11
816000 -- [-681.003] (-682.992) (-681.113) (-684.260) * (-680.242) [-681.253] (-685.733) (-682.285) -- 0:00:11
816500 -- (-680.648) (-682.223) (-680.897) [-686.488] * (-680.769) [-683.247] (-682.024) (-681.868) -- 0:00:11
817000 -- [-680.233] (-683.029) (-682.475) (-683.241) * [-681.783] (-683.219) (-681.952) (-679.999) -- 0:00:10
817500 -- (-683.367) [-681.534] (-681.120) (-682.188) * [-680.337] (-682.543) (-682.251) (-681.743) -- 0:00:10
818000 -- (-682.939) (-681.575) (-681.128) [-680.848] * (-681.647) (-681.874) (-681.518) [-684.447] -- 0:00:10
818500 -- (-683.787) (-679.575) [-682.757] (-680.258) * (-685.026) (-681.086) (-682.327) [-681.630] -- 0:00:10
819000 -- (-680.496) (-680.493) (-680.106) [-680.173] * (-681.946) (-684.945) (-681.080) [-680.175] -- 0:00:10
819500 -- [-684.138] (-683.208) (-682.531) (-680.991) * (-682.065) (-683.404) [-679.764] (-680.302) -- 0:00:10
820000 -- [-680.453] (-681.440) (-684.149) (-681.258) * (-682.203) (-682.620) [-681.512] (-690.765) -- 0:00:10
Average standard deviation of split frequencies: 0.009727
820500 -- (-681.040) [-680.570] (-680.335) (-682.308) * (-680.979) [-680.317] (-682.742) (-687.525) -- 0:00:10
821000 -- [-682.533] (-681.480) (-681.438) (-683.287) * (-682.346) [-681.728] (-683.634) (-682.993) -- 0:00:10
821500 -- (-681.596) (-681.149) (-684.081) [-680.305] * (-682.149) (-681.458) (-682.590) [-680.175] -- 0:00:10
822000 -- (-680.943) [-679.827] (-681.821) (-682.316) * (-681.269) (-682.024) (-684.381) [-681.071] -- 0:00:10
822500 -- (-680.098) (-679.961) (-682.731) [-683.248] * [-680.176] (-683.498) (-683.556) (-682.529) -- 0:00:10
823000 -- (-682.985) (-679.825) (-680.252) [-680.344] * [-679.984] (-685.052) (-680.710) (-688.420) -- 0:00:10
823500 -- (-681.457) (-684.332) [-680.990] (-680.435) * (-681.059) [-680.352] (-682.304) (-681.049) -- 0:00:10
824000 -- (-679.715) (-684.216) [-682.293] (-680.824) * (-683.831) (-683.078) [-682.384] (-679.863) -- 0:00:10
824500 -- (-679.610) (-684.985) [-680.228] (-680.694) * (-681.389) (-684.859) [-680.734] (-682.424) -- 0:00:10
825000 -- (-681.466) (-679.701) [-682.359] (-680.827) * (-679.516) (-681.788) (-681.243) [-682.896] -- 0:00:10
Average standard deviation of split frequencies: 0.009588
825500 -- [-684.562] (-681.512) (-680.060) (-681.118) * (-679.583) (-680.212) [-682.485] (-686.004) -- 0:00:10
826000 -- (-681.255) (-680.675) [-681.007] (-679.673) * (-680.169) (-680.670) [-685.395] (-684.168) -- 0:00:10
826500 -- (-680.890) [-680.030] (-681.941) (-682.773) * (-680.726) [-681.137] (-684.400) (-685.516) -- 0:00:10
827000 -- (-683.132) (-681.094) (-683.490) [-682.346] * [-682.361] (-682.121) (-685.760) (-681.582) -- 0:00:10
827500 -- (-682.163) (-681.114) [-687.146] (-681.732) * [-683.686] (-683.972) (-680.589) (-680.473) -- 0:00:10
828000 -- (-680.930) (-681.160) (-684.288) [-683.291] * [-681.653] (-680.113) (-681.474) (-681.893) -- 0:00:10
828500 -- (-682.389) (-680.313) (-683.282) [-682.071] * [-683.065] (-682.351) (-683.372) (-684.829) -- 0:00:10
829000 -- (-680.006) [-681.335] (-684.977) (-681.195) * (-681.875) (-683.094) [-683.508] (-684.394) -- 0:00:10
829500 -- (-684.639) (-684.209) (-681.452) [-681.236] * (-682.639) (-686.039) [-680.866] (-683.487) -- 0:00:10
830000 -- [-681.415] (-684.053) (-682.373) (-680.914) * (-680.493) [-685.594] (-682.253) (-681.504) -- 0:00:10
Average standard deviation of split frequencies: 0.009534
830500 -- (-685.679) (-682.533) [-681.991] (-680.281) * [-680.424] (-681.158) (-682.230) (-681.905) -- 0:00:10
831000 -- (-681.632) (-682.327) [-682.018] (-681.270) * (-684.777) (-680.443) (-683.442) [-682.044] -- 0:00:10
831500 -- (-682.338) (-684.507) [-681.442] (-683.444) * (-681.327) [-681.777] (-681.291) (-682.713) -- 0:00:10
832000 -- (-687.279) [-681.928] (-682.463) (-684.364) * (-679.955) (-681.197) [-681.767] (-682.113) -- 0:00:10
832500 -- (-688.188) (-683.631) (-684.191) [-680.709] * (-681.103) (-682.455) (-685.755) [-683.122] -- 0:00:10
833000 -- (-689.351) (-680.795) (-686.596) [-680.244] * (-680.761) (-683.821) (-685.511) [-680.231] -- 0:00:10
833500 -- [-683.601] (-681.325) (-682.337) (-687.081) * (-682.387) (-681.146) (-685.131) [-681.994] -- 0:00:09
834000 -- (-680.382) (-681.986) [-683.415] (-685.214) * [-681.963] (-681.976) (-681.897) (-680.204) -- 0:00:09
834500 -- (-682.842) [-681.583] (-682.195) (-680.389) * [-680.134] (-684.998) (-680.347) (-680.204) -- 0:00:09
835000 -- (-680.149) (-681.778) [-681.911] (-680.361) * (-680.886) (-681.448) [-681.903] (-683.013) -- 0:00:09
Average standard deviation of split frequencies: 0.009398
835500 -- (-681.504) [-680.693] (-683.883) (-683.415) * (-682.597) (-680.432) [-679.804] (-681.820) -- 0:00:09
836000 -- (-684.014) (-681.606) [-679.918] (-682.633) * (-680.696) (-681.575) (-680.668) [-681.994] -- 0:00:09
836500 -- (-682.348) [-682.251] (-683.417) (-681.384) * (-679.989) (-680.703) (-680.545) [-680.959] -- 0:00:09
837000 -- [-682.059] (-682.278) (-680.704) (-681.107) * (-682.134) [-680.352] (-681.515) (-680.067) -- 0:00:09
837500 -- (-682.379) (-682.762) [-683.228] (-680.684) * (-683.848) (-682.158) [-680.719] (-680.460) -- 0:00:09
838000 -- (-681.007) (-682.594) [-680.580] (-680.750) * (-682.710) (-681.821) (-683.047) [-684.777] -- 0:00:09
838500 -- (-681.219) (-685.076) (-681.849) [-681.183] * (-683.763) (-681.464) (-683.331) [-684.001] -- 0:00:09
839000 -- (-681.925) [-682.228] (-682.232) (-681.776) * [-682.322] (-680.911) (-682.427) (-682.471) -- 0:00:09
839500 -- [-680.876] (-681.950) (-679.965) (-682.107) * (-682.400) (-682.404) (-682.894) [-685.984] -- 0:00:09
840000 -- (-684.353) (-680.451) [-681.663] (-680.473) * (-683.345) (-682.328) (-681.722) [-685.105] -- 0:00:09
Average standard deviation of split frequencies: 0.008785
840500 -- [-683.483] (-682.418) (-686.003) (-680.612) * (-686.236) [-682.662] (-681.926) (-680.174) -- 0:00:09
841000 -- (-683.000) (-680.183) [-681.744] (-681.198) * [-683.368] (-680.603) (-681.444) (-681.036) -- 0:00:09
841500 -- [-681.080] (-685.587) (-682.893) (-681.742) * (-683.297) [-680.936] (-681.841) (-684.275) -- 0:00:09
842000 -- [-680.535] (-682.137) (-685.791) (-681.429) * (-680.261) (-684.060) [-681.465] (-684.435) -- 0:00:09
842500 -- [-681.087] (-681.133) (-681.313) (-682.282) * (-683.435) (-680.972) [-681.462] (-680.593) -- 0:00:09
843000 -- [-682.550] (-682.921) (-680.111) (-682.576) * (-682.878) (-680.482) [-680.784] (-680.109) -- 0:00:09
843500 -- [-680.745] (-683.423) (-680.335) (-680.197) * [-682.302] (-686.605) (-680.661) (-683.270) -- 0:00:09
844000 -- (-681.007) (-682.562) [-679.908] (-681.699) * (-682.176) (-685.412) [-679.609] (-681.144) -- 0:00:09
844500 -- [-680.854] (-680.444) (-679.945) (-685.685) * [-681.429] (-680.685) (-680.494) (-681.751) -- 0:00:09
845000 -- (-682.959) [-683.302] (-687.194) (-685.136) * (-683.090) [-683.259] (-683.523) (-681.674) -- 0:00:09
Average standard deviation of split frequencies: 0.008655
845500 -- [-680.677] (-681.186) (-685.907) (-685.453) * [-680.457] (-682.141) (-682.516) (-681.806) -- 0:00:09
846000 -- [-680.695] (-683.005) (-688.002) (-684.264) * (-681.895) (-681.445) (-682.512) [-682.282] -- 0:00:09
846500 -- (-682.749) [-682.117] (-688.393) (-683.369) * (-680.517) (-681.081) (-682.817) [-683.830] -- 0:00:09
847000 -- (-684.903) (-682.702) [-684.492] (-681.688) * [-682.042] (-685.552) (-685.710) (-684.213) -- 0:00:09
847500 -- (-686.050) [-680.028] (-682.512) (-684.357) * (-682.282) (-688.246) [-683.761] (-680.765) -- 0:00:09
848000 -- (-684.234) (-681.195) [-682.353] (-681.368) * (-682.805) (-687.058) [-683.283] (-682.917) -- 0:00:09
848500 -- (-681.224) (-682.852) [-683.109] (-681.412) * (-686.183) (-687.948) [-680.956] (-681.654) -- 0:00:09
849000 -- (-681.210) (-681.288) [-681.225] (-682.905) * (-686.009) [-685.193] (-681.134) (-679.626) -- 0:00:09
849500 -- (-680.614) (-681.283) [-680.527] (-684.040) * (-680.009) (-680.835) (-682.081) [-680.093] -- 0:00:09
850000 -- (-679.789) [-680.955] (-682.447) (-683.723) * (-684.699) [-681.809] (-682.370) (-680.824) -- 0:00:09
Average standard deviation of split frequencies: 0.007906
850500 -- (-681.061) (-683.700) [-686.098] (-682.119) * (-683.369) (-680.888) [-682.065] (-679.698) -- 0:00:08
851000 -- (-682.445) (-683.659) [-682.234] (-681.645) * (-685.031) [-683.900] (-681.498) (-680.945) -- 0:00:08
851500 -- (-682.550) (-683.371) [-682.520] (-681.760) * (-682.130) (-683.820) (-680.518) [-680.093] -- 0:00:08
852000 -- (-680.447) (-682.464) (-681.610) [-681.138] * [-682.089] (-682.520) (-683.559) (-680.825) -- 0:00:08
852500 -- [-680.510] (-682.193) (-682.302) (-682.255) * (-681.934) (-681.213) (-682.946) [-682.362] -- 0:00:08
853000 -- (-687.294) (-682.316) (-681.418) [-683.332] * (-682.214) (-680.560) (-683.172) [-679.607] -- 0:00:08
853500 -- (-684.510) [-680.955] (-683.181) (-682.206) * (-682.643) [-680.509] (-682.979) (-681.099) -- 0:00:08
854000 -- (-680.296) (-680.508) [-681.892] (-680.567) * (-683.900) (-682.400) [-681.821] (-680.565) -- 0:00:08
854500 -- (-680.445) (-680.787) (-681.262) [-680.765] * (-682.645) (-681.316) (-685.059) [-680.673] -- 0:00:08
855000 -- [-680.252] (-680.519) (-680.616) (-683.711) * (-681.477) (-680.118) (-682.075) [-680.355] -- 0:00:08
Average standard deviation of split frequencies: 0.007600
855500 -- [-682.935] (-681.593) (-681.434) (-680.917) * (-685.085) (-688.389) (-681.451) [-682.728] -- 0:00:08
856000 -- (-685.224) (-680.897) [-679.974] (-682.587) * (-680.344) (-686.009) (-682.272) [-682.214] -- 0:00:08
856500 -- [-680.142] (-684.217) (-681.610) (-683.174) * (-679.788) (-686.550) (-690.788) [-681.980] -- 0:00:08
857000 -- (-681.927) (-684.569) (-685.653) [-683.719] * (-680.809) [-683.108] (-683.162) (-683.182) -- 0:00:08
857500 -- (-683.953) (-685.685) [-681.183] (-681.121) * [-680.682] (-682.594) (-680.818) (-680.298) -- 0:00:08
858000 -- [-683.557] (-685.758) (-682.936) (-681.765) * (-684.463) [-680.592] (-681.109) (-682.151) -- 0:00:08
858500 -- (-686.928) (-684.345) [-681.455] (-682.243) * (-684.329) (-682.139) [-681.372] (-683.448) -- 0:00:08
859000 -- [-689.578] (-681.991) (-682.394) (-679.970) * (-680.141) (-680.018) (-681.906) [-684.950] -- 0:00:08
859500 -- (-681.130) (-680.360) (-682.955) [-680.978] * (-680.169) (-680.018) [-680.245] (-683.285) -- 0:00:08
860000 -- (-682.563) (-681.484) (-683.516) [-682.686] * (-683.001) (-681.340) [-682.463] (-687.439) -- 0:00:08
Average standard deviation of split frequencies: 0.007559
860500 -- [-682.274] (-680.547) (-680.317) (-684.863) * (-681.461) (-683.190) [-684.172] (-681.218) -- 0:00:08
861000 -- (-681.317) (-680.612) (-682.407) [-688.048] * (-679.988) (-681.389) (-686.175) [-680.889] -- 0:00:08
861500 -- (-684.483) [-683.753] (-680.900) (-686.334) * [-679.803] (-680.161) (-681.515) (-681.716) -- 0:00:08
862000 -- (-682.321) (-685.607) (-685.350) [-684.373] * [-680.352] (-681.774) (-681.830) (-682.220) -- 0:00:08
862500 -- (-681.159) (-681.383) (-683.004) [-680.833] * (-679.870) [-681.176] (-681.670) (-686.246) -- 0:00:08
863000 -- (-681.402) [-685.053] (-683.600) (-686.600) * (-680.360) (-681.014) (-683.495) [-684.687] -- 0:00:08
863500 -- (-681.598) (-682.360) [-685.201] (-683.827) * (-681.676) [-683.811] (-682.255) (-681.620) -- 0:00:08
864000 -- [-680.569] (-682.526) (-684.510) (-682.372) * (-682.231) (-682.640) [-681.558] (-680.325) -- 0:00:08
864500 -- (-681.434) [-681.856] (-681.859) (-681.166) * [-682.744] (-684.543) (-681.225) (-682.974) -- 0:00:08
865000 -- (-682.084) (-681.534) [-683.490] (-681.763) * [-679.802] (-682.474) (-680.959) (-683.684) -- 0:00:08
Average standard deviation of split frequencies: 0.006968
865500 -- [-682.039] (-680.966) (-682.785) (-681.292) * (-680.912) [-682.271] (-682.449) (-682.249) -- 0:00:08
866000 -- [-682.081] (-681.462) (-682.227) (-683.033) * (-680.714) (-680.256) (-682.076) [-682.103] -- 0:00:08
866500 -- (-680.093) (-681.079) (-679.907) [-681.779] * [-681.932] (-680.540) (-681.191) (-680.751) -- 0:00:08
867000 -- (-682.411) (-682.796) [-681.822] (-680.433) * (-680.919) [-683.110] (-680.387) (-685.292) -- 0:00:07
867500 -- [-681.595] (-682.500) (-681.041) (-684.137) * (-681.032) (-682.846) [-681.615] (-685.485) -- 0:00:07
868000 -- (-682.570) [-682.086] (-682.485) (-680.827) * [-680.742] (-680.611) (-681.214) (-686.468) -- 0:00:07
868500 -- (-680.892) (-682.071) (-685.361) [-680.579] * (-679.872) [-682.585] (-680.264) (-681.359) -- 0:00:07
869000 -- (-683.405) (-681.998) (-681.043) [-684.441] * (-680.776) [-679.826] (-681.643) (-685.375) -- 0:00:07
869500 -- (-680.504) (-679.903) [-681.530] (-685.730) * (-682.062) (-680.424) [-680.260] (-684.774) -- 0:00:07
870000 -- [-680.771] (-681.947) (-681.537) (-683.671) * [-681.168] (-681.035) (-683.021) (-682.071) -- 0:00:07
Average standard deviation of split frequencies: 0.007255
870500 -- [-679.932] (-681.635) (-680.978) (-682.296) * (-680.087) (-683.969) [-680.983] (-681.605) -- 0:00:07
871000 -- (-683.148) [-682.170] (-682.308) (-681.384) * [-680.877] (-682.905) (-680.234) (-681.655) -- 0:00:07
871500 -- [-682.563] (-683.999) (-679.733) (-682.223) * (-682.593) [-680.423] (-680.882) (-680.981) -- 0:00:07
872000 -- (-686.656) (-680.975) (-679.771) [-681.460] * [-680.669] (-681.496) (-679.875) (-682.805) -- 0:00:07
872500 -- (-684.759) (-684.606) (-679.653) [-684.357] * (-680.366) (-682.622) [-683.930] (-681.378) -- 0:00:07
873000 -- (-680.711) (-682.603) (-679.946) [-682.397] * (-681.161) (-682.095) (-686.366) [-680.367] -- 0:00:07
873500 -- (-681.422) (-680.639) [-680.367] (-681.020) * [-681.852] (-682.685) (-688.861) (-682.743) -- 0:00:07
874000 -- (-680.694) [-682.912] (-681.210) (-685.198) * (-681.290) (-681.242) (-685.394) [-681.530] -- 0:00:07
874500 -- (-680.763) (-683.608) (-679.843) [-686.496] * (-681.070) (-684.218) (-685.269) [-680.591] -- 0:00:07
875000 -- (-680.269) (-680.206) (-684.863) [-683.986] * (-681.148) (-680.719) (-683.501) [-679.893] -- 0:00:07
Average standard deviation of split frequencies: 0.007677
875500 -- (-680.259) [-684.118] (-681.898) (-685.058) * [-680.534] (-681.899) (-682.490) (-680.142) -- 0:00:07
876000 -- [-682.331] (-680.772) (-680.344) (-682.279) * (-683.495) [-679.751] (-683.460) (-679.573) -- 0:00:07
876500 -- (-682.250) (-680.013) (-681.885) [-683.272] * (-681.258) (-685.606) (-686.043) [-679.710] -- 0:00:07
877000 -- (-685.196) (-681.797) (-682.007) [-679.753] * (-681.463) (-685.917) [-682.034] (-681.052) -- 0:00:07
877500 -- [-683.412] (-683.108) (-683.512) (-680.715) * (-683.140) (-680.389) [-683.395] (-681.531) -- 0:00:07
878000 -- (-682.774) (-682.932) (-683.425) [-680.153] * [-681.272] (-685.203) (-681.275) (-682.985) -- 0:00:07
878500 -- (-680.280) (-682.883) (-682.944) [-680.426] * [-680.075] (-681.675) (-679.892) (-683.132) -- 0:00:07
879000 -- (-681.906) (-684.015) (-681.115) [-685.055] * (-682.335) (-680.720) [-684.116] (-682.611) -- 0:00:07
879500 -- (-684.063) (-682.746) [-680.265] (-681.117) * (-680.941) (-680.899) [-682.809] (-680.370) -- 0:00:07
880000 -- (-682.051) (-686.543) [-680.381] (-681.039) * (-682.880) (-684.895) (-682.977) [-680.169] -- 0:00:07
Average standard deviation of split frequencies: 0.007458
880500 -- (-683.858) (-681.877) [-682.950] (-682.333) * (-682.348) [-684.392] (-682.275) (-687.208) -- 0:00:07
881000 -- [-683.961] (-683.690) (-681.052) (-681.818) * (-680.878) (-680.993) [-682.248] (-687.976) -- 0:00:07
881500 -- [-682.983] (-683.335) (-683.996) (-680.438) * (-680.393) [-681.162] (-682.178) (-683.692) -- 0:00:07
882000 -- [-683.228] (-680.234) (-682.236) (-680.503) * [-680.387] (-681.483) (-682.922) (-681.985) -- 0:00:07
882500 -- (-681.120) (-680.621) [-682.273] (-682.845) * [-680.518] (-680.342) (-682.238) (-681.289) -- 0:00:07
883000 -- (-689.093) (-683.155) (-681.738) [-681.294] * [-683.570] (-680.675) (-680.257) (-681.082) -- 0:00:07
883500 -- (-681.130) [-681.615] (-683.575) (-683.105) * (-684.650) [-680.756] (-680.649) (-680.934) -- 0:00:06
884000 -- (-683.379) [-683.430] (-681.488) (-680.216) * (-684.553) [-686.737] (-683.112) (-683.579) -- 0:00:06
884500 -- (-680.450) [-681.675] (-681.437) (-680.089) * (-684.299) [-682.549] (-681.229) (-680.167) -- 0:00:06
885000 -- (-685.174) (-681.863) [-679.718] (-681.363) * (-681.810) (-680.374) (-681.080) [-680.516] -- 0:00:06
Average standard deviation of split frequencies: 0.007342
885500 -- (-682.114) (-682.932) [-681.741] (-681.701) * [-680.485] (-681.661) (-683.443) (-681.235) -- 0:00:06
886000 -- [-681.286] (-682.768) (-681.460) (-685.183) * (-681.648) (-684.245) [-680.526] (-681.243) -- 0:00:06
886500 -- (-684.194) [-682.554] (-681.763) (-684.426) * (-682.376) (-682.119) (-682.366) [-682.368] -- 0:00:06
887000 -- [-681.709] (-682.039) (-685.882) (-681.630) * (-683.663) (-682.009) (-679.867) [-682.477] -- 0:00:06
887500 -- [-687.352] (-682.998) (-683.435) (-681.390) * (-683.952) [-680.065] (-680.505) (-682.063) -- 0:00:06
888000 -- (-689.283) (-682.465) [-680.442] (-681.365) * (-681.218) (-687.047) [-681.558] (-683.454) -- 0:00:06
888500 -- [-680.987] (-683.551) (-685.342) (-680.942) * (-684.886) (-681.233) (-681.228) [-682.051] -- 0:00:06
889000 -- [-683.398] (-686.583) (-685.214) (-681.396) * (-683.947) (-680.698) [-682.406] (-680.547) -- 0:00:06
889500 -- (-681.011) (-683.263) (-682.580) [-683.352] * (-680.437) (-684.543) [-680.997] (-682.227) -- 0:00:06
890000 -- (-680.868) (-680.114) (-683.637) [-683.485] * (-680.596) (-687.077) [-683.212] (-680.966) -- 0:00:06
Average standard deviation of split frequencies: 0.007092
890500 -- (-679.979) (-681.821) [-682.855] (-682.826) * (-682.121) [-682.183] (-682.234) (-681.520) -- 0:00:06
891000 -- [-684.477] (-681.553) (-685.200) (-680.433) * (-681.177) (-685.416) (-681.838) [-680.922] -- 0:00:06
891500 -- [-682.124] (-680.783) (-684.158) (-681.816) * (-679.522) (-684.876) (-684.279) [-682.559] -- 0:00:06
892000 -- [-681.183] (-681.080) (-684.055) (-685.139) * (-680.375) [-680.213] (-682.279) (-682.364) -- 0:00:06
892500 -- (-679.828) (-683.083) (-681.276) [-682.026] * [-683.401] (-682.551) (-680.992) (-682.906) -- 0:00:06
893000 -- (-679.705) (-683.156) [-682.208] (-680.341) * (-683.911) (-685.138) [-681.607] (-682.329) -- 0:00:06
893500 -- (-681.125) (-684.216) (-681.308) [-679.731] * (-681.023) (-688.970) (-686.890) [-679.607] -- 0:00:06
894000 -- [-681.902] (-686.437) (-681.308) (-683.002) * (-680.458) [-685.396] (-683.081) (-681.404) -- 0:00:06
894500 -- (-680.754) (-683.041) (-683.108) [-683.569] * (-680.976) (-681.629) [-681.427] (-684.120) -- 0:00:06
895000 -- [-679.975] (-682.923) (-683.439) (-682.945) * (-681.554) (-681.213) [-681.277] (-686.147) -- 0:00:06
Average standard deviation of split frequencies: 0.006910
895500 -- (-680.332) [-681.736] (-683.560) (-680.957) * [-682.645] (-683.407) (-682.337) (-681.498) -- 0:00:06
896000 -- [-680.625] (-681.680) (-682.894) (-680.622) * (-684.617) (-682.764) (-681.783) [-679.964] -- 0:00:06
896500 -- (-680.454) (-683.579) (-683.536) [-680.127] * (-684.410) (-681.426) [-681.459] (-681.904) -- 0:00:06
897000 -- (-682.495) (-685.839) [-683.177] (-684.563) * (-680.385) [-683.670] (-683.884) (-686.004) -- 0:00:06
897500 -- (-683.860) (-679.969) [-680.151] (-684.210) * (-679.555) (-685.326) [-680.138] (-682.902) -- 0:00:06
898000 -- (-683.679) (-680.415) (-680.384) [-682.543] * (-681.246) (-681.216) [-680.302] (-684.825) -- 0:00:06
898500 -- [-682.382] (-680.316) (-680.546) (-682.521) * (-681.706) (-682.259) [-682.319] (-685.190) -- 0:00:06
899000 -- (-681.724) [-681.837] (-681.066) (-681.032) * (-680.086) [-681.083] (-688.780) (-686.197) -- 0:00:06
899500 -- (-680.610) (-685.504) [-680.396] (-683.840) * [-681.734] (-682.640) (-682.298) (-684.811) -- 0:00:06
900000 -- (-680.749) [-681.234] (-681.992) (-683.352) * (-685.686) (-680.153) (-681.173) [-680.601] -- 0:00:06
Average standard deviation of split frequencies: 0.006490
900500 -- [-680.471] (-682.129) (-683.333) (-684.016) * (-682.191) (-682.522) [-681.070] (-681.598) -- 0:00:05
901000 -- (-680.996) [-682.939] (-689.881) (-686.934) * (-680.209) (-682.182) (-682.880) [-683.202] -- 0:00:05
901500 -- (-681.553) [-681.245] (-681.982) (-684.895) * (-682.245) [-680.812] (-684.475) (-682.680) -- 0:00:05
902000 -- (-683.089) (-681.304) [-680.603] (-683.655) * [-681.702] (-681.235) (-682.537) (-680.758) -- 0:00:05
902500 -- (-682.372) (-680.196) [-681.819] (-683.123) * (-681.983) (-683.105) (-681.991) [-682.336] -- 0:00:05
903000 -- [-681.374] (-682.136) (-683.020) (-681.746) * [-684.133] (-682.008) (-685.992) (-683.967) -- 0:00:05
903500 -- [-680.542] (-683.523) (-682.909) (-680.430) * (-684.073) [-681.173] (-682.388) (-680.957) -- 0:00:05
904000 -- (-681.394) (-682.007) [-681.881] (-680.028) * (-681.242) (-681.048) (-682.646) [-680.995] -- 0:00:05
904500 -- [-681.412] (-679.874) (-682.442) (-690.105) * (-681.196) [-682.592] (-682.754) (-683.821) -- 0:00:05
905000 -- [-682.137] (-681.336) (-681.669) (-682.005) * (-685.574) (-680.689) (-683.685) [-682.435] -- 0:00:05
Average standard deviation of split frequencies: 0.006487
905500 -- (-682.394) (-681.802) (-680.415) [-682.963] * (-680.984) (-681.566) [-681.055] (-681.814) -- 0:00:05
906000 -- (-683.620) (-688.108) [-683.394] (-680.904) * (-681.113) (-681.063) (-680.079) [-687.474] -- 0:00:05
906500 -- (-682.415) [-686.023] (-681.782) (-681.569) * [-681.712] (-681.890) (-684.864) (-683.440) -- 0:00:05
907000 -- (-680.920) (-682.721) [-681.339] (-680.223) * (-684.363) [-681.300] (-681.578) (-681.936) -- 0:00:05
907500 -- [-681.689] (-682.069) (-682.528) (-684.998) * (-683.510) (-681.408) [-682.578] (-680.824) -- 0:00:05
908000 -- [-684.481] (-683.680) (-681.969) (-681.330) * [-681.767] (-684.599) (-681.175) (-683.047) -- 0:00:05
908500 -- (-682.580) (-681.830) (-682.728) [-681.533] * (-681.072) [-684.494] (-682.979) (-682.678) -- 0:00:05
909000 -- (-680.653) [-682.566] (-683.350) (-683.577) * [-681.580] (-682.393) (-686.709) (-681.787) -- 0:00:05
909500 -- (-681.183) (-682.148) (-679.823) [-682.015] * (-680.544) [-683.219] (-683.518) (-680.855) -- 0:00:05
910000 -- (-680.672) (-684.975) (-680.718) [-680.607] * (-684.213) [-680.787] (-680.493) (-680.504) -- 0:00:05
Average standard deviation of split frequencies: 0.006384
910500 -- (-682.591) (-683.042) (-682.200) [-682.740] * (-681.463) [-684.924] (-681.765) (-683.802) -- 0:00:05
911000 -- (-684.579) (-681.069) [-681.985] (-681.500) * [-680.395] (-680.015) (-687.916) (-684.615) -- 0:00:05
911500 -- (-683.447) [-682.018] (-682.060) (-680.799) * (-681.204) (-683.726) (-686.650) [-684.009] -- 0:00:05
912000 -- (-680.312) (-681.985) (-680.809) [-680.325] * (-681.799) (-681.681) (-684.940) [-682.619] -- 0:00:05
912500 -- (-682.278) (-680.592) [-680.317] (-680.325) * (-681.629) (-681.287) (-686.149) [-679.866] -- 0:00:05
913000 -- (-683.546) (-682.461) (-685.254) [-681.274] * [-682.017] (-681.979) (-683.158) (-680.866) -- 0:00:05
913500 -- (-683.319) [-681.367] (-680.571) (-680.603) * (-681.863) (-686.349) (-680.788) [-683.366] -- 0:00:05
914000 -- [-679.940] (-682.369) (-687.590) (-680.131) * (-687.669) (-680.327) (-682.100) [-684.516] -- 0:00:05
914500 -- (-681.111) (-681.540) [-682.431] (-682.745) * (-686.254) (-680.352) (-685.567) [-681.699] -- 0:00:05
915000 -- (-682.713) [-685.212] (-680.128) (-682.637) * (-685.804) (-683.917) [-680.600] (-681.605) -- 0:00:05
Average standard deviation of split frequencies: 0.006827
915500 -- (-680.525) (-682.216) [-683.327] (-683.025) * (-682.450) (-682.129) [-680.590] (-681.413) -- 0:00:05
916000 -- (-683.545) (-681.206) (-683.793) [-681.592] * (-683.187) (-682.768) (-682.277) [-682.261] -- 0:00:05
916500 -- (-682.447) (-680.425) [-683.370] (-683.129) * (-683.614) (-680.833) (-682.352) [-685.839] -- 0:00:05
917000 -- (-681.317) [-683.125] (-682.692) (-682.494) * [-681.593] (-683.019) (-680.907) (-684.591) -- 0:00:04
917500 -- (-680.880) [-681.727] (-683.512) (-681.870) * (-681.226) [-681.402] (-682.801) (-682.961) -- 0:00:04
918000 -- (-682.094) [-682.864] (-681.476) (-683.746) * (-682.410) (-681.744) [-681.891] (-683.282) -- 0:00:04
918500 -- [-681.120] (-686.257) (-681.051) (-680.589) * (-680.123) [-684.478] (-682.095) (-686.906) -- 0:00:04
919000 -- [-681.654] (-686.395) (-680.757) (-680.408) * (-680.290) [-682.052] (-681.720) (-686.961) -- 0:00:04
919500 -- (-682.739) (-681.323) [-679.834] (-682.654) * (-680.050) (-681.342) (-681.706) [-679.839] -- 0:00:04
920000 -- (-686.708) (-679.949) (-682.458) [-679.973] * (-680.471) [-681.535] (-683.042) (-679.707) -- 0:00:04
Average standard deviation of split frequencies: 0.006861
920500 -- (-685.794) [-680.579] (-682.435) (-682.434) * (-680.836) (-682.694) (-680.517) [-680.063] -- 0:00:04
921000 -- (-683.380) (-680.529) [-680.074] (-682.599) * (-681.427) (-681.129) (-680.454) [-680.008] -- 0:00:04
921500 -- (-684.353) (-682.112) (-682.217) [-681.729] * [-680.545] (-682.131) (-682.142) (-682.019) -- 0:00:04
922000 -- [-682.439] (-684.076) (-680.484) (-685.584) * (-681.176) (-681.022) (-690.605) [-680.941] -- 0:00:04
922500 -- [-680.579] (-682.232) (-685.904) (-684.785) * (-680.410) (-681.253) (-689.102) [-682.939] -- 0:00:04
923000 -- (-684.751) (-685.108) [-680.060] (-682.061) * (-682.253) [-680.203] (-694.493) (-682.656) -- 0:00:04
923500 -- (-683.681) (-690.000) [-681.502] (-680.376) * (-682.131) [-681.206] (-689.444) (-682.743) -- 0:00:04
924000 -- [-682.036] (-681.014) (-680.605) (-679.869) * (-683.752) (-680.501) (-680.685) [-681.448] -- 0:00:04
924500 -- (-683.412) (-689.063) [-680.548] (-681.862) * (-684.763) (-681.310) [-681.934] (-680.050) -- 0:00:04
925000 -- (-681.570) (-682.968) (-681.184) [-682.078] * (-683.052) [-680.960] (-682.256) (-683.052) -- 0:00:04
Average standard deviation of split frequencies: 0.006889
925500 -- (-683.615) [-681.500] (-683.393) (-681.604) * (-684.820) (-681.253) (-681.759) [-683.948] -- 0:00:04
926000 -- (-682.663) [-682.051] (-680.789) (-686.540) * (-685.131) (-681.163) (-683.780) [-684.115] -- 0:00:04
926500 -- (-680.695) (-682.287) (-679.921) [-681.378] * [-682.596] (-685.188) (-680.950) (-686.787) -- 0:00:04
927000 -- (-680.947) [-681.049] (-684.686) (-682.351) * (-681.036) (-683.314) (-679.820) [-682.784] -- 0:00:04
927500 -- (-684.315) (-681.063) [-681.585] (-683.631) * [-682.958] (-680.192) (-680.111) (-680.819) -- 0:00:04
928000 -- (-681.067) [-683.014] (-683.657) (-688.153) * (-680.242) (-680.699) (-681.349) [-683.645] -- 0:00:04
928500 -- (-679.769) (-681.300) (-681.507) [-683.822] * (-683.060) (-681.909) (-684.744) [-681.658] -- 0:00:04
929000 -- (-682.539) [-680.419] (-683.352) (-680.875) * (-680.988) (-681.942) (-682.804) [-680.770] -- 0:00:04
929500 -- (-680.718) (-683.681) [-680.728] (-686.624) * [-680.450] (-682.807) (-684.678) (-681.799) -- 0:00:04
930000 -- (-687.563) (-681.804) [-682.861] (-681.329) * (-684.081) (-680.718) (-682.067) [-684.119] -- 0:00:04
Average standard deviation of split frequencies: 0.006652
930500 -- [-684.055] (-681.110) (-683.104) (-681.945) * [-683.202] (-681.312) (-682.402) (-681.147) -- 0:00:04
931000 -- (-683.400) (-680.373) (-685.669) [-680.134] * (-682.950) [-681.257] (-680.831) (-684.440) -- 0:00:04
931500 -- [-680.378] (-684.242) (-680.055) (-681.745) * (-681.594) [-680.450] (-681.211) (-683.434) -- 0:00:04
932000 -- (-684.197) (-684.630) (-683.175) [-685.699] * [-682.317] (-680.344) (-680.233) (-680.347) -- 0:00:04
932500 -- (-680.193) [-685.173] (-684.620) (-682.775) * (-680.720) (-682.147) [-681.849] (-682.787) -- 0:00:04
933000 -- (-679.613) [-685.153] (-680.999) (-680.570) * (-682.954) (-683.904) [-680.894] (-680.207) -- 0:00:04
933500 -- (-680.582) (-682.790) (-683.418) [-680.676] * (-681.534) (-686.101) (-685.620) [-680.997] -- 0:00:03
934000 -- (-684.978) [-681.724] (-684.818) (-684.583) * [-681.017] (-679.690) (-682.216) (-681.408) -- 0:00:03
934500 -- (-682.265) [-682.961] (-684.836) (-680.888) * (-680.741) (-680.672) (-680.928) [-680.123] -- 0:00:03
935000 -- (-685.821) [-684.755] (-690.026) (-679.990) * (-681.751) (-689.051) (-680.053) [-680.325] -- 0:00:03
Average standard deviation of split frequencies: 0.006178
935500 -- (-681.965) (-682.902) [-683.522] (-680.960) * (-684.454) (-681.882) (-680.574) [-681.537] -- 0:00:03
936000 -- (-679.787) (-683.699) [-681.177] (-685.309) * (-682.987) (-682.690) (-680.495) [-685.620] -- 0:00:03
936500 -- [-681.694] (-682.142) (-681.339) (-684.640) * (-681.141) (-683.713) [-680.973] (-687.473) -- 0:00:03
937000 -- (-680.311) [-683.574] (-680.024) (-681.777) * (-687.965) (-681.191) (-681.631) [-681.902] -- 0:00:03
937500 -- (-679.860) (-685.512) [-680.605] (-683.862) * (-681.079) [-682.634] (-682.119) (-683.517) -- 0:00:03
938000 -- [-681.238] (-685.080) (-681.029) (-686.940) * (-681.815) [-683.352] (-683.194) (-689.400) -- 0:00:03
938500 -- (-684.341) (-684.548) (-687.707) [-684.641] * [-680.189] (-682.191) (-681.172) (-685.999) -- 0:00:03
939000 -- (-683.237) [-684.564] (-681.165) (-680.713) * (-682.039) [-686.140] (-682.785) (-684.255) -- 0:00:03
939500 -- (-680.073) [-681.893] (-680.876) (-679.743) * (-682.058) (-682.327) [-683.085] (-685.072) -- 0:00:03
940000 -- [-679.536] (-683.865) (-680.279) (-679.901) * (-681.074) (-682.502) [-683.359] (-680.916) -- 0:00:03
Average standard deviation of split frequencies: 0.006214
940500 -- (-680.069) (-681.445) (-685.267) [-680.574] * (-681.640) (-681.734) [-683.079] (-681.087) -- 0:00:03
941000 -- (-681.039) (-682.657) [-683.040] (-680.158) * (-680.710) (-681.901) (-682.651) [-680.602] -- 0:00:03
941500 -- (-679.927) (-680.021) (-680.760) [-681.138] * (-680.247) [-684.314] (-680.497) (-684.783) -- 0:00:03
942000 -- (-679.997) (-682.558) (-681.599) [-689.178] * (-680.189) (-682.921) [-681.420] (-681.572) -- 0:00:03
942500 -- (-681.992) [-680.338] (-684.755) (-684.909) * [-683.512] (-684.399) (-683.094) (-681.618) -- 0:00:03
943000 -- (-687.576) [-680.875] (-681.236) (-685.926) * [-684.367] (-680.882) (-683.040) (-682.459) -- 0:00:03
943500 -- [-683.172] (-682.202) (-682.212) (-682.537) * (-683.954) (-681.499) (-682.254) [-681.738] -- 0:00:03
944000 -- (-685.138) (-681.835) (-683.938) [-682.553] * (-685.047) [-682.038] (-681.932) (-685.153) -- 0:00:03
944500 -- (-683.990) (-680.693) (-682.765) [-684.349] * (-680.655) (-680.917) [-681.561] (-681.880) -- 0:00:03
945000 -- (-684.532) [-679.998] (-682.509) (-683.745) * (-682.383) [-683.393] (-682.246) (-683.815) -- 0:00:03
Average standard deviation of split frequencies: 0.006079
945500 -- (-680.371) (-680.853) (-681.965) [-684.931] * [-685.270] (-685.628) (-682.804) (-680.749) -- 0:00:03
946000 -- [-682.034] (-679.881) (-680.522) (-684.319) * [-682.093] (-682.072) (-682.014) (-681.756) -- 0:00:03
946500 -- (-682.913) [-681.992] (-683.831) (-686.089) * (-680.716) (-684.056) [-681.071] (-687.375) -- 0:00:03
947000 -- (-680.455) [-682.663] (-681.562) (-684.896) * [-680.829] (-685.204) (-680.906) (-683.959) -- 0:00:03
947500 -- (-679.917) (-681.151) (-684.779) [-681.312] * (-685.639) (-682.645) [-680.492] (-684.014) -- 0:00:03
948000 -- [-681.287] (-680.857) (-685.582) (-679.709) * (-682.955) (-683.102) (-681.563) [-680.874] -- 0:00:03
948500 -- [-680.394] (-683.739) (-681.913) (-682.948) * (-682.874) [-680.281] (-685.132) (-680.709) -- 0:00:03
949000 -- [-681.619] (-685.191) (-682.551) (-681.462) * [-679.544] (-685.356) (-684.308) (-683.409) -- 0:00:03
949500 -- (-682.690) (-682.274) [-680.721] (-680.626) * [-681.775] (-681.653) (-681.381) (-684.043) -- 0:00:03
950000 -- (-683.373) (-681.991) (-680.682) [-680.458] * (-681.165) [-685.633] (-682.113) (-682.013) -- 0:00:03
Average standard deviation of split frequencies: 0.006083
950500 -- (-684.721) (-689.078) [-681.793] (-684.055) * (-682.196) [-687.422] (-681.856) (-680.716) -- 0:00:02
951000 -- (-683.827) (-687.588) [-681.533] (-682.115) * [-681.404] (-683.602) (-683.123) (-682.623) -- 0:00:02
951500 -- [-682.006] (-683.905) (-682.025) (-681.344) * (-681.630) [-684.722] (-683.010) (-685.651) -- 0:00:02
952000 -- (-680.486) [-680.429] (-680.809) (-680.322) * (-683.625) [-682.264] (-681.574) (-689.914) -- 0:00:02
952500 -- (-680.310) (-685.288) [-680.306] (-682.002) * (-682.788) (-680.737) (-680.624) [-684.878] -- 0:00:02
953000 -- (-682.201) (-684.771) (-681.686) [-680.347] * (-682.998) (-681.605) [-681.361] (-680.448) -- 0:00:02
953500 -- [-680.174] (-681.646) (-683.399) (-683.169) * (-681.898) [-681.687] (-679.876) (-681.544) -- 0:00:02
954000 -- (-680.452) (-684.892) [-681.366] (-681.405) * (-679.975) (-682.258) (-681.449) [-680.085] -- 0:00:02
954500 -- (-680.991) [-682.058] (-683.421) (-684.299) * (-679.742) (-682.416) (-681.250) [-681.079] -- 0:00:02
955000 -- [-684.403] (-680.583) (-682.184) (-682.606) * (-679.665) [-680.819] (-684.300) (-682.024) -- 0:00:02
Average standard deviation of split frequencies: 0.005917
955500 -- (-681.274) [-680.417] (-682.923) (-685.272) * [-680.427] (-683.231) (-685.243) (-680.514) -- 0:00:02
956000 -- (-686.656) (-680.483) [-680.150] (-682.296) * (-685.668) (-685.405) (-681.190) [-680.511] -- 0:00:02
956500 -- (-683.296) [-681.062] (-682.028) (-682.218) * (-682.208) (-691.379) [-683.073] (-680.901) -- 0:00:02
957000 -- [-681.884] (-680.456) (-680.329) (-683.604) * (-680.174) [-684.650] (-683.110) (-681.991) -- 0:00:02
957500 -- (-680.523) [-682.947] (-681.208) (-680.072) * [-680.344] (-680.568) (-679.878) (-681.828) -- 0:00:02
958000 -- (-680.610) (-687.652) [-681.936] (-684.177) * (-680.271) (-680.551) (-680.829) [-683.420] -- 0:00:02
958500 -- (-680.687) [-679.917] (-681.603) (-682.777) * [-681.370] (-681.050) (-683.276) (-689.256) -- 0:00:02
959000 -- (-681.974) [-682.408] (-680.758) (-681.359) * [-680.310] (-680.244) (-681.445) (-690.225) -- 0:00:02
959500 -- [-680.094] (-681.444) (-681.484) (-680.438) * (-683.651) [-680.656] (-680.804) (-685.262) -- 0:00:02
960000 -- (-687.437) [-680.324] (-682.023) (-682.240) * [-681.866] (-681.839) (-680.439) (-682.322) -- 0:00:02
Average standard deviation of split frequencies: 0.005856
960500 -- [-681.568] (-681.547) (-684.267) (-681.850) * (-682.515) (-680.043) (-680.577) [-680.443] -- 0:00:02
961000 -- (-681.958) [-680.709] (-680.304) (-681.901) * (-685.114) (-680.172) (-684.961) [-682.644] -- 0:00:02
961500 -- (-681.682) (-681.480) (-683.930) [-683.413] * (-683.764) (-680.122) (-684.250) [-682.984] -- 0:00:02
962000 -- [-686.103] (-684.432) (-681.399) (-682.514) * [-683.193] (-680.449) (-683.277) (-680.116) -- 0:00:02
962500 -- [-684.614] (-681.108) (-681.432) (-682.564) * [-680.448] (-680.132) (-685.614) (-679.538) -- 0:00:02
963000 -- [-681.010] (-681.216) (-683.802) (-684.704) * (-680.666) [-680.088] (-680.026) (-681.136) -- 0:00:02
963500 -- (-683.747) [-681.493] (-682.824) (-680.917) * (-685.366) (-682.202) [-679.867] (-681.126) -- 0:00:02
964000 -- (-680.694) (-681.816) [-680.118] (-682.335) * (-681.270) (-683.365) (-682.154) [-682.933] -- 0:00:02
964500 -- (-683.018) (-681.795) (-681.444) [-680.201] * (-680.782) (-680.070) [-682.872] (-685.457) -- 0:00:02
965000 -- (-682.945) [-684.499] (-681.622) (-681.086) * (-685.844) (-681.316) [-683.220] (-681.445) -- 0:00:02
Average standard deviation of split frequencies: 0.005563
965500 -- (-682.443) [-681.836] (-682.067) (-681.007) * (-683.331) [-680.603] (-683.493) (-679.808) -- 0:00:02
966000 -- (-680.884) (-682.078) [-681.447] (-683.034) * (-683.386) (-682.432) (-680.175) [-679.998] -- 0:00:02
966500 -- (-681.418) [-683.691] (-681.250) (-681.172) * (-682.125) [-682.979] (-679.606) (-682.406) -- 0:00:02
967000 -- (-680.851) (-683.286) [-680.734] (-680.525) * (-681.294) [-680.073] (-683.949) (-682.542) -- 0:00:01
967500 -- [-682.149] (-680.851) (-681.580) (-680.443) * (-681.721) (-679.856) [-681.966] (-684.332) -- 0:00:01
968000 -- (-682.851) (-681.705) [-681.558] (-681.726) * [-682.520] (-680.996) (-684.573) (-683.283) -- 0:00:01
968500 -- (-682.213) (-683.349) [-679.862] (-685.018) * (-682.313) (-680.884) [-679.603] (-689.456) -- 0:00:01
969000 -- (-687.154) (-682.138) [-680.106] (-685.361) * (-683.046) [-680.601] (-680.011) (-685.507) -- 0:00:01
969500 -- (-680.681) (-682.052) (-685.642) [-682.666] * [-684.424] (-684.431) (-683.982) (-683.228) -- 0:00:01
970000 -- (-680.593) (-681.616) (-682.080) [-681.149] * (-681.824) (-684.332) (-681.631) [-681.131] -- 0:00:01
Average standard deviation of split frequencies: 0.005601
970500 -- [-680.841] (-679.815) (-682.213) (-681.940) * (-684.458) [-682.308] (-681.277) (-683.403) -- 0:00:01
971000 -- (-682.779) (-686.914) (-681.955) [-681.771] * (-680.797) [-681.659] (-681.289) (-682.597) -- 0:00:01
971500 -- [-681.850] (-685.385) (-683.061) (-680.600) * (-682.754) (-681.788) [-681.571] (-681.793) -- 0:00:01
972000 -- (-683.319) [-683.684] (-684.076) (-685.764) * (-679.823) [-682.199] (-679.717) (-681.573) -- 0:00:01
972500 -- (-681.537) [-681.182] (-680.509) (-682.087) * (-681.134) [-684.852] (-680.800) (-681.014) -- 0:00:01
973000 -- (-685.729) (-680.926) [-680.963] (-681.253) * (-680.107) (-684.862) (-683.839) [-681.885] -- 0:00:01
973500 -- [-683.282] (-681.544) (-682.151) (-681.391) * [-680.327] (-685.059) (-680.409) (-681.843) -- 0:00:01
974000 -- (-682.121) (-684.099) (-680.750) [-680.825] * (-683.549) (-683.135) (-681.295) [-680.298] -- 0:00:01
974500 -- (-681.907) (-682.744) [-682.549] (-681.263) * (-682.298) [-682.160] (-682.388) (-680.888) -- 0:00:01
975000 -- (-683.479) (-680.435) [-681.698] (-681.029) * (-683.543) (-682.330) [-684.972] (-681.750) -- 0:00:01
Average standard deviation of split frequencies: 0.005667
975500 -- (-681.532) (-680.672) [-680.539] (-683.149) * (-682.560) [-680.846] (-683.787) (-683.065) -- 0:00:01
976000 -- (-682.657) [-680.784] (-679.707) (-683.023) * (-681.274) (-681.208) (-685.093) [-682.696] -- 0:00:01
976500 -- (-681.588) [-685.161] (-682.956) (-683.588) * (-680.925) (-687.537) (-680.972) [-682.515] -- 0:00:01
977000 -- [-684.508] (-681.308) (-679.892) (-683.152) * [-680.138] (-682.739) (-683.105) (-682.914) -- 0:00:01
977500 -- (-682.008) [-680.805] (-680.119) (-683.546) * (-681.959) (-683.858) [-682.228] (-682.576) -- 0:00:01
978000 -- [-683.747] (-683.193) (-681.698) (-682.505) * [-681.365] (-681.315) (-682.734) (-681.868) -- 0:00:01
978500 -- [-682.853] (-682.891) (-683.178) (-682.684) * (-684.144) (-681.460) (-679.936) [-680.402] -- 0:00:01
979000 -- (-681.455) [-681.891] (-680.761) (-680.471) * (-684.880) (-681.555) (-682.323) [-683.364] -- 0:00:01
979500 -- (-682.046) [-680.169] (-682.602) (-679.869) * (-682.588) (-682.439) (-683.110) [-681.813] -- 0:00:01
980000 -- (-680.953) (-681.993) [-681.816] (-682.667) * (-681.249) [-679.622] (-681.134) (-683.227) -- 0:00:01
Average standard deviation of split frequencies: 0.005192
980500 -- (-679.684) [-680.362] (-681.489) (-686.208) * [-681.406] (-680.814) (-682.032) (-680.530) -- 0:00:01
981000 -- (-679.750) (-681.845) (-683.627) [-683.284] * (-681.008) (-680.679) (-680.684) [-680.423] -- 0:00:01
981500 -- (-681.584) (-681.579) [-681.572] (-686.112) * [-681.589] (-681.617) (-681.639) (-681.503) -- 0:00:01
982000 -- (-680.068) (-681.764) [-684.581] (-684.716) * (-683.281) (-681.358) (-680.223) [-679.834] -- 0:00:01
982500 -- (-686.695) [-680.608] (-684.742) (-682.276) * [-682.465] (-680.678) (-680.735) (-681.848) -- 0:00:01
983000 -- (-684.099) (-682.267) [-682.043] (-681.005) * [-681.750] (-683.408) (-680.524) (-684.341) -- 0:00:01
983500 -- (-689.154) [-682.418] (-684.181) (-681.418) * (-686.742) (-680.979) (-680.347) [-682.767] -- 0:00:00
984000 -- (-687.174) (-687.688) (-681.582) [-680.512] * (-684.405) (-679.784) (-686.694) [-684.437] -- 0:00:00
984500 -- (-686.650) (-687.883) [-680.200] (-681.568) * (-680.368) (-680.886) (-685.175) [-681.590] -- 0:00:00
985000 -- (-686.968) (-686.305) (-682.551) [-682.810] * (-681.913) (-683.971) [-681.468] (-684.589) -- 0:00:00
Average standard deviation of split frequencies: 0.005100
985500 -- (-682.453) (-681.133) [-683.379] (-680.954) * (-684.612) (-684.357) [-681.793] (-682.760) -- 0:00:00
986000 -- (-680.609) (-681.881) (-680.877) [-683.082] * (-682.425) [-681.796] (-682.030) (-683.857) -- 0:00:00
986500 -- (-681.097) (-685.339) (-681.593) [-680.196] * (-681.031) (-685.538) (-681.117) [-680.556] -- 0:00:00
987000 -- (-685.836) (-683.197) [-682.713] (-679.857) * [-681.342] (-682.725) (-681.559) (-680.017) -- 0:00:00
987500 -- (-685.114) (-683.635) (-680.032) [-681.115] * [-683.259] (-688.213) (-683.199) (-686.501) -- 0:00:00
988000 -- (-683.969) (-682.052) [-679.922] (-684.825) * [-681.084] (-686.457) (-687.019) (-682.935) -- 0:00:00
988500 -- (-683.249) (-686.006) (-680.781) [-679.908] * (-681.744) (-681.435) [-683.832] (-680.575) -- 0:00:00
989000 -- (-684.475) (-684.540) (-681.297) [-683.520] * [-680.330] (-682.398) (-683.703) (-681.084) -- 0:00:00
989500 -- [-682.047] (-681.277) (-681.417) (-681.248) * (-680.960) (-684.683) [-684.233] (-685.058) -- 0:00:00
990000 -- (-682.537) (-683.031) [-683.551] (-682.227) * (-680.429) [-682.943] (-684.804) (-681.102) -- 0:00:00
Average standard deviation of split frequencies: 0.005425
990500 -- (-680.783) (-683.823) [-682.489] (-680.981) * (-681.987) [-680.440] (-686.632) (-682.938) -- 0:00:00
991000 -- [-684.502] (-682.392) (-680.874) (-680.830) * [-681.145] (-680.980) (-681.180) (-682.925) -- 0:00:00
991500 -- (-680.507) (-680.037) (-680.293) [-680.554] * (-685.302) (-680.642) (-683.498) [-681.896] -- 0:00:00
992000 -- (-681.777) (-681.270) (-679.557) [-680.456] * (-679.514) (-679.838) [-680.581] (-681.519) -- 0:00:00
992500 -- (-681.297) [-681.432] (-679.557) (-680.106) * (-683.079) [-679.687] (-680.781) (-681.441) -- 0:00:00
993000 -- (-682.699) (-682.908) [-679.662] (-681.769) * (-681.745) (-680.152) [-682.003] (-680.373) -- 0:00:00
993500 -- (-682.828) (-680.629) (-680.471) [-684.656] * [-680.658] (-680.287) (-680.669) (-680.806) -- 0:00:00
994000 -- (-682.905) [-680.138] (-681.890) (-682.271) * (-680.489) [-681.336] (-680.598) (-681.360) -- 0:00:00
994500 -- [-681.054] (-681.335) (-685.078) (-682.911) * (-682.345) [-684.807] (-683.460) (-680.723) -- 0:00:00
995000 -- (-681.744) (-681.731) (-683.437) [-682.722] * (-683.618) (-681.523) (-682.304) [-682.414] -- 0:00:00
Average standard deviation of split frequencies: 0.005490
995500 -- [-682.493] (-682.394) (-687.152) (-687.346) * (-681.113) (-681.464) (-682.086) [-681.282] -- 0:00:00
996000 -- [-680.857] (-682.633) (-686.357) (-681.984) * [-682.461] (-681.448) (-682.906) (-683.592) -- 0:00:00
996500 -- (-683.554) (-680.730) (-681.298) [-683.287] * [-680.935] (-684.719) (-687.016) (-679.858) -- 0:00:00
997000 -- [-681.390] (-680.845) (-681.981) (-684.847) * (-681.452) (-690.238) (-683.476) [-680.621] -- 0:00:00
997500 -- (-681.917) (-682.949) [-682.702] (-682.886) * (-687.056) (-680.886) (-684.947) [-680.024] -- 0:00:00
998000 -- [-681.073] (-684.142) (-680.945) (-682.181) * (-683.152) [-680.551] (-682.728) (-680.308) -- 0:00:00
998500 -- (-682.615) [-683.655] (-681.624) (-680.488) * (-682.110) [-681.268] (-684.132) (-682.768) -- 0:00:00
999000 -- (-680.803) [-683.800] (-680.015) (-681.258) * (-680.102) (-683.035) (-681.158) [-683.077] -- 0:00:00
999500 -- (-679.582) (-680.500) [-682.211] (-680.356) * (-680.766) (-680.902) (-680.234) [-682.998] -- 0:00:00
1000000 -- [-683.573] (-681.560) (-684.546) (-684.819) * [-683.802] (-679.854) (-679.676) (-679.771) -- 0:00:00
Average standard deviation of split frequencies: 0.005465
Analysis completed in 60 seconds
Analysis used 58.82 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -679.36
Likelihood of best state for "cold" chain of run 2 was -679.38
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.6 % ( 68 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
31.1 % ( 27 %) Dirichlet(Pi{all})
32.9 % ( 32 %) Slider(Pi{all})
79.1 % ( 52 %) Multiplier(Alpha{1,2})
77.8 % ( 49 %) Multiplier(Alpha{3})
23.1 % ( 29 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.2 % ( 63 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 29 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.6 % ( 32 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 64 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
31.2 % ( 27 %) Dirichlet(Pi{all})
32.0 % ( 25 %) Slider(Pi{all})
78.9 % ( 67 %) Multiplier(Alpha{1,2})
77.7 % ( 48 %) Multiplier(Alpha{3})
23.2 % ( 25 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.3 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 83 %) ParsSPR(Tau{all},V{all})
28.0 % ( 28 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.8 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166289 0.82 0.66
3 | 166950 167271 0.84
4 | 166857 166483 166150
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166543 0.82 0.66
3 | 166846 166101 0.84
4 | 166869 167012 166629
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -681.23
| 2 2 2 |
| 1 2 2 2 * 2 |
| 1 1 2 1 1 1 2 1 1 |
| 2 2 2 11 * 2 122 2 |
| 21 2 2 2 1 1 22 2 2 |
| 22 21 1 2 12 1 2 21 1 2|
|2 2 2 1 2 211 2 * 1 |
| 1 2 11 2 1 21 1 1 1 1 * 1 2 11|
| 1 2 2 1 1 1 |
|1 11 1 2 1 2 12 1 2 22 |
| 2 1 2 1 1 2 |
| 2 1 |
| 1 2 1 1 |
| 2 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -682.83
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -681.14 -685.33
2 -681.08 -683.63
--------------------------------------
TOTAL -681.11 -684.81
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895974 0.090815 0.371161 1.495268 0.863542 1501.00 1501.00 1.000
r(A<->C){all} 0.166926 0.020006 0.000184 0.452825 0.127294 253.06 353.95 1.000
r(A<->G){all} 0.171694 0.021797 0.000006 0.469840 0.129298 119.21 183.40 1.016
r(A<->T){all} 0.169631 0.020561 0.000018 0.468419 0.131642 162.75 283.84 1.006
r(C<->G){all} 0.165455 0.020089 0.000066 0.459756 0.126715 198.78 232.72 1.009
r(C<->T){all} 0.163064 0.019326 0.000097 0.443348 0.125228 188.71 367.19 1.000
r(G<->T){all} 0.163230 0.019396 0.000044 0.444896 0.127410 254.69 260.11 1.011
pi(A){all} 0.181300 0.000294 0.147552 0.214284 0.181481 1193.84 1255.57 1.000
pi(C){all} 0.281695 0.000405 0.243359 0.322064 0.281318 1161.15 1298.38 1.000
pi(G){all} 0.348193 0.000463 0.306981 0.390400 0.347879 1179.87 1227.40 1.000
pi(T){all} 0.188811 0.000300 0.156388 0.222130 0.188357 1299.30 1372.18 1.000
alpha{1,2} 0.429274 0.221235 0.000213 1.393921 0.272420 1063.30 1177.32 1.000
alpha{3} 0.434938 0.217809 0.000104 1.385263 0.283970 1144.62 1211.69 1.002
pinvar{all} 0.996910 0.000014 0.989744 0.999996 0.998164 1188.53 1206.15 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...**.
8 -- ..*.*.
9 -- .**...
10 -- .*.*..
11 -- .****.
12 -- .*...*
13 -- ..*..*
14 -- .**.**
15 -- ..**..
16 -- .*..*.
17 -- .***.*
18 -- ...*.*
19 -- .*.***
20 -- ..****
21 -- ....**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 452 0.150566 0.000942 0.149900 0.151233 2
8 445 0.148235 0.006124 0.143904 0.152565 2
9 444 0.147901 0.005653 0.143904 0.151899 2
10 443 0.147568 0.000471 0.147235 0.147901 2
11 443 0.147568 0.000471 0.147235 0.147901 2
12 442 0.147235 0.016017 0.135909 0.158561 2
13 434 0.144570 0.008480 0.138574 0.150566 2
14 434 0.144570 0.000942 0.143904 0.145237 2
15 429 0.142905 0.011777 0.134577 0.151233 2
16 427 0.142239 0.006124 0.137908 0.146569 2
17 424 0.141239 0.001884 0.139907 0.142572 2
18 423 0.140906 0.000471 0.140573 0.141239 2
19 411 0.136909 0.002355 0.135243 0.138574 2
20 403 0.134244 0.006124 0.129913 0.138574 2
21 368 0.122585 0.014133 0.112592 0.132578 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099209 0.009384 0.000005 0.294221 0.068598 1.000 2
length{all}[2] 0.098648 0.009990 0.000024 0.294283 0.066631 1.000 2
length{all}[3] 0.098504 0.009742 0.000100 0.287633 0.070033 1.001 2
length{all}[4] 0.098660 0.009885 0.000006 0.289117 0.069377 1.000 2
length{all}[5] 0.098089 0.009543 0.000019 0.301787 0.069778 1.000 2
length{all}[6] 0.099506 0.010351 0.000012 0.303505 0.068714 1.000 2
length{all}[7] 0.105415 0.011448 0.000081 0.330454 0.073931 1.000 2
length{all}[8] 0.096248 0.009775 0.000243 0.276044 0.062125 0.999 2
length{all}[9] 0.099951 0.009633 0.000100 0.289283 0.072145 0.998 2
length{all}[10] 0.101257 0.009442 0.000182 0.282294 0.068816 0.999 2
length{all}[11] 0.084608 0.008576 0.000034 0.268717 0.052574 1.000 2
length{all}[12] 0.102129 0.011136 0.000143 0.309344 0.069200 1.000 2
length{all}[13] 0.108189 0.011206 0.000037 0.310240 0.072550 0.998 2
length{all}[14] 0.105199 0.010394 0.000142 0.310211 0.078771 1.004 2
length{all}[15] 0.096849 0.009358 0.000199 0.288596 0.071113 1.003 2
length{all}[16] 0.102592 0.011686 0.000476 0.295338 0.069332 1.002 2
length{all}[17] 0.095380 0.009748 0.000316 0.284944 0.063559 1.000 2
length{all}[18] 0.105498 0.010889 0.000010 0.336370 0.071582 0.998 2
length{all}[19] 0.102880 0.010166 0.000258 0.266961 0.077681 0.998 2
length{all}[20] 0.100423 0.010027 0.000361 0.314077 0.068065 1.001 2
length{all}[21] 0.097844 0.009902 0.000397 0.312657 0.064618 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005465
Maximum standard deviation of split frequencies = 0.016017
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 504
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 47 patterns at 168 / 168 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 47 patterns at 168 / 168 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
45872 bytes for conP
4136 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.057250 0.015131 0.083556 0.082269 0.079940 0.069122 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -722.343330
Iterating by ming2
Initial: fx= 722.343330
x= 0.05725 0.01513 0.08356 0.08227 0.07994 0.06912 0.30000 1.30000
1 h-m-p 0.0000 0.0001 402.2847 ++ 707.554682 m 0.0001 13 | 1/8
2 h-m-p 0.0009 0.0087 38.2868 -----------.. | 1/8
3 h-m-p 0.0000 0.0003 367.5890 +++ 672.811615 m 0.0003 45 | 2/8
4 h-m-p 0.0029 0.0147 25.8015 ------------.. | 2/8
5 h-m-p 0.0000 0.0001 331.1294 ++ 664.869575 m 0.0001 77 | 3/8
6 h-m-p 0.0013 0.0384 16.2984 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 287.2345 ++ 659.413414 m 0.0001 108 | 4/8
8 h-m-p 0.0013 0.0854 11.9293 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 234.9602 ++ 658.627424 m 0.0000 139 | 5/8
10 h-m-p 0.0004 0.2169 8.0125 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 166.1947 ++ 658.410126 m 0.0000 170 | 6/8
12 h-m-p 0.0160 8.0000 0.0000 Y 658.410126 0 0.0160 181 | 6/8
13 h-m-p 1.6000 8.0000 0.0000 C 658.410126 0 0.4000 194
Out..
lnL = -658.410126
195 lfun, 195 eigenQcodon, 1170 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.091916 0.063875 0.109869 0.087741 0.024786 0.096290 0.299924 0.756241 0.506083
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.184325
np = 9
lnL0 = -735.287328
Iterating by ming2
Initial: fx= 735.287328
x= 0.09192 0.06388 0.10987 0.08774 0.02479 0.09629 0.29992 0.75624 0.50608
1 h-m-p 0.0000 0.0002 389.4651 ++ 711.765035 m 0.0002 14 | 1/9
2 h-m-p 0.0001 0.0004 342.8705 ++ 679.938910 m 0.0004 26 | 2/9
3 h-m-p 0.0000 0.0000 11332.0074 ++ 664.322671 m 0.0000 38 | 3/9
4 h-m-p 0.0001 0.0004 105.0297 ++ 661.879041 m 0.0004 50 | 4/9
5 h-m-p 0.0000 0.0000 6059.7906 ++ 660.357873 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 19549.0458 ++ 658.410098 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 658.410098 m 8.0000 86 | 6/9
8 h-m-p 0.0020 0.3107 0.4705 ++++ 658.410085 m 0.3107 103 | 7/9
9 h-m-p 0.4038 8.0000 0.1038 -----------Y 658.410085 0 0.0000 129 | 7/9
10 h-m-p 0.0160 8.0000 0.0003 +++++ 658.410085 m 8.0000 146 | 7/9
11 h-m-p 0.0078 2.5544 0.2888 -----------Y 658.410085 0 0.0000 171 | 7/9
12 h-m-p 0.0160 8.0000 0.0000 +++++ 658.410085 m 8.0000 188 | 7/9
13 h-m-p 0.0020 0.9945 0.4251 ------------.. | 7/9
14 h-m-p 0.0160 8.0000 0.0001 +++++ 658.410085 m 8.0000 229 | 7/9
15 h-m-p 0.0055 2.7253 0.2893 ---------Y 658.410085 0 0.0000 252 | 7/9
16 h-m-p 0.0160 8.0000 0.0001 +++++ 658.410085 m 8.0000 269 | 7/9
17 h-m-p 0.0053 2.6403 0.2829 ------------.. | 7/9
18 h-m-p 0.0160 8.0000 0.0001 +++++ 658.410085 m 8.0000 310 | 7/9
19 h-m-p 0.0055 2.7538 0.2870 -----------Y 658.410085 0 0.0000 335 | 7/9
20 h-m-p 0.0160 8.0000 0.0005 +++++ 658.410084 m 8.0000 352 | 7/9
21 h-m-p 0.0134 2.4953 0.2996 ----------Y 658.410084 0 0.0000 376 | 7/9
22 h-m-p 0.0160 8.0000 0.0002 ----C 658.410084 0 0.0000 394 | 7/9
23 h-m-p 0.0160 8.0000 0.0003 -------------.. | 7/9
24 h-m-p 0.0160 8.0000 0.0001 +++++ 658.410084 m 8.0000 436 | 7/9
25 h-m-p 0.0056 2.8109 0.2829 ----------Y 658.410084 0 0.0000 460 | 7/9
26 h-m-p 0.0160 8.0000 0.0115 +++++ 658.410071 m 8.0000 477 | 7/9
27 h-m-p 0.2974 2.7926 0.3084 ------------Y 658.410071 0 0.0000 503 | 7/9
28 h-m-p 0.0160 8.0000 0.0001 ----Y 658.410071 0 0.0000 521 | 7/9
29 h-m-p 0.0160 8.0000 0.0000 +++++ 658.410071 m 8.0000 538 | 7/9
30 h-m-p 0.0071 3.5432 0.2425 ---------C 658.410071 0 0.0000 561 | 7/9
31 h-m-p 0.0160 8.0000 0.0005 +++++ 658.410070 m 8.0000 578 | 7/9
32 h-m-p 0.0179 3.6376 0.2422 ----------Y 658.410070 0 0.0000 602 | 7/9
33 h-m-p 0.0160 8.0000 0.0001 +++++ 658.410070 m 8.0000 619 | 7/9
34 h-m-p 0.0102 5.1124 0.4081 ------------Y 658.410070 0 0.0000 645 | 7/9
35 h-m-p 0.0160 8.0000 0.0001 -------------.. | 7/9
36 h-m-p 0.0160 8.0000 0.0002 +++++ 658.410070 m 8.0000 687 | 7/9
37 h-m-p 0.0074 3.7007 0.2398 ---------C 658.410070 0 0.0000 710 | 7/9
38 h-m-p 0.0160 8.0000 0.0122 +++++ 658.410048 m 8.0000 727 | 7/9
39 h-m-p 0.3679 3.6086 0.2648 -------------Y 658.410048 0 0.0000 754 | 7/9
40 h-m-p 0.0160 8.0000 0.0001 ------C 658.410048 0 0.0000 774 | 7/9
41 h-m-p 0.0160 8.0000 0.0000 +++++ 658.410048 m 8.0000 791 | 7/9
42 h-m-p 0.0097 4.8345 0.1939 -----------Y 658.410048 0 0.0000 816 | 7/9
43 h-m-p 0.0160 8.0000 0.0001 ----------Y 658.410048 0 0.0000 840 | 7/9
44 h-m-p 0.0160 8.0000 0.0000 +++++ 658.410048 m 8.0000 857 | 7/9
45 h-m-p 0.0026 1.2836 0.2446 ---------C 658.410048 0 0.0000 880 | 7/9
46 h-m-p 0.0160 8.0000 0.0000 ----Y 658.410048 0 0.0000 898 | 7/9
47 h-m-p 0.0160 8.0000 0.0001 ------Y 658.410048 0 0.0000 918
Out..
lnL = -658.410048
919 lfun, 2757 eigenQcodon, 11028 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.055866 0.095121 0.061995 0.051154 0.055904 0.039743 0.181647 0.937803 0.549291 0.142027 1.523638
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.143929
np = 11
lnL0 = -713.903041
Iterating by ming2
Initial: fx= 713.903041
x= 0.05587 0.09512 0.06199 0.05115 0.05590 0.03974 0.18165 0.93780 0.54929 0.14203 1.52364
1 h-m-p 0.0000 0.0003 352.1672 +++ 678.190404 m 0.0003 17 | 1/11
2 h-m-p 0.0002 0.0008 112.2393 ++ 668.825415 m 0.0008 31 | 2/11
3 h-m-p 0.0000 0.0000 1314.2437 ++ 665.899284 m 0.0000 45 | 3/11
4 h-m-p 0.0014 0.0069 11.1855 -----------.. | 3/11
5 h-m-p 0.0000 0.0000 321.7668 ++ 665.507213 m 0.0000 82 | 4/11
6 h-m-p 0.0001 0.0587 7.2533 ----------.. | 4/11
7 h-m-p 0.0000 0.0000 278.7341 ++ 665.489529 m 0.0000 118 | 5/11
8 h-m-p 0.0001 0.0572 6.9869 ----------.. | 5/11
9 h-m-p 0.0000 0.0000 227.0451 ++ 663.612518 m 0.0000 154 | 6/11
10 h-m-p 0.0010 0.0581 6.0806 -----------.. | 6/11
11 h-m-p 0.0000 0.0002 160.9774 +++ 658.410108 m 0.0002 192 | 7/11
12 h-m-p 1.1970 8.0000 0.0000 ++ 658.410108 m 8.0000 206 | 7/11
13 h-m-p 0.0215 8.0000 0.0051 +++++ 658.410107 m 8.0000 227 | 7/11
14 h-m-p 0.0244 8.0000 1.6753 -----------N 658.410107 0 0.0000 256 | 7/11
15 h-m-p 0.0160 8.0000 0.0001 +++++ 658.410107 m 8.0000 273 | 7/11
16 h-m-p 0.0160 8.0000 1.7859 -------------.. | 7/11
17 h-m-p 0.0160 8.0000 0.0000 +++++ 658.410107 m 8.0000 319 | 7/11
18 h-m-p 0.0237 8.0000 0.0092 +++++ 658.410105 m 8.0000 340 | 7/11
19 h-m-p 0.0892 8.0000 0.8257 -----------N 658.410105 0 0.0000 369 | 7/11
20 h-m-p 0.0160 8.0000 0.0000 C 658.410105 0 0.0160 387 | 7/11
21 h-m-p 0.0160 8.0000 0.0000 Y 658.410105 0 0.0040 405 | 7/11
22 h-m-p 0.0160 8.0000 0.0000 --Y 658.410105 0 0.0003 425
Out..
lnL = -658.410105
426 lfun, 1704 eigenQcodon, 7668 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -658.418612 S = -658.407699 -0.004176
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 47 patterns 0:05
did 20 / 47 patterns 0:05
did 30 / 47 patterns 0:05
did 40 / 47 patterns 0:05
did 47 / 47 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.038134 0.028619 0.010729 0.036726 0.054886 0.035897 0.095370 1.086483 1.476260
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 14.354585
np = 9
lnL0 = -691.538486
Iterating by ming2
Initial: fx= 691.538486
x= 0.03813 0.02862 0.01073 0.03673 0.05489 0.03590 0.09537 1.08648 1.47626
1 h-m-p 0.0000 0.0001 388.5576 ++ 681.339616 m 0.0001 14 | 1/9
2 h-m-p 0.0008 0.0055 28.0904 ++ 680.894744 m 0.0055 26 | 2/9
3 h-m-p 0.0012 0.0062 8.6851 -----------.. | 2/9
4 h-m-p 0.0000 0.0001 356.9043 ++ 666.579915 m 0.0001 59 | 3/9
5 h-m-p 0.0024 0.0677 14.6909 ------------.. | 3/9
6 h-m-p 0.0000 0.0000 325.3664 ++ 661.944560 m 0.0000 93 | 4/9
7 h-m-p 0.0015 0.1249 8.3944 -----------.. | 4/9
8 h-m-p 0.0000 0.0000 283.5448 ++ 661.546825 m 0.0000 126 | 5/9
9 h-m-p 0.0003 0.1715 6.3708 ----------.. | 5/9
10 h-m-p 0.0000 0.0000 231.4148 ++ 661.096539 m 0.0000 158 | 6/9
11 h-m-p 0.0004 0.2086 5.2867 ----------.. | 6/9
12 h-m-p 0.0000 0.0001 163.3262 ++ 658.410089 m 0.0001 190 | 7/9
13 h-m-p 1.1052 8.0000 0.0000 ++ 658.410089 m 8.0000 202 | 7/9
14 h-m-p 0.0334 8.0000 0.0005 ++++ 658.410089 m 8.0000 218 | 7/9
15 h-m-p 0.0160 8.0000 1.1585 +++++ 658.410085 m 8.0000 235 | 7/9
16 h-m-p 1.6000 8.0000 0.6618 ++ 658.410085 m 8.0000 247 | 7/9
17 h-m-p 1.6000 8.0000 1.1703 ++ 658.410085 m 8.0000 261 | 7/9
18 h-m-p 0.7625 3.8123 6.7231 --------------N 658.410085 0 0.0000 287 | 7/9
19 h-m-p 0.1593 8.0000 0.0000 ----------Y 658.410085 0 0.0000 309 | 7/9
20 h-m-p 0.0160 8.0000 0.0000 ----------N 658.410085 0 0.0000 333
Out..
lnL = -658.410085
334 lfun, 3674 eigenQcodon, 20040 P(t)
Time used: 0:11
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.091671 0.061351 0.085111 0.063431 0.039520 0.016643 0.000100 0.900000 0.418283 1.612966 1.299939
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 17.802543
np = 11
lnL0 = -712.212296
Iterating by ming2
Initial: fx= 712.212296
x= 0.09167 0.06135 0.08511 0.06343 0.03952 0.01664 0.00011 0.90000 0.41828 1.61297 1.29994
1 h-m-p 0.0000 0.0000 340.9969 ++ 711.965537 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0006 168.8827 +++ 697.537323 m 0.0006 31 | 2/11
3 h-m-p 0.0001 0.0004 178.8580 ++ 680.111109 m 0.0004 45 | 3/11
4 h-m-p 0.0007 0.0037 79.0909 ++ 666.853483 m 0.0037 59 | 4/11
5 h-m-p 0.0000 0.0000 20695.3470 ++ 665.866888 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 8520.7827 ++ 664.789823 m 0.0000 87 | 6/11
7 h-m-p 0.0010 0.0052 9.7782 -----------.. | 6/11
8 h-m-p 0.0000 0.0001 220.1529 ++ 659.390969 m 0.0001 124 | 7/11
9 h-m-p 0.0015 0.0155 11.1217 ++ 658.410040 m 0.0155 138 | 8/11
10 h-m-p 1.6000 8.0000 0.0016 ++ 658.410034 m 8.0000 152 | 8/11
11 h-m-p 0.0991 7.3928 0.1297 -------------C 658.410034 0 0.0000 182 | 8/11
12 h-m-p 0.0160 8.0000 0.0002 +++++ 658.410034 m 8.0000 202 | 8/11
13 h-m-p 0.0129 6.4602 0.3429 -------------.. | 8/11
14 h-m-p 0.0160 8.0000 0.0005 +++++ 658.410032 m 8.0000 250 | 8/11
15 h-m-p 0.0328 7.8423 0.1221 -----------Y 658.410032 0 0.0000 278 | 8/11
16 h-m-p 0.0000 0.0194 2.1879 +++++ 658.410005 m 0.0194 298 | 9/11
17 h-m-p 1.6000 8.0000 0.0000 Y 658.410005 0 0.4000 312 | 9/11
18 h-m-p 1.6000 8.0000 0.0000 N 658.410005 0 1.6000 328 | 9/11
19 h-m-p 0.1042 8.0000 0.0000 C 658.410005 0 0.1042 344 | 9/11
20 h-m-p 0.0943 8.0000 0.0000 Y 658.410005 0 0.0943 360 | 9/11
21 h-m-p 0.0013 0.6446 4.9497 -----N 658.410005 0 0.0000 381 | 9/11
22 h-m-p 1.6000 8.0000 0.0000 N 658.410005 0 1.6000 395 | 9/11
23 h-m-p 0.0160 8.0000 0.0000 C 658.410005 0 0.0160 411
Out..
lnL = -658.410005
412 lfun, 4944 eigenQcodon, 27192 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -658.452358 S = -658.410663 -0.018441
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 47 patterns 0:17
did 20 / 47 patterns 0:18
did 30 / 47 patterns 0:18
did 40 / 47 patterns 0:18
did 47 / 47 patterns 0:18
Time used: 0:18
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=168
NC_011896_1_WP_010909031_1_2872_MLBR_RS13675 VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
NC_002677_1_NP_302712_1_1584_ssb VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
NZ_LVXE01000018_1_WP_010909031_1_683_A3216_RS06865 VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
NZ_LYPH01000023_1_WP_010909031_1_950_A8144_RS04535 VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
NZ_CP029543_1_WP_010909031_1_2910_DIJ64_RS14805 VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
NZ_AP014567_1_WP_010909031_1_2975_ssb VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG
**************************************************
NC_011896_1_WP_010909031_1_2872_MLBR_RS13675 EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
NC_002677_1_NP_302712_1_1584_ssb EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
NZ_LVXE01000018_1_WP_010909031_1_683_A3216_RS06865 EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
NZ_LYPH01000023_1_WP_010909031_1_950_A8144_RS04535 EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
NZ_CP029543_1_WP_010909031_1_2910_DIJ64_RS14805 EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
NZ_AP014567_1_WP_010909031_1_2975_ssb EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE
**************************************************
NC_011896_1_WP_010909031_1_2872_MLBR_RS13675 VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
NC_002677_1_NP_302712_1_1584_ssb VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
NZ_LVXE01000018_1_WP_010909031_1_683_A3216_RS06865 VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
NZ_LYPH01000023_1_WP_010909031_1_950_A8144_RS04535 VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
NZ_CP029543_1_WP_010909031_1_2910_DIJ64_RS14805 VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
NZ_AP014567_1_WP_010909031_1_2975_ssb VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW
**************************************************
NC_011896_1_WP_010909031_1_2872_MLBR_RS13675 GSAPTSGSFGVGDEEPPF
NC_002677_1_NP_302712_1_1584_ssb GSAPTSGSFGVGDEEPPF
NZ_LVXE01000018_1_WP_010909031_1_683_A3216_RS06865 GSAPTSGSFGVGDEEPPF
NZ_LYPH01000023_1_WP_010909031_1_950_A8144_RS04535 GSAPTSGSFGVGDEEPPF
NZ_CP029543_1_WP_010909031_1_2910_DIJ64_RS14805 GSAPTSGSFGVGDEEPPF
NZ_AP014567_1_WP_010909031_1_2975_ssb GSAPTSGSFGVGDEEPPF
******************
>NC_011896_1_WP_010909031_1_2872_MLBR_RS13675 GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC CTTC >NC_002677_1_NP_302712_1_1584_ssb GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC CTTC >NZ_LVXE01000018_1_WP_010909031_1_683_A3216_RS06865 GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC CTTC >NZ_LYPH01000023_1_WP_010909031_1_950_A8144_RS04535 GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC CTTC >NZ_CP029543_1_WP_010909031_1_2910_DIJ64_RS14805 GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC CTTC >NZ_AP014567_1_WP_010909031_1_2975_ssb GTGGCTGGCGACACCACCATTACCATTGTCGGAAATTTGACCGCTGACCC TGAGTTGCGGTTCACTTCGTCCGGTGCTGCCGTGGTGAACTTCACTGTTG CATCGACACCGCGGATCTATGATCGTCAAAGCGGTGAGTGGAAAGACGGC GAGGCGCTGTTCCTTCGGTGCAATATTTGGCGGGAGGCTGCGGAGAACGT GGCCGAAAGCCTCACCCGGGGGGCGCGGGTGATCGTCACCGGTCGGCTCA AGCAGCGTTCCTTCGAGACCCGCGAGGGCGAGAAACGGACAGTTGTCGAG GTCGAGGTCGATGAGATCGGCCCGTCGCTTCGGTATGCCACCGCCAAAGT CAACAAGGCTAGCCGCAGTGGTGGCGGGGGCGGCGGCTTCGGCAGCGGAT CCCGTCAGGCGCCTGCTCAAATGAGTGGCGGAGTAGGTGACGATCCGTGG GGCAGTGCCCCAACCTCGGGGTCCTTCGGCGTCGGTGACGAAGAACCCCC CTTC
>NC_011896_1_WP_010909031_1_2872_MLBR_RS13675 VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW GSAPTSGSFGVGDEEPPF >NC_002677_1_NP_302712_1_1584_ssb VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW GSAPTSGSFGVGDEEPPF >NZ_LVXE01000018_1_WP_010909031_1_683_A3216_RS06865 VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW GSAPTSGSFGVGDEEPPF >NZ_LYPH01000023_1_WP_010909031_1_950_A8144_RS04535 VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW GSAPTSGSFGVGDEEPPF >NZ_CP029543_1_WP_010909031_1_2910_DIJ64_RS14805 VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW GSAPTSGSFGVGDEEPPF >NZ_AP014567_1_WP_010909031_1_2975_ssb VAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDG EALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVE VEVDEIGPSLRYATAKVNKASRSGGGGGGFGSGSRQAPAQMSGGVGDDPW GSAPTSGSFGVGDEEPPF
#NEXUS
[ID: 0515822061]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010909031_1_2872_MLBR_RS13675
NC_002677_1_NP_302712_1_1584_ssb
NZ_LVXE01000018_1_WP_010909031_1_683_A3216_RS06865
NZ_LYPH01000023_1_WP_010909031_1_950_A8144_RS04535
NZ_CP029543_1_WP_010909031_1_2910_DIJ64_RS14805
NZ_AP014567_1_WP_010909031_1_2975_ssb
;
end;
begin trees;
translate
1 NC_011896_1_WP_010909031_1_2872_MLBR_RS13675,
2 NC_002677_1_NP_302712_1_1584_ssb,
3 NZ_LVXE01000018_1_WP_010909031_1_683_A3216_RS06865,
4 NZ_LYPH01000023_1_WP_010909031_1_950_A8144_RS04535,
5 NZ_CP029543_1_WP_010909031_1_2910_DIJ64_RS14805,
6 NZ_AP014567_1_WP_010909031_1_2975_ssb
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06859751,2:0.06663117,3:0.07003317,4:0.06937741,5:0.06977754,6:0.06871433);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06859751,2:0.06663117,3:0.07003317,4:0.06937741,5:0.06977754,6:0.06871433);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -681.14 -685.33
2 -681.08 -683.63
--------------------------------------
TOTAL -681.11 -684.81
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/ssb/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895974 0.090815 0.371161 1.495268 0.863542 1501.00 1501.00 1.000
r(A<->C){all} 0.166926 0.020006 0.000184 0.452825 0.127294 253.06 353.95 1.000
r(A<->G){all} 0.171694 0.021797 0.000006 0.469840 0.129298 119.21 183.40 1.016
r(A<->T){all} 0.169631 0.020561 0.000018 0.468419 0.131642 162.75 283.84 1.006
r(C<->G){all} 0.165455 0.020089 0.000066 0.459756 0.126715 198.78 232.72 1.009
r(C<->T){all} 0.163064 0.019326 0.000097 0.443348 0.125228 188.71 367.19 1.000
r(G<->T){all} 0.163230 0.019396 0.000044 0.444896 0.127410 254.69 260.11 1.011
pi(A){all} 0.181300 0.000294 0.147552 0.214284 0.181481 1193.84 1255.57 1.000
pi(C){all} 0.281695 0.000405 0.243359 0.322064 0.281318 1161.15 1298.38 1.000
pi(G){all} 0.348193 0.000463 0.306981 0.390400 0.347879 1179.87 1227.40 1.000
pi(T){all} 0.188811 0.000300 0.156388 0.222130 0.188357 1299.30 1372.18 1.000
alpha{1,2} 0.429274 0.221235 0.000213 1.393921 0.272420 1063.30 1177.32 1.000
alpha{3} 0.434938 0.217809 0.000104 1.385263 0.283970 1144.62 1211.69 1.002
pinvar{all} 0.996910 0.000014 0.989744 0.999996 0.998164 1188.53 1206.15 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/12res/ssb/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 168
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0
TTC 7 7 7 7 7 7 | TCC 4 4 4 4 4 4 | TAC 0 0 0 0 0 0 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 2 2 2 2 2 2 | His CAT 0 0 0 0 0 0 | Arg CGT 3 3 3 3 3 3
CTC 2 2 2 2 2 2 | CCC 2 2 2 2 2 2 | CAC 0 0 0 0 0 0 | CGC 2 2 2 2 2 2
CTA 0 0 0 0 0 0 | CCA 1 1 1 1 1 1 | Gln CAA 2 2 2 2 2 2 | CGA 0 0 0 0 0 0
CTG 1 1 1 1 1 1 | CCG 3 3 3 3 3 3 | CAG 2 2 2 2 2 2 | CGG 9 9 9 9 9 9
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 2 2 2 2 2 2 | Asn AAT 2 2 2 2 2 2 | Ser AGT 3 3 3 3 3 3
ATC 3 3 3 3 3 3 | ACC 9 9 9 9 9 9 | AAC 3 3 3 3 3 3 | AGC 4 4 4 4 4 4
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 0 0 0 0 0 0 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 6 6 6 6 6 6 | Asp GAT 3 3 3 3 3 3 | Gly GGT 6 6 6 6 6 6
GTC 7 7 7 7 7 7 | GCC 5 5 5 5 5 5 | GAC 5 5 5 5 5 5 | GGC 12 12 12 12 12 12
GTA 1 1 1 1 1 1 | GCA 1 1 1 1 1 1 | Glu GAA 3 3 3 3 3 3 | GGA 3 3 3 3 3 3
GTG 5 5 5 5 5 5 | GCG 4 4 4 4 4 4 | GAG 11 11 11 11 11 11 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010909031_1_2872_MLBR_RS13675
position 1: T:0.13690 C:0.18452 A:0.22024 G:0.45833
position 2: T:0.21429 C:0.26786 A:0.22619 G:0.29167
position 3: T:0.21429 C:0.39286 A:0.09524 G:0.29762
Average T:0.18849 C:0.28175 A:0.18056 G:0.34921
#2: NC_002677_1_NP_302712_1_1584_ssb
position 1: T:0.13690 C:0.18452 A:0.22024 G:0.45833
position 2: T:0.21429 C:0.26786 A:0.22619 G:0.29167
position 3: T:0.21429 C:0.39286 A:0.09524 G:0.29762
Average T:0.18849 C:0.28175 A:0.18056 G:0.34921
#3: NZ_LVXE01000018_1_WP_010909031_1_683_A3216_RS06865
position 1: T:0.13690 C:0.18452 A:0.22024 G:0.45833
position 2: T:0.21429 C:0.26786 A:0.22619 G:0.29167
position 3: T:0.21429 C:0.39286 A:0.09524 G:0.29762
Average T:0.18849 C:0.28175 A:0.18056 G:0.34921
#4: NZ_LYPH01000023_1_WP_010909031_1_950_A8144_RS04535
position 1: T:0.13690 C:0.18452 A:0.22024 G:0.45833
position 2: T:0.21429 C:0.26786 A:0.22619 G:0.29167
position 3: T:0.21429 C:0.39286 A:0.09524 G:0.29762
Average T:0.18849 C:0.28175 A:0.18056 G:0.34921
#5: NZ_CP029543_1_WP_010909031_1_2910_DIJ64_RS14805
position 1: T:0.13690 C:0.18452 A:0.22024 G:0.45833
position 2: T:0.21429 C:0.26786 A:0.22619 G:0.29167
position 3: T:0.21429 C:0.39286 A:0.09524 G:0.29762
Average T:0.18849 C:0.28175 A:0.18056 G:0.34921
#6: NZ_AP014567_1_WP_010909031_1_2975_ssb
position 1: T:0.13690 C:0.18452 A:0.22024 G:0.45833
position 2: T:0.21429 C:0.26786 A:0.22619 G:0.29167
position 3: T:0.21429 C:0.39286 A:0.09524 G:0.29762
Average T:0.18849 C:0.28175 A:0.18056 G:0.34921
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 0
TTC 42 | TCC 24 | TAC 0 | TGC 6
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 24 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 12 | His H CAT 0 | Arg R CGT 18
CTC 12 | CCC 12 | CAC 0 | CGC 12
CTA 0 | CCA 6 | Gln Q CAA 12 | CGA 0
CTG 6 | CCG 18 | CAG 12 | CGG 54
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 12 | Asn N AAT 12 | Ser S AGT 18
ATC 18 | ACC 54 | AAC 18 | AGC 24
ATA 0 | ACA 12 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 6 | ACG 0 | AAG 12 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 36 | Asp D GAT 18 | Gly G GGT 36
GTC 42 | GCC 30 | GAC 30 | GGC 72
GTA 6 | GCA 6 | Glu E GAA 18 | GGA 18
GTG 30 | GCG 24 | GAG 66 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13690 C:0.18452 A:0.22024 G:0.45833
position 2: T:0.21429 C:0.26786 A:0.22619 G:0.29167
position 3: T:0.21429 C:0.39286 A:0.09524 G:0.29762
Average T:0.18849 C:0.28175 A:0.18056 G:0.34921
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -658.410126 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299924 1.299939
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909031_1_2872_MLBR_RS13675: 0.000004, NC_002677_1_NP_302712_1_1584_ssb: 0.000004, NZ_LVXE01000018_1_WP_010909031_1_683_A3216_RS06865: 0.000004, NZ_LYPH01000023_1_WP_010909031_1_950_A8144_RS04535: 0.000004, NZ_CP029543_1_WP_010909031_1_2910_DIJ64_RS14805: 0.000004, NZ_AP014567_1_WP_010909031_1_2975_ssb: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29992
omega (dN/dS) = 1.29994
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 381.7 122.3 1.2999 0.0000 0.0000 0.0 0.0
7..2 0.000 381.7 122.3 1.2999 0.0000 0.0000 0.0 0.0
7..3 0.000 381.7 122.3 1.2999 0.0000 0.0000 0.0 0.0
7..4 0.000 381.7 122.3 1.2999 0.0000 0.0000 0.0 0.0
7..5 0.000 381.7 122.3 1.2999 0.0000 0.0000 0.0 0.0
7..6 0.000 381.7 122.3 1.2999 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -658.410048 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.181647 0.933813 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909031_1_2872_MLBR_RS13675: 0.000004, NC_002677_1_NP_302712_1_1584_ssb: 0.000004, NZ_LVXE01000018_1_WP_010909031_1_683_A3216_RS06865: 0.000004, NZ_LYPH01000023_1_WP_010909031_1_950_A8144_RS04535: 0.000004, NZ_CP029543_1_WP_010909031_1_2910_DIJ64_RS14805: 0.000004, NZ_AP014567_1_WP_010909031_1_2975_ssb: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.18165
MLEs of dN/dS (w) for site classes (K=2)
p: 0.93381 0.06619
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 383.3 120.7 0.0662 0.0000 0.0000 0.0 0.0
7..2 0.000 383.3 120.7 0.0662 0.0000 0.0000 0.0 0.0
7..3 0.000 383.3 120.7 0.0662 0.0000 0.0000 0.0 0.0
7..4 0.000 383.3 120.7 0.0662 0.0000 0.0000 0.0 0.0
7..5 0.000 383.3 120.7 0.0662 0.0000 0.0000 0.0 0.0
7..6 0.000 383.3 120.7 0.0662 0.0000 0.0000 0.0 0.0
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -658.410105 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.095370 0.502131 0.312595 0.000001 1.490303
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909031_1_2872_MLBR_RS13675: 0.000004, NC_002677_1_NP_302712_1_1584_ssb: 0.000004, NZ_LVXE01000018_1_WP_010909031_1_683_A3216_RS06865: 0.000004, NZ_LYPH01000023_1_WP_010909031_1_950_A8144_RS04535: 0.000004, NZ_CP029543_1_WP_010909031_1_2910_DIJ64_RS14805: 0.000004, NZ_AP014567_1_WP_010909031_1_2975_ssb: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.09537
MLEs of dN/dS (w) for site classes (K=3)
p: 0.50213 0.31260 0.18527
w: 0.00000 1.00000 1.49030
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 384.6 119.4 0.5887 0.0000 0.0000 0.0 0.0
7..2 0.000 384.6 119.4 0.5887 0.0000 0.0000 0.0 0.0
7..3 0.000 384.6 119.4 0.5887 0.0000 0.0000 0.0 0.0
7..4 0.000 384.6 119.4 0.5887 0.0000 0.0000 0.0 0.0
7..5 0.000 384.6 119.4 0.5887 0.0000 0.0000 0.0 0.0
7..6 0.000 384.6 119.4 0.5887 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909031_1_2872_MLBR_RS13675)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909031_1_2872_MLBR_RS13675)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -658.410085 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 12.349468 22.550328
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909031_1_2872_MLBR_RS13675: 0.000004, NC_002677_1_NP_302712_1_1584_ssb: 0.000004, NZ_LVXE01000018_1_WP_010909031_1_683_A3216_RS06865: 0.000004, NZ_LYPH01000023_1_WP_010909031_1_950_A8144_RS04535: 0.000004, NZ_CP029543_1_WP_010909031_1_2910_DIJ64_RS14805: 0.000004, NZ_AP014567_1_WP_010909031_1_2975_ssb: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 12.34947 q = 22.55033
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.22736 0.27043 0.29765 0.32015 0.34086 0.36130 0.38278 0.40704 0.43780 0.49001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 386.2 117.8 0.3535 0.0000 0.0000 0.0 0.0
7..2 0.000 386.2 117.8 0.3535 0.0000 0.0000 0.0 0.0
7..3 0.000 386.2 117.8 0.3535 0.0000 0.0000 0.0 0.0
7..4 0.000 386.2 117.8 0.3535 0.0000 0.0000 0.0 0.0
7..5 0.000 386.2 117.8 0.3535 0.0000 0.0000 0.0 0.0
7..6 0.000 386.2 117.8 0.3535 0.0000 0.0000 0.0 0.0
Time used: 0:11
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -658.410005 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.680134 1.568526
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909031_1_2872_MLBR_RS13675: 0.000004, NC_002677_1_NP_302712_1_1584_ssb: 0.000004, NZ_LVXE01000018_1_WP_010909031_1_683_A3216_RS06865: 0.000004, NZ_LYPH01000023_1_WP_010909031_1_950_A8144_RS04535: 0.000004, NZ_CP029543_1_WP_010909031_1_2910_DIJ64_RS14805: 0.000004, NZ_AP014567_1_WP_010909031_1_2975_ssb: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.68013
(p1 = 0.00001) w = 1.56853
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.56853
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 386.2 117.8 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 386.2 117.8 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 386.2 117.8 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 386.2 117.8 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 386.2 117.8 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 386.2 117.8 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909031_1_2872_MLBR_RS13675)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.097 0.098 0.098 0.099 0.100 0.100 0.101 0.102 0.103 0.103
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Time used: 0:18
Model 1: NearlyNeutral -658.410048 Model 2: PositiveSelection -658.410105 Model 0: one-ratio -658.410126 Model 7: beta -658.410085 Model 8: beta&w>1 -658.410005 Model 0 vs 1 1.560000000608852E-4 Model 2 vs 1 1.1400000016692502E-4 Model 8 vs 7 1.6000000005078618E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
