--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 14:23:26 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/12res/sseA/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1211.83 -1215.00 2 -1211.83 -1215.59 -------------------------------------- TOTAL -1211.83 -1215.34 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.902929 0.090933 0.340560 1.468242 0.866663 1338.20 1419.60 1.000 r(A<->C){all} 0.156191 0.016989 0.000090 0.413737 0.120180 273.26 279.10 1.000 r(A<->G){all} 0.174254 0.020816 0.000006 0.450563 0.132999 353.05 365.82 1.000 r(A<->T){all} 0.154523 0.018210 0.000010 0.417109 0.120192 143.20 198.47 1.000 r(C<->G){all} 0.173399 0.023337 0.000013 0.485969 0.129772 91.32 166.09 1.001 r(C<->T){all} 0.161640 0.020389 0.000063 0.456397 0.122087 87.97 175.45 1.000 r(G<->T){all} 0.179993 0.021434 0.000097 0.468358 0.145224 197.68 200.69 1.000 pi(A){all} 0.227447 0.000199 0.200766 0.255604 0.226878 1243.94 1372.47 1.000 pi(C){all} 0.322152 0.000250 0.289688 0.352248 0.321927 1264.47 1269.64 1.001 pi(G){all} 0.273376 0.000217 0.244180 0.302288 0.273348 1234.46 1367.73 1.000 pi(T){all} 0.177024 0.000166 0.153066 0.202545 0.176955 1239.85 1344.16 1.000 alpha{1,2} 0.419204 0.223461 0.000331 1.343187 0.252949 1159.76 1280.12 1.001 alpha{3} 0.445114 0.215608 0.000288 1.371328 0.296529 1323.68 1326.29 1.000 pinvar{all} 0.998294 0.000004 0.994496 0.999999 0.998964 1096.66 1138.65 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1166.177856 Model 2: PositiveSelection -1166.177846 Model 0: one-ratio -1166.177862 Model 7: beta -1166.177822 Model 8: beta&w>1 -1166.177849 Model 0 vs 1 1.1999999969702912E-5 Model 2 vs 1 1.9999999949504854E-5 Model 8 vs 7 5.399999963628943E-5
>C1 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV >C2 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV >C3 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV >C4 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV >C5 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV >C6 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=296 C1 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG C2 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG C3 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG C4 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG C5 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG C6 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG ************************************************** C1 HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS C2 HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS C3 HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS C4 HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS C5 HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS C6 HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS ************************************************** C1 NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV C2 NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV C3 NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV C4 NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV C5 NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV C6 NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV ************************************************** C1 VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR C2 VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR C3 VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR C4 VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR C5 VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR C6 VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR ************************************************** C1 AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER C2 AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER C3 AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER C4 AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER C5 AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER C6 AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER ************************************************** C1 SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV C2 SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV C3 SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV C4 SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV C5 SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV C6 SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV ********************************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 296 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 296 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8880] Library Relaxation: Multi_proc [96] Relaxation Summary: [8880]--->[8880] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.495 Mb, Max= 30.847 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG C2 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG C3 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG C4 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG C5 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG C6 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG ************************************************** C1 HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS C2 HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS C3 HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS C4 HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS C5 HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS C6 HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS ************************************************** C1 NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV C2 NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV C3 NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV C4 NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV C5 NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV C6 NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV ************************************************** C1 VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR C2 VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR C3 VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR C4 VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR C5 VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR C6 VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR ************************************************** C1 AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER C2 AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER C3 AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER C4 AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER C5 AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER C6 AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER ************************************************** C1 SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV C2 SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV C3 SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV C4 SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV C5 SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV C6 SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV ********************************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC C2 GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC C3 GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC C4 GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC C5 GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC C6 GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC ************************************************** C1 CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG C2 CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG C3 CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG C4 CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG C5 CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG C6 CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG ************************************************** C1 GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA C2 GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA C3 GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA C4 GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA C5 GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA C6 GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA ************************************************** C1 CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC C2 CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC C3 CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC C4 CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC C5 CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC C6 CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC ************************************************** C1 GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC C2 GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC C3 GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC C4 GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC C5 GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC C6 GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC ************************************************** C1 GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC C2 GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC C3 GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC C4 GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC C5 GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC C6 GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC ************************************************** C1 AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC C2 AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC C3 AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC C4 AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC C5 AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC C6 AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC ************************************************** C1 CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC C2 CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC C3 CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC C4 CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC C5 CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC C6 CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC ************************************************** C1 GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG C2 GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG C3 GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG C4 GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG C5 GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG C6 GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG ************************************************** C1 GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC C2 GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC C3 GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC C4 GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC C5 GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC C6 GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC ************************************************** C1 CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA C2 CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA C3 CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA C4 CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA C5 CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA C6 CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA ************************************************** C1 CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA C2 CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA C3 CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA C4 CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA C5 CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA C6 CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA ************************************************** C1 GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA C2 GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA C3 GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA C4 GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA C5 GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA C6 GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA ************************************************** C1 CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT C2 CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT C3 CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT C4 CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT C5 CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT C6 CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT ************************************************** C1 TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA C2 TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA C3 TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA C4 TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA C5 TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA C6 TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA ************************************************** C1 TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT C2 TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT C3 TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT C4 TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT C5 TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT C6 TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT ************************************************** C1 GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC C2 GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC C3 GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC C4 GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC C5 GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC C6 GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC ************************************************** C1 CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC C2 CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC C3 CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC C4 CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC C5 CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC C6 CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC ************************************** >C1 GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC >C2 GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC >C3 GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC >C4 GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC >C5 GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC >C6 GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC >C1 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV >C2 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV >C3 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV >C4 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV >C5 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV >C6 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 888 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579789323 Setting output file names to "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 215949631 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0244374402 Seed = 250886326 Swapseed = 1579789323 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1987.386578 -- -24.965149 Chain 2 -- -1987.386578 -- -24.965149 Chain 3 -- -1987.386465 -- -24.965149 Chain 4 -- -1987.386275 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1987.386465 -- -24.965149 Chain 2 -- -1987.386578 -- -24.965149 Chain 3 -- -1987.386578 -- -24.965149 Chain 4 -- -1987.386465 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1987.387] (-1987.387) (-1987.386) (-1987.386) * [-1987.386] (-1987.387) (-1987.387) (-1987.386) 500 -- (-1228.562) [-1226.440] (-1232.683) (-1218.610) * [-1224.331] (-1221.475) (-1236.788) (-1231.333) -- 0:00:00 1000 -- (-1220.128) (-1221.474) [-1222.391] (-1216.448) * (-1223.585) [-1219.229] (-1223.418) (-1224.981) -- 0:00:00 1500 -- (-1225.755) (-1232.632) (-1226.260) [-1219.321] * [-1218.812] (-1223.797) (-1221.961) (-1230.600) -- 0:00:00 2000 -- (-1223.355) (-1220.510) [-1224.653] (-1228.942) * [-1218.857] (-1229.827) (-1216.008) (-1228.357) -- 0:00:00 2500 -- [-1217.910] (-1216.897) (-1224.856) (-1222.000) * [-1223.680] (-1226.485) (-1220.263) (-1222.511) -- 0:00:00 3000 -- [-1218.573] (-1227.884) (-1217.774) (-1221.608) * (-1216.606) [-1223.052] (-1219.629) (-1222.315) -- 0:00:00 3500 -- (-1221.315) (-1219.780) [-1220.415] (-1222.259) * (-1225.171) [-1226.738] (-1223.591) (-1221.651) -- 0:00:00 4000 -- [-1214.923] (-1221.132) (-1224.307) (-1223.310) * [-1217.898] (-1220.934) (-1227.373) (-1219.133) -- 0:00:00 4500 -- [-1222.378] (-1224.169) (-1220.397) (-1228.131) * (-1225.156) [-1226.241] (-1224.862) (-1222.305) -- 0:00:00 5000 -- [-1218.671] (-1219.830) (-1221.787) (-1220.525) * (-1218.637) [-1219.384] (-1222.097) (-1229.955) -- 0:00:00 Average standard deviation of split frequencies: 0.136639 5500 -- (-1225.189) (-1224.353) (-1224.021) [-1218.658] * (-1219.132) [-1219.895] (-1223.003) (-1220.620) -- 0:00:00 6000 -- (-1226.804) (-1217.374) [-1216.643] (-1223.011) * (-1223.259) [-1216.517] (-1220.937) (-1228.882) -- 0:00:00 6500 -- [-1219.016] (-1223.382) (-1217.339) (-1221.449) * (-1220.911) [-1219.624] (-1226.595) (-1217.580) -- 0:00:00 7000 -- (-1224.408) (-1224.722) (-1217.835) [-1217.762] * (-1221.322) (-1217.131) [-1221.367] (-1221.525) -- 0:00:00 7500 -- (-1218.428) (-1223.077) [-1224.637] (-1217.558) * (-1227.367) (-1222.194) [-1215.086] (-1228.836) -- 0:00:00 8000 -- (-1235.351) (-1225.260) [-1219.346] (-1216.793) * (-1225.277) (-1222.105) (-1218.019) [-1222.718] -- 0:00:00 8500 -- (-1222.493) [-1222.346] (-1218.083) (-1220.624) * (-1219.073) [-1215.995] (-1226.144) (-1218.227) -- 0:00:00 9000 -- (-1223.205) (-1219.911) (-1215.366) [-1219.962] * (-1221.389) [-1214.941] (-1224.186) (-1223.514) -- 0:00:00 9500 -- [-1223.278] (-1224.970) (-1219.472) (-1221.691) * (-1229.553) (-1222.744) (-1224.377) [-1214.695] -- 0:00:00 10000 -- (-1219.158) [-1226.740] (-1215.330) (-1226.787) * (-1221.248) (-1222.264) [-1216.841] (-1225.048) -- 0:00:00 Average standard deviation of split frequencies: 0.084179 10500 -- (-1226.905) (-1221.577) [-1221.584] (-1225.092) * (-1218.340) (-1217.385) [-1220.071] (-1224.957) -- 0:00:00 11000 -- [-1219.863] (-1218.391) (-1225.410) (-1220.726) * (-1226.266) [-1219.217] (-1220.334) (-1225.950) -- 0:00:00 11500 -- (-1227.436) [-1216.726] (-1232.434) (-1224.665) * (-1227.242) (-1220.410) (-1224.631) [-1218.205] -- 0:00:00 12000 -- (-1223.748) [-1228.349] (-1222.054) (-1220.220) * (-1222.461) [-1219.862] (-1218.323) (-1219.997) -- 0:01:22 12500 -- (-1221.343) (-1222.234) [-1216.405] (-1214.936) * (-1224.446) (-1227.486) (-1221.227) [-1225.373] -- 0:01:19 13000 -- (-1220.563) (-1220.028) (-1217.589) [-1218.917] * [-1220.527] (-1221.216) (-1231.765) (-1222.819) -- 0:01:15 13500 -- (-1215.211) [-1220.486] (-1225.733) (-1219.150) * [-1222.685] (-1216.779) (-1223.228) (-1218.160) -- 0:01:13 14000 -- (-1222.168) (-1224.923) (-1225.574) [-1219.489] * (-1229.042) (-1225.896) [-1218.119] (-1219.500) -- 0:01:10 14500 -- (-1222.101) (-1217.726) (-1221.639) [-1216.764] * (-1219.576) (-1220.045) [-1217.176] (-1219.160) -- 0:01:07 15000 -- (-1220.776) (-1219.978) (-1218.661) [-1219.113] * (-1232.915) (-1228.510) [-1217.997] (-1224.254) -- 0:01:05 Average standard deviation of split frequencies: 0.081456 15500 -- [-1219.480] (-1235.009) (-1226.498) (-1229.005) * (-1220.825) (-1219.356) [-1226.484] (-1221.579) -- 0:01:03 16000 -- (-1227.153) (-1226.806) [-1224.056] (-1223.450) * (-1221.238) [-1220.992] (-1218.196) (-1225.905) -- 0:01:01 16500 -- (-1218.639) [-1220.933] (-1219.231) (-1216.474) * (-1228.736) (-1224.698) [-1217.157] (-1226.463) -- 0:00:59 17000 -- (-1218.030) (-1220.661) [-1218.978] (-1219.904) * (-1222.227) [-1220.221] (-1218.845) (-1216.742) -- 0:00:57 17500 -- (-1221.612) (-1220.758) [-1212.367] (-1220.421) * (-1217.735) (-1220.645) (-1223.162) [-1219.649] -- 0:00:56 18000 -- (-1219.604) (-1221.772) (-1210.714) [-1218.518] * [-1217.394] (-1237.419) (-1222.791) (-1220.755) -- 0:00:54 18500 -- (-1220.384) [-1227.400] (-1212.456) (-1220.889) * (-1225.349) [-1219.550] (-1226.282) (-1218.669) -- 0:00:53 19000 -- (-1223.581) [-1221.617] (-1217.075) (-1223.502) * (-1226.240) (-1232.182) [-1222.331] (-1222.640) -- 0:00:51 19500 -- [-1223.058] (-1223.180) (-1217.372) (-1218.174) * [-1221.477] (-1216.781) (-1222.680) (-1217.590) -- 0:00:50 20000 -- (-1221.399) (-1221.801) [-1218.196] (-1221.072) * (-1215.257) (-1218.111) [-1220.605] (-1212.699) -- 0:00:49 Average standard deviation of split frequencies: 0.062347 20500 -- (-1224.850) (-1217.737) [-1210.918] (-1222.770) * (-1214.649) (-1211.073) (-1221.835) [-1212.505] -- 0:00:47 21000 -- (-1219.559) (-1217.254) [-1211.301] (-1220.378) * (-1214.657) [-1211.431] (-1218.568) (-1214.785) -- 0:00:46 21500 -- (-1219.225) (-1227.610) (-1212.053) [-1223.335] * (-1216.903) (-1211.186) [-1219.730] (-1213.531) -- 0:00:45 22000 -- (-1218.034) (-1226.642) (-1217.078) [-1219.040] * (-1216.594) [-1211.886] (-1217.571) (-1212.314) -- 0:00:44 22500 -- (-1223.498) (-1230.546) (-1213.769) [-1221.599] * (-1212.882) (-1211.474) [-1220.028] (-1211.072) -- 0:00:43 23000 -- [-1223.914] (-1230.763) (-1212.817) (-1218.808) * [-1215.997] (-1211.036) (-1225.304) (-1210.855) -- 0:00:42 23500 -- (-1221.693) (-1218.383) (-1212.990) [-1219.688] * (-1213.590) (-1212.433) (-1224.182) [-1211.273] -- 0:00:41 24000 -- (-1223.583) [-1216.662] (-1214.078) (-1216.898) * (-1215.353) [-1214.912] (-1220.204) (-1210.528) -- 0:00:40 24500 -- (-1220.407) (-1224.171) (-1218.009) [-1216.491] * (-1215.541) (-1211.467) [-1225.833] (-1214.072) -- 0:00:39 25000 -- [-1221.657] (-1219.693) (-1212.864) (-1218.752) * [-1213.605] (-1210.807) (-1227.332) (-1210.434) -- 0:00:39 Average standard deviation of split frequencies: 0.046838 25500 -- (-1229.437) (-1212.951) [-1212.103] (-1218.657) * [-1213.126] (-1210.807) (-1222.388) (-1213.333) -- 0:01:16 26000 -- (-1222.497) (-1226.582) [-1210.946] (-1218.907) * [-1213.373] (-1211.942) (-1217.855) (-1211.330) -- 0:01:14 26500 -- (-1221.295) [-1219.810] (-1211.486) (-1220.854) * (-1213.244) [-1213.398] (-1227.449) (-1212.264) -- 0:01:13 27000 -- (-1221.875) (-1228.116) [-1214.523] (-1221.089) * (-1213.015) (-1212.386) [-1227.727] (-1214.676) -- 0:01:12 27500 -- [-1218.278] (-1224.122) (-1214.424) (-1225.036) * [-1213.694] (-1211.140) (-1224.135) (-1210.535) -- 0:01:10 28000 -- [-1224.054] (-1224.607) (-1212.713) (-1227.979) * [-1213.211] (-1210.897) (-1226.526) (-1210.674) -- 0:01:09 28500 -- [-1219.206] (-1215.179) (-1211.225) (-1232.426) * [-1213.527] (-1212.988) (-1225.248) (-1215.191) -- 0:01:08 29000 -- (-1227.936) [-1216.917] (-1217.669) (-1224.383) * [-1212.374] (-1215.868) (-1221.961) (-1215.994) -- 0:01:06 29500 -- (-1219.861) [-1219.866] (-1214.043) (-1223.161) * [-1210.905] (-1210.976) (-1225.473) (-1215.160) -- 0:01:05 30000 -- (-1225.435) [-1219.140] (-1214.197) (-1227.455) * [-1210.609] (-1212.479) (-1224.716) (-1215.284) -- 0:01:04 Average standard deviation of split frequencies: 0.041923 30500 -- (-1225.345) (-1223.495) (-1213.170) [-1220.892] * (-1213.551) (-1211.606) [-1220.539] (-1213.821) -- 0:01:03 31000 -- (-1220.142) [-1220.736] (-1213.630) (-1222.762) * (-1212.228) (-1211.750) [-1220.241] (-1214.394) -- 0:01:02 31500 -- (-1224.971) [-1214.622] (-1215.882) (-1221.886) * (-1212.933) (-1211.552) [-1226.021] (-1214.963) -- 0:01:01 32000 -- [-1222.651] (-1222.830) (-1214.023) (-1218.966) * [-1213.602] (-1213.634) (-1218.370) (-1215.323) -- 0:01:00 32500 -- (-1223.051) (-1215.507) [-1214.350] (-1218.778) * (-1214.158) (-1211.321) [-1216.613] (-1212.529) -- 0:00:59 33000 -- [-1219.155] (-1220.846) (-1213.178) (-1222.795) * [-1211.432] (-1211.057) (-1229.541) (-1212.131) -- 0:00:58 33500 -- (-1214.718) (-1224.419) (-1211.022) [-1222.436] * (-1210.786) [-1211.690] (-1220.357) (-1213.504) -- 0:00:57 34000 -- (-1212.456) (-1216.717) [-1212.064] (-1217.458) * (-1217.614) (-1211.681) [-1219.212] (-1221.409) -- 0:00:56 34500 -- (-1212.634) (-1223.594) (-1211.358) [-1211.224] * [-1214.961] (-1216.822) (-1223.324) (-1219.443) -- 0:00:55 35000 -- [-1211.851] (-1221.953) (-1211.811) (-1211.589) * (-1212.584) [-1212.610] (-1247.831) (-1212.071) -- 0:00:55 Average standard deviation of split frequencies: 0.045519 35500 -- (-1211.606) (-1219.584) (-1213.417) [-1211.751] * (-1213.985) (-1212.128) (-1214.922) [-1211.197] -- 0:00:54 36000 -- (-1212.373) [-1217.963] (-1211.493) (-1212.068) * (-1220.579) (-1212.910) (-1213.403) [-1210.828] -- 0:00:53 36500 -- [-1214.341] (-1232.935) (-1211.117) (-1212.470) * [-1215.262] (-1214.658) (-1211.833) (-1211.168) -- 0:00:52 37000 -- (-1210.391) (-1222.984) (-1211.117) [-1211.342] * (-1216.699) (-1211.150) [-1212.703] (-1212.819) -- 0:00:52 37500 -- (-1211.289) (-1219.662) [-1213.967] (-1212.004) * [-1213.711] (-1212.858) (-1211.548) (-1213.194) -- 0:00:51 38000 -- [-1211.451] (-1220.704) (-1212.995) (-1212.619) * (-1212.416) (-1212.421) (-1211.892) [-1213.432] -- 0:00:50 38500 -- (-1212.122) (-1222.322) [-1213.408] (-1214.078) * (-1214.019) (-1212.994) (-1214.021) [-1214.003] -- 0:01:14 39000 -- (-1213.598) (-1228.137) [-1212.348] (-1212.688) * [-1212.417] (-1210.945) (-1215.001) (-1213.833) -- 0:01:13 39500 -- [-1214.085] (-1220.466) (-1212.916) (-1214.105) * (-1212.054) (-1212.375) [-1211.955] (-1215.571) -- 0:01:12 40000 -- [-1211.779] (-1227.384) (-1214.526) (-1215.224) * [-1211.702] (-1212.005) (-1211.457) (-1213.880) -- 0:01:12 Average standard deviation of split frequencies: 0.040572 40500 -- (-1211.590) (-1219.241) [-1211.965] (-1213.225) * (-1213.342) [-1211.651] (-1212.121) (-1211.101) -- 0:01:11 41000 -- (-1210.736) (-1226.214) [-1212.040] (-1212.596) * [-1211.408] (-1212.458) (-1213.498) (-1214.855) -- 0:01:10 41500 -- [-1212.711] (-1230.268) (-1215.046) (-1215.367) * (-1211.610) (-1213.533) (-1211.663) [-1211.896] -- 0:01:09 42000 -- (-1212.319) [-1220.958] (-1211.736) (-1212.121) * (-1211.400) (-1214.528) (-1213.767) [-1214.616] -- 0:01:08 42500 -- (-1216.867) [-1223.400] (-1212.490) (-1212.205) * [-1211.242] (-1211.143) (-1211.951) (-1215.073) -- 0:01:07 43000 -- (-1211.623) (-1227.087) (-1214.516) [-1213.720] * (-1214.893) (-1213.160) [-1211.951] (-1213.154) -- 0:01:06 43500 -- (-1210.344) (-1229.004) [-1213.486] (-1213.055) * (-1213.411) (-1213.014) [-1211.856] (-1214.632) -- 0:01:05 44000 -- (-1211.919) [-1216.957] (-1212.759) (-1211.664) * (-1211.201) (-1211.775) [-1211.138] (-1212.337) -- 0:01:05 44500 -- (-1210.696) (-1219.649) (-1214.704) [-1211.808] * [-1211.206] (-1212.067) (-1211.671) (-1211.228) -- 0:01:04 45000 -- (-1211.226) (-1223.849) [-1213.657] (-1212.640) * (-1213.698) (-1211.377) [-1211.633] (-1213.169) -- 0:01:03 Average standard deviation of split frequencies: 0.026734 45500 -- [-1210.977] (-1218.934) (-1211.566) (-1221.997) * (-1212.663) (-1211.877) (-1211.495) [-1211.613] -- 0:01:02 46000 -- (-1211.610) (-1219.259) (-1212.171) [-1217.532] * (-1212.859) [-1212.520] (-1212.949) (-1211.571) -- 0:01:02 46500 -- (-1210.897) (-1218.733) (-1212.570) [-1212.451] * (-1212.799) (-1211.658) [-1213.020] (-1210.868) -- 0:01:01 47000 -- (-1212.539) (-1215.821) (-1213.251) [-1213.036] * (-1215.402) (-1211.967) [-1212.531] (-1211.027) -- 0:01:00 47500 -- [-1213.185] (-1228.756) (-1211.296) (-1211.512) * (-1214.954) (-1213.575) (-1214.182) [-1211.527] -- 0:01:00 48000 -- (-1219.000) [-1228.520] (-1211.899) (-1212.963) * (-1211.445) (-1212.111) (-1213.535) [-1210.993] -- 0:00:59 48500 -- (-1214.812) [-1225.276] (-1212.176) (-1211.918) * (-1213.400) [-1211.919] (-1212.272) (-1213.569) -- 0:00:58 49000 -- (-1213.406) (-1218.690) (-1215.192) [-1213.116] * (-1214.927) [-1211.470] (-1213.885) (-1215.386) -- 0:00:58 49500 -- (-1212.228) [-1220.877] (-1215.384) (-1212.309) * [-1212.265] (-1214.412) (-1212.006) (-1215.498) -- 0:00:57 50000 -- (-1211.384) (-1229.922) (-1211.723) [-1213.193] * [-1211.537] (-1210.535) (-1214.737) (-1213.409) -- 0:00:57 Average standard deviation of split frequencies: 0.034679 50500 -- (-1212.477) (-1228.449) (-1215.054) [-1212.139] * (-1214.818) (-1216.254) [-1213.165] (-1217.049) -- 0:00:56 51000 -- (-1212.453) (-1219.123) [-1212.266] (-1212.331) * [-1213.350] (-1215.690) (-1212.029) (-1213.031) -- 0:00:55 51500 -- (-1211.680) (-1219.427) (-1212.954) [-1211.935] * (-1214.429) (-1211.894) [-1212.347] (-1210.798) -- 0:01:13 52000 -- (-1214.549) [-1219.704] (-1213.420) (-1212.104) * [-1212.052] (-1213.961) (-1212.394) (-1212.149) -- 0:01:12 52500 -- (-1212.282) (-1216.454) [-1213.339] (-1210.912) * [-1212.884] (-1214.539) (-1210.352) (-1212.191) -- 0:01:12 53000 -- (-1211.785) (-1211.495) (-1213.884) [-1215.477] * (-1211.022) (-1217.569) (-1210.525) [-1214.095] -- 0:01:11 53500 -- [-1210.757] (-1215.615) (-1213.374) (-1214.203) * (-1213.479) [-1211.742] (-1211.080) (-1212.625) -- 0:01:10 54000 -- (-1212.188) (-1213.104) [-1212.643] (-1211.989) * (-1210.696) (-1210.490) (-1210.705) [-1212.477] -- 0:01:10 54500 -- (-1214.062) (-1212.760) (-1213.062) [-1212.149] * (-1212.042) (-1210.485) [-1213.805] (-1213.899) -- 0:01:09 55000 -- (-1211.936) [-1213.000] (-1212.037) (-1213.495) * [-1210.840] (-1210.690) (-1212.320) (-1214.134) -- 0:01:08 Average standard deviation of split frequencies: 0.031567 55500 -- (-1211.984) [-1212.673] (-1213.363) (-1210.497) * (-1210.572) (-1213.927) (-1215.366) [-1212.967] -- 0:01:08 56000 -- (-1211.258) (-1214.534) [-1211.393] (-1212.663) * (-1211.468) [-1211.136] (-1210.886) (-1212.969) -- 0:01:07 56500 -- [-1212.527] (-1212.586) (-1211.764) (-1211.900) * (-1212.982) (-1219.920) (-1212.938) [-1213.233] -- 0:01:06 57000 -- (-1214.826) (-1213.295) [-1212.670] (-1211.900) * [-1211.402] (-1216.133) (-1212.977) (-1211.857) -- 0:01:06 57500 -- (-1210.645) [-1211.355] (-1216.798) (-1211.229) * (-1213.523) (-1214.841) (-1213.960) [-1211.899] -- 0:01:05 58000 -- [-1210.645] (-1213.097) (-1212.754) (-1210.952) * (-1213.104) (-1213.854) (-1212.725) [-1214.684] -- 0:01:04 58500 -- (-1211.213) (-1215.551) (-1212.053) [-1212.164] * (-1211.158) (-1215.395) [-1210.852] (-1214.684) -- 0:01:04 59000 -- (-1211.151) [-1216.313] (-1211.377) (-1210.447) * [-1211.132] (-1217.135) (-1211.276) (-1220.406) -- 0:01:03 59500 -- (-1211.098) (-1214.655) (-1211.225) [-1212.633] * (-1213.944) (-1216.541) (-1211.058) [-1219.598] -- 0:01:03 60000 -- [-1212.554] (-1214.719) (-1210.837) (-1214.006) * (-1212.234) (-1212.271) [-1211.166] (-1215.916) -- 0:01:02 Average standard deviation of split frequencies: 0.024129 60500 -- (-1212.143) (-1211.477) [-1211.740] (-1212.929) * (-1212.278) (-1214.391) (-1215.344) [-1213.346] -- 0:01:02 61000 -- (-1210.742) (-1213.773) [-1213.786] (-1212.927) * (-1211.886) [-1211.450] (-1213.701) (-1212.179) -- 0:01:01 61500 -- (-1210.547) [-1212.296] (-1212.238) (-1213.962) * [-1210.798] (-1213.307) (-1211.993) (-1213.275) -- 0:01:01 62000 -- (-1211.793) (-1213.655) [-1210.839] (-1213.393) * (-1210.944) [-1212.598] (-1211.918) (-1212.874) -- 0:01:00 62500 -- (-1212.898) (-1212.214) (-1212.446) [-1213.573] * (-1211.462) [-1213.760] (-1214.052) (-1216.208) -- 0:01:00 63000 -- (-1212.922) (-1213.686) (-1217.967) [-1214.223] * (-1211.702) (-1213.861) [-1210.187] (-1214.563) -- 0:00:59 63500 -- (-1211.926) (-1214.174) [-1211.412] (-1213.347) * [-1212.048] (-1213.012) (-1210.410) (-1212.654) -- 0:00:58 64000 -- (-1214.257) (-1212.837) (-1211.179) [-1211.379] * (-1211.323) (-1212.853) [-1211.607] (-1210.777) -- 0:00:58 64500 -- [-1212.485] (-1215.183) (-1212.692) (-1211.532) * (-1211.443) (-1212.411) (-1212.419) [-1210.985] -- 0:00:58 65000 -- (-1213.963) [-1211.916] (-1213.657) (-1211.647) * (-1213.626) (-1211.561) (-1213.753) [-1213.075] -- 0:00:57 Average standard deviation of split frequencies: 0.025356 65500 -- (-1216.504) [-1212.718] (-1215.090) (-1214.493) * [-1214.599] (-1213.758) (-1212.063) (-1212.769) -- 0:00:57 66000 -- (-1212.359) (-1212.886) (-1210.736) [-1211.709] * (-1214.815) [-1210.988] (-1211.702) (-1211.389) -- 0:00:56 66500 -- (-1210.544) (-1215.080) [-1210.827] (-1212.383) * [-1212.296] (-1215.077) (-1211.790) (-1213.240) -- 0:00:56 67000 -- (-1212.915) (-1214.574) [-1211.383] (-1211.735) * (-1211.751) (-1212.597) (-1210.970) [-1214.852] -- 0:00:55 67500 -- [-1213.039] (-1217.220) (-1212.846) (-1217.253) * (-1213.413) (-1211.304) (-1212.042) [-1212.620] -- 0:01:09 68000 -- [-1211.279] (-1215.936) (-1212.384) (-1215.711) * (-1214.466) (-1211.436) (-1210.285) [-1210.922] -- 0:01:08 68500 -- (-1210.567) (-1214.460) [-1213.260] (-1216.830) * (-1212.939) [-1211.425] (-1211.497) (-1210.907) -- 0:01:07 69000 -- (-1213.133) [-1211.097] (-1212.452) (-1214.164) * (-1211.660) (-1211.378) (-1212.333) [-1210.605] -- 0:01:07 69500 -- (-1213.491) [-1211.340] (-1212.037) (-1211.410) * [-1211.578] (-1212.697) (-1210.303) (-1211.916) -- 0:01:06 70000 -- (-1210.934) [-1213.510] (-1212.865) (-1213.368) * (-1212.167) (-1212.383) (-1212.747) [-1211.921] -- 0:01:06 Average standard deviation of split frequencies: 0.024928 70500 -- (-1210.935) [-1213.948] (-1214.362) (-1213.225) * (-1211.793) (-1213.450) [-1210.803] (-1215.462) -- 0:01:05 71000 -- (-1212.911) (-1213.723) [-1210.798] (-1213.417) * (-1212.397) (-1212.064) (-1213.164) [-1214.511] -- 0:01:05 71500 -- (-1211.528) (-1212.109) (-1211.954) [-1211.349] * (-1211.618) (-1211.147) [-1211.390] (-1213.377) -- 0:01:04 72000 -- (-1213.254) (-1214.477) (-1213.143) [-1210.531] * (-1213.242) (-1214.867) (-1213.034) [-1214.223] -- 0:01:04 72500 -- (-1211.699) (-1211.629) (-1213.706) [-1210.598] * (-1211.715) (-1213.325) [-1212.487] (-1212.026) -- 0:01:03 73000 -- (-1214.172) [-1214.180] (-1214.860) (-1210.825) * (-1211.278) (-1212.807) (-1211.373) [-1211.573] -- 0:01:03 73500 -- (-1211.550) [-1213.336] (-1212.454) (-1211.124) * (-1215.376) (-1211.750) [-1213.376] (-1211.711) -- 0:01:03 74000 -- [-1212.206] (-1214.013) (-1214.106) (-1211.099) * (-1212.780) (-1212.264) (-1211.226) [-1211.194] -- 0:01:02 74500 -- (-1212.604) (-1214.496) [-1213.091] (-1213.417) * (-1212.738) (-1215.293) [-1210.812] (-1212.191) -- 0:01:02 75000 -- (-1210.629) (-1214.905) [-1210.627] (-1210.956) * (-1211.966) (-1210.686) (-1210.974) [-1213.835] -- 0:01:01 Average standard deviation of split frequencies: 0.025137 75500 -- [-1211.421] (-1213.015) (-1211.181) (-1215.935) * (-1216.724) (-1212.301) (-1211.149) [-1214.283] -- 0:01:01 76000 -- (-1211.143) (-1213.121) [-1211.198] (-1213.399) * [-1212.327] (-1211.042) (-1210.687) (-1212.679) -- 0:01:00 76500 -- (-1214.404) (-1215.197) [-1213.329] (-1228.194) * (-1212.142) [-1212.347] (-1210.669) (-1212.232) -- 0:01:00 77000 -- (-1212.128) (-1216.323) [-1216.103] (-1216.859) * (-1212.610) (-1217.682) [-1210.669] (-1212.917) -- 0:00:59 77500 -- (-1211.315) (-1213.034) [-1212.238] (-1215.584) * (-1211.957) (-1212.633) [-1211.236] (-1210.714) -- 0:00:59 78000 -- [-1213.398] (-1215.679) (-1211.877) (-1211.836) * [-1211.037] (-1213.108) (-1211.107) (-1212.106) -- 0:00:59 78500 -- [-1213.390] (-1212.446) (-1210.587) (-1212.086) * (-1211.043) [-1212.580] (-1211.375) (-1210.752) -- 0:00:58 79000 -- (-1212.541) (-1215.070) (-1210.609) [-1212.390] * (-1211.554) (-1211.820) (-1212.110) [-1214.321] -- 0:00:58 79500 -- (-1213.664) (-1210.979) [-1214.779] (-1211.527) * (-1211.073) (-1212.596) (-1216.370) [-1211.606] -- 0:00:57 80000 -- (-1212.654) (-1211.251) [-1211.903] (-1211.200) * (-1210.987) (-1213.268) (-1210.836) [-1215.234] -- 0:00:57 Average standard deviation of split frequencies: 0.026947 80500 -- (-1215.770) (-1211.326) (-1214.761) [-1214.034] * (-1210.693) (-1212.635) [-1211.634] (-1212.540) -- 0:00:57 81000 -- (-1211.683) (-1211.235) [-1213.377] (-1214.959) * (-1210.205) [-1212.641] (-1210.948) (-1213.715) -- 0:00:56 81500 -- (-1212.156) [-1213.960] (-1213.380) (-1211.924) * (-1210.323) (-1210.317) [-1211.079] (-1211.386) -- 0:00:56 82000 -- [-1210.307] (-1214.368) (-1216.546) (-1212.207) * (-1213.207) (-1211.204) [-1213.504] (-1213.234) -- 0:00:55 82500 -- [-1210.614] (-1214.945) (-1212.125) (-1210.926) * (-1213.081) (-1212.133) (-1212.763) [-1211.148] -- 0:00:55 83000 -- (-1210.327) (-1213.075) (-1211.961) [-1211.639] * (-1213.259) [-1211.638] (-1213.367) (-1214.315) -- 0:00:55 83500 -- [-1210.771] (-1212.517) (-1211.374) (-1211.055) * [-1211.352] (-1214.081) (-1215.371) (-1222.216) -- 0:00:54 84000 -- (-1214.037) (-1214.682) (-1212.460) [-1211.300] * (-1213.206) (-1215.960) [-1212.518] (-1212.976) -- 0:01:05 84500 -- (-1213.102) (-1214.555) (-1211.485) [-1215.277] * (-1213.096) (-1212.072) (-1213.046) [-1213.111] -- 0:01:05 85000 -- (-1216.214) (-1212.517) [-1210.826] (-1213.377) * (-1212.217) [-1216.026] (-1213.570) (-1213.106) -- 0:01:04 Average standard deviation of split frequencies: 0.023296 85500 -- (-1213.979) (-1213.785) (-1212.748) [-1217.481] * [-1211.825] (-1213.221) (-1211.778) (-1212.187) -- 0:01:04 86000 -- (-1213.451) [-1213.344] (-1210.856) (-1214.858) * (-1213.462) (-1212.586) [-1211.057] (-1212.344) -- 0:01:03 86500 -- (-1211.819) (-1212.794) (-1210.514) [-1214.840] * [-1210.712] (-1212.448) (-1213.184) (-1212.273) -- 0:01:03 87000 -- (-1214.662) (-1214.440) [-1211.141] (-1215.056) * (-1211.538) (-1215.845) (-1211.420) [-1213.903] -- 0:01:02 87500 -- (-1212.212) (-1212.902) (-1210.801) [-1212.986] * (-1211.769) [-1212.666] (-1213.599) (-1212.657) -- 0:01:02 88000 -- (-1210.830) [-1212.380] (-1211.403) (-1213.747) * (-1210.404) (-1213.459) [-1210.839] (-1211.420) -- 0:01:02 88500 -- [-1213.873] (-1213.797) (-1211.493) (-1211.738) * (-1210.366) (-1211.194) (-1212.038) [-1210.410] -- 0:01:01 89000 -- [-1212.614] (-1214.038) (-1212.385) (-1213.654) * (-1213.971) (-1212.781) [-1211.670] (-1215.004) -- 0:01:01 89500 -- (-1213.484) (-1210.623) (-1211.065) [-1212.733] * (-1213.915) (-1212.806) (-1211.368) [-1210.987] -- 0:01:01 90000 -- (-1212.014) (-1214.719) [-1212.576] (-1212.095) * (-1212.469) (-1218.036) (-1211.434) [-1210.572] -- 0:01:00 Average standard deviation of split frequencies: 0.021892 90500 -- [-1219.127] (-1215.382) (-1210.979) (-1215.235) * (-1217.580) (-1219.178) [-1211.191] (-1213.920) -- 0:01:00 91000 -- (-1214.766) (-1210.983) [-1211.107] (-1215.177) * (-1215.754) [-1213.778] (-1211.805) (-1211.449) -- 0:00:59 91500 -- (-1210.610) (-1210.866) [-1211.095] (-1213.912) * (-1215.868) (-1211.977) [-1210.464] (-1211.823) -- 0:00:59 92000 -- (-1217.290) (-1215.163) [-1213.080] (-1212.067) * (-1212.525) (-1212.352) [-1210.480] (-1214.363) -- 0:00:59 92500 -- (-1213.739) (-1226.468) [-1213.538] (-1215.264) * (-1212.135) (-1214.645) (-1210.449) [-1211.405] -- 0:00:58 93000 -- (-1212.307) (-1226.775) (-1214.248) [-1210.973] * (-1214.602) (-1211.372) (-1211.294) [-1212.421] -- 0:00:58 93500 -- (-1211.667) (-1219.293) [-1211.915] (-1214.107) * (-1215.603) (-1212.073) [-1213.734] (-1214.742) -- 0:00:58 94000 -- (-1213.027) (-1215.993) [-1211.489] (-1210.637) * (-1212.171) [-1212.953] (-1212.287) (-1216.029) -- 0:00:57 94500 -- (-1211.116) [-1213.647] (-1210.726) (-1211.107) * [-1211.442] (-1212.455) (-1213.186) (-1211.825) -- 0:00:57 95000 -- (-1210.700) (-1213.749) (-1212.882) [-1212.252] * [-1212.493] (-1215.796) (-1211.439) (-1216.030) -- 0:00:57 Average standard deviation of split frequencies: 0.021006 95500 -- (-1211.010) (-1215.543) [-1214.225] (-1215.835) * [-1215.100] (-1214.562) (-1212.723) (-1211.652) -- 0:00:56 96000 -- (-1210.349) (-1214.515) (-1211.354) [-1212.841] * (-1214.153) (-1214.348) [-1211.711] (-1212.811) -- 0:00:56 96500 -- (-1210.358) (-1215.820) [-1211.735] (-1212.325) * (-1214.369) (-1213.090) (-1210.569) [-1212.843] -- 0:00:56 97000 -- [-1214.536] (-1214.543) (-1211.609) (-1214.756) * (-1213.517) (-1211.773) (-1211.218) [-1212.098] -- 0:00:55 97500 -- (-1212.511) [-1213.579] (-1211.301) (-1212.004) * (-1213.176) (-1210.879) [-1210.538] (-1210.631) -- 0:00:55 98000 -- (-1214.154) (-1212.828) [-1214.157] (-1211.201) * (-1211.667) (-1210.415) (-1214.366) [-1210.534] -- 0:00:55 98500 -- (-1213.268) (-1210.706) (-1213.928) [-1211.434] * [-1211.261] (-1211.450) (-1214.135) (-1211.982) -- 0:01:04 99000 -- (-1216.595) [-1210.516] (-1212.164) (-1211.081) * (-1211.657) (-1210.739) (-1211.936) [-1211.945] -- 0:01:03 99500 -- (-1215.661) (-1214.087) (-1213.342) [-1216.942] * (-1211.710) [-1213.369] (-1211.801) (-1214.431) -- 0:01:03 100000 -- (-1212.605) (-1212.868) [-1214.249] (-1213.137) * (-1211.016) (-1214.493) (-1214.609) [-1210.708] -- 0:01:02 Average standard deviation of split frequencies: 0.021486 100500 -- (-1213.541) (-1211.399) (-1211.281) [-1211.735] * (-1211.894) (-1215.937) (-1214.061) [-1211.105] -- 0:01:02 101000 -- (-1217.480) (-1211.448) [-1211.078] (-1211.052) * (-1210.514) (-1212.680) [-1212.472] (-1212.139) -- 0:01:02 101500 -- (-1215.271) [-1212.304] (-1212.289) (-1211.088) * (-1212.187) (-1213.645) [-1210.841] (-1211.952) -- 0:01:01 102000 -- (-1210.456) [-1213.097] (-1212.621) (-1211.084) * [-1210.772] (-1210.969) (-1216.993) (-1213.035) -- 0:01:01 102500 -- (-1211.005) [-1211.273] (-1212.980) (-1211.661) * [-1210.677] (-1211.429) (-1212.753) (-1211.135) -- 0:01:01 103000 -- (-1212.313) (-1210.707) [-1213.526] (-1211.105) * (-1212.394) [-1213.536] (-1212.252) (-1212.720) -- 0:01:00 103500 -- [-1210.873] (-1210.997) (-1216.066) (-1213.093) * (-1212.310) [-1213.329] (-1211.123) (-1212.510) -- 0:01:00 104000 -- (-1211.927) (-1213.062) [-1213.405] (-1214.414) * (-1211.863) [-1213.338] (-1212.509) (-1213.716) -- 0:01:00 104500 -- (-1213.120) (-1215.013) [-1213.392] (-1212.250) * [-1211.775] (-1211.548) (-1213.060) (-1212.136) -- 0:00:59 105000 -- (-1212.600) (-1213.602) [-1212.062] (-1215.398) * (-1211.695) [-1211.893] (-1215.475) (-1212.409) -- 0:00:59 Average standard deviation of split frequencies: 0.022938 105500 -- (-1212.141) [-1213.108] (-1215.957) (-1210.985) * [-1212.343] (-1215.305) (-1214.201) (-1210.467) -- 0:00:59 106000 -- (-1212.627) (-1210.786) (-1215.067) [-1212.316] * [-1214.011] (-1214.090) (-1215.336) (-1212.784) -- 0:00:59 106500 -- [-1211.352] (-1211.047) (-1211.117) (-1216.435) * (-1215.492) (-1214.143) (-1214.999) [-1211.690] -- 0:00:58 107000 -- (-1210.359) (-1212.509) (-1211.487) [-1210.872] * (-1212.862) [-1213.081] (-1215.981) (-1211.593) -- 0:00:58 107500 -- (-1211.627) [-1212.021] (-1211.388) (-1211.091) * (-1214.329) (-1212.066) (-1211.276) [-1212.305] -- 0:00:58 108000 -- (-1210.358) (-1210.840) (-1214.862) [-1212.768] * (-1213.596) (-1212.438) [-1210.795] (-1212.532) -- 0:00:57 108500 -- (-1211.759) [-1212.797] (-1212.771) (-1212.249) * (-1213.991) (-1210.664) (-1211.089) [-1214.156] -- 0:00:57 109000 -- [-1212.746] (-1212.809) (-1213.256) (-1212.049) * [-1210.963] (-1214.540) (-1211.258) (-1214.318) -- 0:00:57 109500 -- (-1211.943) (-1212.351) [-1212.468] (-1213.274) * (-1212.349) (-1213.675) [-1212.252] (-1213.486) -- 0:00:56 110000 -- (-1211.101) (-1213.568) [-1213.389] (-1213.748) * (-1213.565) (-1211.651) [-1211.882] (-1219.219) -- 0:00:56 Average standard deviation of split frequencies: 0.022150 110500 -- (-1211.436) (-1215.993) (-1213.974) [-1211.727] * (-1212.150) (-1212.693) (-1214.576) [-1215.335] -- 0:00:56 111000 -- (-1210.878) (-1211.812) [-1211.963] (-1214.227) * [-1211.744] (-1211.913) (-1213.395) (-1215.406) -- 0:00:56 111500 -- [-1211.262] (-1214.150) (-1218.121) (-1216.561) * (-1211.646) (-1210.837) (-1212.145) [-1211.930] -- 0:00:55 112000 -- (-1210.801) [-1210.620] (-1216.402) (-1217.078) * [-1211.324] (-1212.897) (-1211.443) (-1211.603) -- 0:00:55 112500 -- (-1211.339) (-1210.762) [-1213.617] (-1212.972) * (-1210.854) (-1210.506) [-1211.276] (-1210.884) -- 0:00:55 113000 -- (-1211.674) [-1213.970] (-1215.809) (-1215.363) * (-1212.891) (-1210.852) [-1212.488] (-1214.955) -- 0:00:54 113500 -- [-1212.419] (-1211.222) (-1213.702) (-1214.397) * (-1211.543) (-1212.089) [-1219.958] (-1214.010) -- 0:00:54 114000 -- (-1214.700) (-1211.318) [-1214.512] (-1215.478) * (-1212.836) [-1211.243] (-1213.574) (-1212.883) -- 0:01:02 114500 -- [-1214.916] (-1212.699) (-1212.652) (-1216.717) * (-1210.582) [-1210.628] (-1213.851) (-1212.761) -- 0:01:01 115000 -- (-1212.652) [-1216.286] (-1212.150) (-1213.310) * [-1213.017] (-1211.106) (-1213.849) (-1212.109) -- 0:01:01 Average standard deviation of split frequencies: 0.021867 115500 -- [-1212.688] (-1213.062) (-1210.666) (-1214.371) * (-1212.394) (-1211.977) (-1214.020) [-1214.239] -- 0:01:01 116000 -- [-1212.117] (-1214.379) (-1214.161) (-1214.039) * [-1211.426] (-1211.867) (-1211.938) (-1214.747) -- 0:01:00 116500 -- (-1212.218) (-1211.637) [-1215.840] (-1214.654) * [-1212.501] (-1213.429) (-1213.635) (-1215.732) -- 0:01:00 117000 -- [-1211.358] (-1211.359) (-1214.763) (-1216.830) * (-1212.898) (-1212.268) (-1212.355) [-1214.278] -- 0:01:00 117500 -- (-1211.652) [-1213.443] (-1211.725) (-1213.167) * (-1217.748) [-1212.866] (-1211.925) (-1212.416) -- 0:01:00 118000 -- (-1211.669) (-1211.333) [-1211.239] (-1212.756) * [-1215.601] (-1214.126) (-1211.962) (-1213.561) -- 0:00:59 118500 -- (-1213.836) (-1214.233) (-1211.756) [-1211.927] * (-1214.619) [-1214.057] (-1212.398) (-1211.915) -- 0:00:59 119000 -- (-1213.613) [-1216.869] (-1211.755) (-1215.841) * (-1213.342) (-1212.914) (-1213.573) [-1211.557] -- 0:00:59 119500 -- [-1213.118] (-1213.275) (-1211.034) (-1211.325) * [-1212.288] (-1212.098) (-1213.617) (-1213.226) -- 0:00:58 120000 -- (-1213.040) (-1213.780) (-1211.161) [-1213.564] * (-1211.793) (-1212.119) (-1214.927) [-1211.741] -- 0:00:58 Average standard deviation of split frequencies: 0.021682 120500 -- (-1213.314) [-1214.033] (-1211.333) (-1211.841) * (-1214.583) (-1211.739) (-1214.000) [-1212.363] -- 0:00:58 121000 -- [-1212.968] (-1211.374) (-1211.625) (-1218.241) * (-1211.598) (-1214.366) [-1212.249] (-1211.284) -- 0:00:58 121500 -- [-1213.282] (-1212.396) (-1212.543) (-1212.845) * [-1211.943] (-1216.400) (-1213.309) (-1212.913) -- 0:00:57 122000 -- (-1214.748) (-1212.203) (-1212.402) [-1211.470] * [-1212.765] (-1220.811) (-1216.907) (-1212.028) -- 0:00:57 122500 -- (-1215.807) (-1214.175) [-1211.207] (-1214.234) * (-1211.919) (-1212.969) (-1212.241) [-1210.416] -- 0:00:57 123000 -- (-1210.901) (-1212.316) [-1211.194] (-1214.243) * [-1212.391] (-1211.457) (-1210.714) (-1210.235) -- 0:00:57 123500 -- [-1212.605] (-1212.282) (-1213.641) (-1213.872) * [-1212.005] (-1210.586) (-1211.758) (-1213.219) -- 0:00:56 124000 -- (-1212.859) (-1213.694) [-1211.773] (-1215.031) * (-1213.030) [-1211.577] (-1216.542) (-1212.241) -- 0:00:56 124500 -- (-1212.023) (-1213.222) [-1213.097] (-1215.910) * (-1217.536) (-1212.264) (-1212.326) [-1211.023] -- 0:00:56 125000 -- [-1210.809] (-1213.236) (-1212.779) (-1213.980) * (-1214.733) (-1212.102) (-1212.524) [-1211.053] -- 0:00:56 Average standard deviation of split frequencies: 0.022635 125500 -- (-1212.657) (-1210.493) [-1215.812] (-1211.489) * [-1211.344] (-1212.177) (-1212.617) (-1210.873) -- 0:00:55 126000 -- [-1212.649] (-1212.541) (-1212.729) (-1215.350) * [-1210.887] (-1212.183) (-1212.008) (-1213.127) -- 0:00:55 126500 -- (-1211.090) [-1212.562] (-1212.094) (-1212.058) * [-1210.744] (-1211.728) (-1214.344) (-1213.414) -- 0:00:55 127000 -- (-1212.134) (-1210.798) (-1212.103) [-1214.138] * (-1213.315) [-1211.846] (-1214.003) (-1213.986) -- 0:00:54 127500 -- [-1213.068] (-1211.058) (-1211.639) (-1211.453) * (-1211.074) (-1214.083) (-1213.354) [-1213.005] -- 0:00:54 128000 -- (-1211.902) [-1210.589] (-1212.355) (-1210.587) * (-1211.275) (-1211.701) (-1213.265) [-1213.161] -- 0:00:54 128500 -- (-1211.768) [-1211.164] (-1212.093) (-1211.171) * (-1212.070) (-1216.014) [-1212.504] (-1215.457) -- 0:00:54 129000 -- (-1211.366) [-1211.759] (-1211.102) (-1212.008) * [-1210.603] (-1210.986) (-1211.897) (-1217.935) -- 0:00:54 129500 -- (-1212.863) (-1211.042) [-1214.915] (-1211.137) * [-1211.758] (-1212.985) (-1210.986) (-1213.838) -- 0:00:53 130000 -- (-1212.262) [-1213.223] (-1217.955) (-1210.971) * (-1214.367) [-1211.082] (-1211.341) (-1211.194) -- 0:01:00 Average standard deviation of split frequencies: 0.023250 130500 -- (-1211.822) (-1211.576) [-1216.927] (-1211.341) * (-1212.292) [-1211.587] (-1212.431) (-1216.327) -- 0:00:59 131000 -- (-1214.490) [-1211.438] (-1217.157) (-1213.472) * [-1210.838] (-1213.011) (-1212.513) (-1214.741) -- 0:00:59 131500 -- (-1211.269) (-1210.510) (-1213.731) [-1212.062] * (-1211.734) (-1213.100) (-1212.176) [-1212.870] -- 0:00:59 132000 -- [-1210.952] (-1210.696) (-1212.346) (-1211.390) * (-1211.710) (-1217.143) [-1211.411] (-1212.012) -- 0:00:59 132500 -- (-1212.887) (-1215.025) (-1213.439) [-1210.587] * (-1211.791) (-1213.845) [-1210.993] (-1212.837) -- 0:00:58 133000 -- (-1210.711) (-1214.317) (-1214.267) [-1210.810] * (-1210.489) (-1213.080) (-1212.593) [-1211.811] -- 0:00:58 133500 -- [-1212.719] (-1216.812) (-1211.220) (-1210.548) * [-1211.290] (-1212.496) (-1213.077) (-1211.155) -- 0:00:58 134000 -- (-1211.216) (-1212.252) (-1212.078) [-1211.676] * [-1210.524] (-1212.447) (-1216.703) (-1211.684) -- 0:00:58 134500 -- (-1212.113) (-1211.686) [-1211.295] (-1215.371) * [-1211.322] (-1211.460) (-1211.903) (-1211.088) -- 0:00:57 135000 -- (-1213.878) (-1213.763) (-1215.799) [-1213.994] * (-1213.054) (-1215.256) [-1215.415] (-1210.776) -- 0:00:57 Average standard deviation of split frequencies: 0.023686 135500 -- (-1212.836) (-1212.651) (-1213.575) [-1214.388] * [-1212.400] (-1213.079) (-1211.720) (-1210.789) -- 0:00:57 136000 -- (-1215.586) [-1217.034] (-1213.362) (-1214.299) * (-1212.457) (-1211.837) (-1212.883) [-1210.828] -- 0:00:57 136500 -- (-1215.483) (-1222.099) [-1212.367] (-1215.605) * (-1216.845) [-1211.691] (-1213.114) (-1212.732) -- 0:00:56 137000 -- (-1213.027) (-1212.443) [-1210.347] (-1215.515) * (-1211.818) (-1215.471) (-1213.342) [-1212.599] -- 0:00:56 137500 -- [-1213.029] (-1212.309) (-1212.479) (-1216.090) * (-1211.361) [-1216.424] (-1211.978) (-1212.532) -- 0:00:56 138000 -- [-1210.699] (-1210.395) (-1211.589) (-1218.144) * (-1211.132) (-1215.833) [-1212.288] (-1211.430) -- 0:00:56 138500 -- (-1211.290) (-1210.938) (-1211.586) [-1214.568] * (-1213.508) (-1215.427) (-1211.573) [-1213.676] -- 0:00:55 139000 -- (-1211.284) (-1210.768) [-1210.551] (-1211.287) * (-1211.599) [-1215.110] (-1212.020) (-1212.884) -- 0:00:55 139500 -- (-1215.322) (-1214.947) (-1211.872) [-1215.377] * (-1211.619) (-1215.456) (-1211.327) [-1211.209] -- 0:00:55 140000 -- (-1211.395) [-1211.355] (-1211.753) (-1215.555) * (-1212.039) (-1215.759) (-1213.189) [-1211.899] -- 0:00:55 Average standard deviation of split frequencies: 0.022929 140500 -- [-1213.588] (-1213.870) (-1211.712) (-1215.632) * [-1211.147] (-1211.631) (-1211.548) (-1213.920) -- 0:00:55 141000 -- (-1213.544) (-1212.182) (-1214.501) [-1213.971] * [-1211.513] (-1214.448) (-1211.699) (-1212.094) -- 0:00:54 141500 -- (-1217.649) [-1211.269] (-1211.814) (-1214.360) * (-1212.125) (-1212.335) [-1212.982] (-1212.126) -- 0:00:54 142000 -- (-1218.961) (-1211.272) (-1212.290) [-1213.399] * (-1214.087) (-1213.172) [-1211.031] (-1211.620) -- 0:00:54 142500 -- (-1213.080) (-1210.952) [-1214.995] (-1212.468) * [-1212.434] (-1211.510) (-1210.850) (-1212.600) -- 0:00:54 143000 -- (-1211.978) (-1213.666) [-1211.590] (-1213.095) * (-1213.193) (-1214.079) (-1212.550) [-1212.410] -- 0:00:53 143500 -- (-1213.825) [-1211.860] (-1214.186) (-1210.902) * (-1212.375) [-1217.798] (-1211.316) (-1213.729) -- 0:00:53 144000 -- [-1211.628] (-1214.031) (-1213.481) (-1213.873) * (-1214.224) (-1212.355) (-1214.853) [-1211.728] -- 0:00:53 144500 -- (-1213.591) (-1213.515) [-1211.616] (-1213.418) * [-1213.660] (-1217.405) (-1213.046) (-1212.313) -- 0:00:53 145000 -- (-1215.958) [-1213.350] (-1214.693) (-1212.301) * [-1212.899] (-1214.575) (-1212.964) (-1212.496) -- 0:00:53 Average standard deviation of split frequencies: 0.024377 145500 -- [-1212.680] (-1213.818) (-1210.579) (-1211.466) * (-1210.824) (-1217.700) (-1212.915) [-1212.681] -- 0:00:58 146000 -- (-1212.969) (-1214.073) (-1211.319) [-1211.274] * [-1211.013] (-1212.882) (-1214.968) (-1212.749) -- 0:00:58 146500 -- (-1212.130) (-1213.544) (-1212.667) [-1211.126] * [-1212.177] (-1211.557) (-1212.238) (-1217.047) -- 0:00:58 147000 -- (-1211.998) (-1211.446) [-1215.777] (-1214.168) * (-1211.249) (-1212.299) (-1211.366) [-1213.521] -- 0:00:58 147500 -- (-1211.349) (-1211.571) [-1213.852] (-1212.548) * [-1210.569] (-1214.293) (-1210.493) (-1212.919) -- 0:00:57 148000 -- (-1211.164) (-1212.414) [-1212.052] (-1213.760) * [-1210.621] (-1214.001) (-1210.494) (-1213.191) -- 0:00:57 148500 -- [-1211.191] (-1213.917) (-1212.704) (-1216.125) * (-1212.989) (-1211.630) (-1211.372) [-1212.076] -- 0:00:57 149000 -- [-1211.354] (-1212.177) (-1211.981) (-1213.677) * (-1212.799) (-1211.691) (-1211.626) [-1210.483] -- 0:00:57 149500 -- (-1213.399) (-1212.720) (-1213.961) [-1211.018] * (-1214.576) (-1211.609) [-1211.624] (-1213.017) -- 0:00:56 150000 -- (-1211.835) (-1212.509) (-1213.512) [-1211.697] * (-1217.868) [-1212.404] (-1211.616) (-1211.219) -- 0:00:56 Average standard deviation of split frequencies: 0.022944 150500 -- [-1211.405] (-1215.231) (-1213.235) (-1210.941) * (-1212.434) (-1212.878) [-1213.258] (-1214.225) -- 0:00:56 151000 -- (-1214.604) (-1212.260) (-1212.284) [-1211.718] * (-1211.118) [-1211.893] (-1213.656) (-1211.983) -- 0:00:56 151500 -- [-1212.389] (-1211.502) (-1214.901) (-1211.488) * (-1213.860) (-1212.488) [-1213.077] (-1217.402) -- 0:00:56 152000 -- (-1215.231) (-1211.731) [-1211.422] (-1212.267) * [-1215.323] (-1215.115) (-1211.808) (-1213.282) -- 0:00:55 152500 -- (-1211.917) (-1212.734) [-1212.608] (-1211.554) * (-1212.872) (-1213.302) (-1210.743) [-1213.868] -- 0:00:55 153000 -- (-1211.349) (-1214.992) [-1215.748] (-1210.443) * (-1212.841) (-1216.958) (-1210.989) [-1214.090] -- 0:00:55 153500 -- (-1211.770) (-1215.562) (-1213.405) [-1211.094] * (-1213.758) [-1210.492] (-1210.547) (-1212.524) -- 0:00:55 154000 -- (-1211.382) (-1212.933) [-1210.241] (-1210.849) * (-1213.281) (-1210.876) (-1213.670) [-1210.783] -- 0:00:54 154500 -- [-1211.881] (-1213.849) (-1212.830) (-1211.775) * (-1214.556) (-1214.155) [-1212.236] (-1210.946) -- 0:00:54 155000 -- (-1212.252) [-1213.158] (-1212.798) (-1211.685) * (-1212.127) [-1213.133] (-1213.492) (-1212.926) -- 0:00:54 Average standard deviation of split frequencies: 0.022815 155500 -- (-1212.746) [-1212.708] (-1214.249) (-1213.192) * (-1212.598) [-1213.426] (-1213.346) (-1211.342) -- 0:00:54 156000 -- (-1211.608) (-1212.446) (-1211.692) [-1211.142] * (-1211.494) (-1211.983) [-1212.856] (-1212.701) -- 0:00:54 156500 -- (-1213.612) (-1219.013) [-1212.682] (-1214.247) * (-1214.580) (-1213.965) [-1214.588] (-1213.142) -- 0:00:53 157000 -- (-1210.504) (-1212.455) [-1213.723] (-1215.559) * (-1211.111) (-1212.706) (-1214.023) [-1213.538] -- 0:00:53 157500 -- (-1217.368) [-1212.933] (-1218.265) (-1215.052) * [-1211.843] (-1212.779) (-1212.240) (-1212.500) -- 0:00:53 158000 -- (-1216.714) [-1211.955] (-1212.753) (-1213.076) * [-1212.955] (-1215.546) (-1213.782) (-1212.128) -- 0:00:53 158500 -- (-1212.928) [-1212.468] (-1214.665) (-1215.678) * [-1213.362] (-1211.984) (-1213.335) (-1211.821) -- 0:00:53 159000 -- (-1210.573) (-1213.718) [-1213.741] (-1211.940) * (-1216.845) (-1211.470) (-1211.157) [-1212.630] -- 0:00:52 159500 -- (-1212.902) [-1213.835] (-1218.054) (-1211.272) * (-1213.200) (-1210.828) (-1213.191) [-1210.527] -- 0:00:52 160000 -- [-1210.368] (-1217.118) (-1218.737) (-1213.679) * (-1214.095) (-1211.038) (-1210.507) [-1210.572] -- 0:00:52 Average standard deviation of split frequencies: 0.021056 160500 -- (-1217.714) [-1214.942] (-1214.131) (-1221.832) * (-1213.775) (-1212.186) (-1210.614) [-1214.353] -- 0:00:52 161000 -- (-1213.059) (-1214.838) (-1211.822) [-1217.717] * (-1211.966) (-1215.310) (-1215.272) [-1211.954] -- 0:00:52 161500 -- (-1215.976) [-1215.041] (-1212.540) (-1212.971) * (-1212.685) (-1211.451) (-1212.358) [-1215.800] -- 0:00:57 162000 -- (-1217.092) (-1214.473) (-1212.722) [-1213.093] * (-1213.228) [-1211.212] (-1211.604) (-1210.794) -- 0:00:56 162500 -- (-1219.866) (-1213.110) (-1213.796) [-1212.368] * (-1210.834) (-1211.212) [-1211.571] (-1211.877) -- 0:00:56 163000 -- (-1213.880) (-1212.340) (-1212.531) [-1213.998] * (-1211.613) [-1213.684] (-1215.094) (-1210.715) -- 0:00:56 163500 -- (-1214.822) (-1211.121) [-1212.528] (-1211.871) * (-1212.723) (-1213.852) (-1211.511) [-1212.740] -- 0:00:56 164000 -- (-1211.128) [-1211.045] (-1210.557) (-1211.826) * (-1214.726) (-1211.238) [-1211.248] (-1212.422) -- 0:00:56 164500 -- [-1211.391] (-1210.403) (-1210.904) (-1212.966) * (-1213.316) [-1218.518] (-1211.076) (-1212.328) -- 0:00:55 165000 -- (-1213.879) (-1219.958) (-1211.999) [-1211.751] * (-1212.529) (-1214.651) (-1212.564) [-1211.618] -- 0:00:55 Average standard deviation of split frequencies: 0.020925 165500 -- (-1212.456) (-1212.399) (-1212.448) [-1212.456] * (-1211.925) [-1212.261] (-1212.092) (-1211.702) -- 0:00:55 166000 -- [-1213.736] (-1212.097) (-1211.885) (-1212.742) * (-1212.882) (-1212.187) [-1213.017] (-1216.637) -- 0:00:55 166500 -- (-1218.920) (-1211.963) (-1210.952) [-1212.150] * (-1212.715) [-1212.670] (-1214.790) (-1213.099) -- 0:00:55 167000 -- (-1214.743) [-1211.497] (-1213.051) (-1214.299) * (-1213.093) (-1212.014) [-1213.812] (-1214.167) -- 0:00:54 167500 -- (-1213.155) (-1212.037) (-1212.664) [-1212.174] * [-1213.490] (-1220.619) (-1213.787) (-1211.293) -- 0:00:54 168000 -- (-1212.300) (-1211.933) [-1210.881] (-1211.966) * [-1211.026] (-1214.479) (-1212.089) (-1213.256) -- 0:00:54 168500 -- (-1213.348) [-1213.742] (-1212.588) (-1211.491) * (-1212.356) (-1214.648) [-1213.085] (-1213.450) -- 0:00:54 169000 -- (-1213.935) (-1211.571) [-1211.234] (-1213.724) * [-1212.008] (-1211.510) (-1214.713) (-1212.337) -- 0:00:54 169500 -- (-1212.325) (-1215.052) [-1212.747] (-1212.650) * (-1215.857) (-1216.698) (-1214.584) [-1212.831] -- 0:00:53 170000 -- (-1213.612) (-1221.064) (-1210.851) [-1210.869] * (-1212.581) (-1212.271) [-1210.185] (-1212.445) -- 0:00:53 Average standard deviation of split frequencies: 0.021637 170500 -- (-1214.638) [-1214.610] (-1212.267) (-1211.919) * (-1213.681) [-1215.205] (-1214.807) (-1211.659) -- 0:00:53 171000 -- (-1212.097) (-1215.810) (-1215.289) [-1212.573] * (-1213.237) [-1213.996] (-1213.904) (-1211.234) -- 0:00:53 171500 -- (-1212.887) (-1213.201) (-1219.733) [-1210.470] * [-1214.052] (-1211.702) (-1218.807) (-1212.563) -- 0:00:53 172000 -- (-1215.245) [-1213.084] (-1216.271) (-1211.088) * (-1215.764) (-1211.603) [-1214.074] (-1211.845) -- 0:00:52 172500 -- [-1211.622] (-1211.704) (-1212.720) (-1213.228) * (-1214.992) (-1211.902) (-1214.543) [-1212.957] -- 0:00:52 173000 -- (-1213.937) (-1211.563) (-1212.767) [-1212.216] * (-1213.904) [-1212.785] (-1212.605) (-1212.269) -- 0:00:52 173500 -- [-1210.733] (-1214.756) (-1213.805) (-1212.941) * [-1214.693] (-1211.603) (-1214.644) (-1212.568) -- 0:00:52 174000 -- (-1214.418) (-1215.761) (-1212.201) [-1211.156] * (-1213.905) (-1211.616) [-1213.592] (-1212.560) -- 0:00:52 174500 -- (-1214.297) (-1210.843) (-1216.123) [-1214.230] * (-1212.730) (-1214.815) [-1215.388] (-1214.099) -- 0:00:52 175000 -- [-1212.166] (-1210.867) (-1214.893) (-1216.118) * (-1214.673) [-1212.910] (-1210.807) (-1216.293) -- 0:00:51 Average standard deviation of split frequencies: 0.020237 175500 -- [-1211.194] (-1212.924) (-1212.397) (-1213.186) * (-1219.785) (-1211.683) (-1213.887) [-1211.420] -- 0:00:51 176000 -- (-1210.586) (-1213.918) (-1216.101) [-1213.201] * (-1216.883) (-1211.487) (-1210.546) [-1211.825] -- 0:00:51 176500 -- (-1212.191) [-1213.460] (-1216.448) (-1218.608) * (-1213.123) (-1212.337) [-1214.585] (-1215.973) -- 0:00:51 177000 -- (-1212.058) [-1212.439] (-1213.075) (-1216.081) * (-1211.527) (-1211.460) (-1211.682) [-1213.103] -- 0:00:51 177500 -- (-1212.226) [-1210.930] (-1212.322) (-1216.143) * (-1212.469) [-1212.756] (-1211.515) (-1214.469) -- 0:00:55 178000 -- (-1211.719) (-1214.535) [-1211.553] (-1211.535) * (-1211.771) (-1211.517) (-1214.467) [-1213.258] -- 0:00:55 178500 -- (-1212.190) (-1210.636) [-1212.105] (-1212.468) * (-1210.627) [-1211.463] (-1218.833) (-1215.272) -- 0:00:55 179000 -- (-1214.134) [-1211.575] (-1212.075) (-1211.077) * [-1211.197] (-1211.962) (-1212.691) (-1213.083) -- 0:00:55 179500 -- [-1214.887] (-1214.577) (-1211.133) (-1211.193) * (-1215.280) [-1211.515] (-1213.053) (-1211.780) -- 0:00:54 180000 -- (-1212.396) (-1214.559) (-1211.910) [-1211.407] * (-1211.431) [-1211.810] (-1210.332) (-1215.897) -- 0:00:54 Average standard deviation of split frequencies: 0.020294 180500 -- (-1212.907) (-1217.668) [-1211.049] (-1212.486) * (-1210.674) [-1213.210] (-1215.839) (-1211.974) -- 0:00:54 181000 -- (-1211.157) (-1213.950) (-1211.182) [-1212.969] * (-1211.437) (-1212.075) [-1213.627] (-1217.269) -- 0:00:54 181500 -- (-1211.017) (-1211.694) [-1210.873] (-1215.366) * (-1211.299) [-1210.709] (-1213.627) (-1211.490) -- 0:00:54 182000 -- (-1211.288) [-1213.274] (-1210.875) (-1212.699) * (-1211.367) (-1211.225) (-1214.727) [-1210.561] -- 0:00:53 182500 -- (-1211.721) (-1212.281) [-1211.709] (-1214.011) * (-1211.906) (-1214.078) (-1210.735) [-1210.648] -- 0:00:53 183000 -- (-1213.091) (-1214.514) [-1211.794] (-1215.552) * (-1212.177) (-1213.509) [-1210.244] (-1212.037) -- 0:00:53 183500 -- (-1213.561) (-1212.842) [-1210.937] (-1213.219) * (-1215.908) [-1214.659] (-1211.326) (-1210.438) -- 0:00:53 184000 -- (-1212.319) [-1217.832] (-1210.562) (-1211.734) * (-1215.914) [-1210.746] (-1212.428) (-1212.708) -- 0:00:53 184500 -- (-1211.199) (-1211.821) (-1211.464) [-1211.493] * [-1214.326] (-1211.675) (-1211.297) (-1211.971) -- 0:00:53 185000 -- (-1210.606) [-1211.564] (-1211.386) (-1214.190) * (-1213.277) (-1211.648) (-1211.428) [-1212.785] -- 0:00:52 Average standard deviation of split frequencies: 0.018445 185500 -- (-1211.922) (-1213.218) (-1211.389) [-1211.272] * [-1213.141] (-1214.650) (-1214.641) (-1213.385) -- 0:00:52 186000 -- (-1212.379) [-1211.754] (-1212.497) (-1214.485) * (-1212.366) (-1216.750) (-1210.874) [-1212.639] -- 0:00:52 186500 -- (-1212.233) (-1211.422) (-1216.291) [-1213.418] * [-1210.475] (-1216.048) (-1211.275) (-1214.070) -- 0:00:52 187000 -- (-1211.913) (-1211.022) [-1213.136] (-1215.274) * (-1211.673) (-1214.402) (-1212.871) [-1214.457] -- 0:00:52 187500 -- (-1211.611) [-1211.725] (-1212.891) (-1215.636) * (-1212.989) [-1214.371] (-1211.103) (-1216.058) -- 0:00:52 188000 -- (-1218.051) [-1210.896] (-1213.127) (-1213.178) * [-1216.258] (-1210.471) (-1211.351) (-1216.295) -- 0:00:51 188500 -- (-1215.948) (-1210.648) (-1212.837) [-1210.918] * (-1213.247) [-1211.380] (-1211.150) (-1217.089) -- 0:00:51 189000 -- (-1212.858) [-1212.186] (-1211.887) (-1211.031) * (-1216.012) [-1212.502] (-1214.790) (-1211.670) -- 0:00:51 189500 -- (-1211.826) (-1212.948) (-1213.077) [-1211.993] * [-1214.308] (-1214.740) (-1213.269) (-1211.451) -- 0:00:51 190000 -- (-1211.640) (-1210.901) (-1214.464) [-1211.853] * (-1213.765) (-1212.337) (-1214.987) [-1213.133] -- 0:00:51 Average standard deviation of split frequencies: 0.017994 190500 -- (-1211.893) (-1211.903) [-1212.519] (-1210.258) * (-1213.618) [-1214.644] (-1212.471) (-1211.916) -- 0:00:50 191000 -- (-1215.010) [-1210.918] (-1212.815) (-1211.988) * (-1211.137) (-1221.570) [-1213.165] (-1211.127) -- 0:00:50 191500 -- [-1212.297] (-1214.246) (-1211.059) (-1211.049) * (-1213.018) [-1214.231] (-1211.188) (-1212.946) -- 0:00:50 192000 -- (-1212.539) (-1211.782) [-1211.358] (-1210.871) * (-1222.392) (-1210.947) [-1210.827] (-1213.971) -- 0:00:50 192500 -- [-1212.518] (-1211.919) (-1211.122) (-1212.968) * (-1212.903) (-1214.733) [-1211.041] (-1212.235) -- 0:00:50 193000 -- [-1213.114] (-1211.032) (-1210.471) (-1212.291) * (-1212.344) (-1211.450) [-1213.059] (-1212.035) -- 0:00:50 193500 -- (-1212.571) (-1211.235) (-1211.360) [-1210.409] * [-1212.010] (-1211.394) (-1211.967) (-1210.414) -- 0:00:54 194000 -- (-1213.610) [-1211.149] (-1211.730) (-1210.378) * (-1210.457) (-1211.614) [-1212.548] (-1211.215) -- 0:00:54 194500 -- (-1215.190) (-1210.841) (-1211.198) [-1214.290] * (-1212.394) [-1212.870] (-1215.770) (-1210.619) -- 0:00:53 195000 -- (-1214.185) (-1210.953) (-1213.787) [-1212.018] * (-1217.970) (-1212.132) (-1212.268) [-1210.679] -- 0:00:53 Average standard deviation of split frequencies: 0.018172 195500 -- (-1213.046) (-1211.227) (-1211.346) [-1212.020] * (-1215.914) (-1211.997) (-1215.306) [-1211.644] -- 0:00:53 196000 -- (-1211.204) (-1210.989) (-1211.212) [-1210.661] * (-1213.814) (-1210.637) (-1213.392) [-1211.621] -- 0:00:53 196500 -- (-1211.760) [-1211.444] (-1212.375) (-1212.202) * (-1214.905) [-1211.284] (-1213.676) (-1213.236) -- 0:00:53 197000 -- (-1212.125) [-1211.896] (-1212.500) (-1211.143) * (-1215.022) (-1211.393) (-1211.110) [-1214.620] -- 0:00:52 197500 -- [-1213.085] (-1214.794) (-1212.799) (-1212.035) * [-1211.541] (-1212.670) (-1216.775) (-1214.809) -- 0:00:52 198000 -- [-1211.967] (-1214.440) (-1215.540) (-1210.605) * (-1214.926) (-1212.179) [-1211.386] (-1212.819) -- 0:00:52 198500 -- [-1210.678] (-1212.799) (-1215.429) (-1210.605) * (-1212.659) (-1212.644) (-1211.953) [-1214.367] -- 0:00:52 199000 -- [-1210.683] (-1213.848) (-1217.271) (-1210.621) * [-1211.158] (-1211.481) (-1211.914) (-1213.731) -- 0:00:52 199500 -- (-1211.884) (-1212.308) (-1211.546) [-1213.046] * [-1211.605] (-1211.900) (-1212.257) (-1213.260) -- 0:00:52 200000 -- [-1211.246] (-1211.064) (-1211.797) (-1210.338) * (-1211.432) (-1214.229) [-1211.807] (-1213.222) -- 0:00:51 Average standard deviation of split frequencies: 0.018103 200500 -- (-1212.516) (-1210.992) (-1212.582) [-1213.388] * (-1214.675) (-1214.497) (-1213.324) [-1215.695] -- 0:00:51 201000 -- (-1213.746) (-1212.431) (-1213.304) [-1213.291] * (-1214.687) [-1213.550] (-1215.366) (-1213.051) -- 0:00:51 201500 -- (-1213.242) (-1212.528) [-1212.128] (-1211.339) * (-1214.515) (-1212.577) (-1212.238) [-1210.355] -- 0:00:51 202000 -- (-1215.877) (-1210.376) (-1211.524) [-1211.353] * (-1213.182) (-1211.381) (-1212.860) [-1212.815] -- 0:00:51 202500 -- (-1218.760) (-1212.122) (-1212.515) [-1212.475] * [-1212.229] (-1210.863) (-1210.756) (-1212.437) -- 0:00:51 203000 -- [-1212.755] (-1212.204) (-1211.044) (-1213.047) * (-1215.538) (-1212.699) (-1211.048) [-1212.673] -- 0:00:51 203500 -- (-1212.170) [-1210.803] (-1211.916) (-1211.754) * (-1213.087) [-1210.626] (-1211.831) (-1214.099) -- 0:00:50 204000 -- (-1212.655) (-1212.481) (-1210.874) [-1210.945] * [-1212.950] (-1211.890) (-1211.997) (-1213.083) -- 0:00:50 204500 -- (-1214.538) (-1214.400) [-1210.874] (-1211.318) * (-1212.100) [-1211.457] (-1211.359) (-1213.298) -- 0:00:50 205000 -- (-1210.937) (-1211.954) (-1210.797) [-1210.877] * (-1212.641) (-1211.270) [-1213.098] (-1215.039) -- 0:00:50 Average standard deviation of split frequencies: 0.018187 205500 -- (-1211.301) (-1210.881) (-1211.144) [-1210.597] * [-1213.022] (-1211.980) (-1213.416) (-1214.893) -- 0:00:50 206000 -- (-1215.063) (-1211.793) [-1210.941] (-1211.118) * [-1212.065] (-1212.217) (-1214.098) (-1219.066) -- 0:00:50 206500 -- (-1210.841) [-1212.165] (-1211.700) (-1211.767) * [-1212.665] (-1219.605) (-1210.401) (-1216.301) -- 0:00:49 207000 -- [-1211.864] (-1211.893) (-1214.998) (-1211.645) * (-1210.834) (-1219.195) [-1211.666] (-1214.126) -- 0:00:49 207500 -- (-1212.167) (-1213.874) [-1213.182] (-1211.732) * [-1211.959] (-1212.719) (-1212.538) (-1215.600) -- 0:00:49 208000 -- (-1213.713) [-1213.604] (-1213.107) (-1210.861) * [-1211.368] (-1212.398) (-1214.403) (-1215.877) -- 0:00:49 208500 -- (-1214.724) (-1213.807) [-1213.365] (-1211.798) * (-1211.218) [-1211.825] (-1215.999) (-1216.368) -- 0:00:49 209000 -- (-1213.359) (-1214.448) [-1212.146] (-1210.472) * (-1213.110) (-1211.156) (-1213.006) [-1216.923] -- 0:00:49 209500 -- (-1213.084) (-1217.223) [-1213.326] (-1211.353) * [-1213.663] (-1210.644) (-1212.226) (-1219.092) -- 0:00:49 210000 -- (-1210.825) [-1215.964] (-1212.661) (-1211.081) * (-1212.402) [-1211.644] (-1213.743) (-1215.114) -- 0:00:52 Average standard deviation of split frequencies: 0.018961 210500 -- (-1211.554) (-1214.621) (-1220.547) [-1213.268] * [-1214.064] (-1212.746) (-1214.830) (-1214.495) -- 0:00:52 211000 -- (-1211.865) (-1216.250) (-1212.252) [-1212.953] * (-1210.974) [-1212.078] (-1212.148) (-1216.464) -- 0:00:52 211500 -- (-1210.493) (-1212.599) [-1212.539] (-1213.955) * (-1212.546) [-1211.125] (-1212.067) (-1216.415) -- 0:00:52 212000 -- (-1211.845) [-1212.185] (-1214.311) (-1214.577) * (-1212.239) (-1216.040) [-1212.121] (-1212.792) -- 0:00:52 212500 -- (-1210.648) (-1211.141) [-1213.250] (-1213.060) * (-1215.643) (-1211.282) (-1214.254) [-1212.764] -- 0:00:51 213000 -- (-1213.760) (-1212.836) [-1213.487] (-1213.010) * [-1215.138] (-1211.289) (-1216.530) (-1215.889) -- 0:00:51 213500 -- (-1214.029) [-1214.110] (-1213.308) (-1213.705) * (-1210.411) [-1215.170] (-1213.279) (-1211.888) -- 0:00:51 214000 -- (-1211.634) [-1211.122] (-1210.527) (-1212.163) * (-1210.594) (-1218.736) (-1212.984) [-1212.406] -- 0:00:51 214500 -- [-1212.275] (-1211.998) (-1210.434) (-1215.323) * (-1211.840) (-1214.547) [-1213.403] (-1212.587) -- 0:00:51 215000 -- (-1214.747) (-1211.484) (-1212.798) [-1215.350] * [-1213.311] (-1212.373) (-1213.067) (-1212.630) -- 0:00:51 Average standard deviation of split frequencies: 0.018187 215500 -- (-1211.963) (-1214.404) [-1210.824] (-1213.415) * [-1212.579] (-1213.332) (-1212.310) (-1214.091) -- 0:00:50 216000 -- (-1211.939) (-1214.287) (-1219.008) [-1212.800] * [-1212.004] (-1214.285) (-1213.970) (-1217.091) -- 0:00:50 216500 -- (-1211.908) [-1211.818] (-1214.580) (-1214.857) * [-1211.744] (-1211.845) (-1215.454) (-1211.623) -- 0:00:50 217000 -- [-1212.972] (-1212.019) (-1217.265) (-1212.157) * (-1213.967) [-1213.468] (-1211.756) (-1211.315) -- 0:00:50 217500 -- [-1212.462] (-1211.122) (-1212.541) (-1211.646) * (-1214.394) (-1210.660) [-1211.957] (-1212.107) -- 0:00:50 218000 -- (-1213.158) [-1215.829] (-1212.140) (-1210.839) * (-1217.596) (-1213.803) [-1211.319] (-1210.756) -- 0:00:50 218500 -- (-1210.369) [-1211.405] (-1213.328) (-1211.897) * (-1212.010) (-1214.317) (-1211.027) [-1214.389] -- 0:00:50 219000 -- (-1210.659) (-1215.693) [-1212.696] (-1211.543) * (-1212.436) (-1210.748) [-1212.466] (-1215.215) -- 0:00:49 219500 -- (-1212.046) [-1214.500] (-1212.744) (-1211.415) * (-1211.557) (-1211.170) (-1215.988) [-1211.404] -- 0:00:49 220000 -- (-1210.979) (-1215.203) (-1215.403) [-1211.916] * (-1211.212) (-1211.701) [-1211.936] (-1210.542) -- 0:00:49 Average standard deviation of split frequencies: 0.018633 220500 -- [-1210.951] (-1213.306) (-1213.372) (-1211.230) * (-1210.808) (-1210.809) (-1210.935) [-1212.832] -- 0:00:49 221000 -- (-1218.597) (-1213.609) [-1213.002] (-1213.407) * [-1211.206] (-1213.545) (-1210.923) (-1213.528) -- 0:00:49 221500 -- (-1212.606) [-1217.287] (-1212.776) (-1212.000) * (-1213.787) [-1213.909] (-1213.450) (-1212.789) -- 0:00:49 222000 -- (-1213.978) (-1215.625) [-1213.584] (-1212.142) * (-1210.798) [-1212.276] (-1210.968) (-1213.509) -- 0:00:49 222500 -- [-1216.538] (-1212.547) (-1212.424) (-1210.961) * (-1212.066) [-1211.731] (-1211.868) (-1213.385) -- 0:00:48 223000 -- (-1212.488) (-1213.889) (-1211.737) [-1212.357] * [-1214.776] (-1212.714) (-1211.761) (-1211.504) -- 0:00:48 223500 -- (-1211.189) [-1212.255] (-1213.187) (-1211.238) * [-1212.728] (-1211.771) (-1211.761) (-1212.468) -- 0:00:48 224000 -- (-1210.837) (-1216.726) [-1211.641] (-1211.867) * (-1212.092) (-1211.667) (-1210.868) [-1215.677] -- 0:00:48 224500 -- (-1210.721) [-1211.818] (-1213.826) (-1212.025) * [-1213.214] (-1212.135) (-1211.470) (-1211.856) -- 0:00:48 225000 -- (-1210.670) (-1214.372) [-1214.803] (-1214.117) * (-1212.632) (-1211.461) (-1210.872) [-1211.399] -- 0:00:48 Average standard deviation of split frequencies: 0.018773 225500 -- [-1211.266] (-1210.766) (-1212.528) (-1211.975) * (-1213.232) [-1212.764] (-1210.865) (-1210.728) -- 0:00:48 226000 -- (-1212.017) (-1212.175) (-1212.204) [-1211.801] * (-1212.240) [-1211.981] (-1214.686) (-1211.202) -- 0:00:51 226500 -- (-1210.616) (-1211.750) (-1212.793) [-1212.229] * (-1213.177) [-1217.994] (-1212.748) (-1211.443) -- 0:00:51 227000 -- [-1210.625] (-1214.973) (-1213.587) (-1212.158) * (-1213.356) [-1217.665] (-1211.744) (-1214.982) -- 0:00:51 227500 -- [-1210.647] (-1215.818) (-1218.327) (-1211.482) * [-1213.499] (-1212.448) (-1213.126) (-1213.822) -- 0:00:50 228000 -- (-1210.759) (-1213.704) [-1211.618] (-1210.963) * (-1211.516) [-1212.635] (-1211.380) (-1214.743) -- 0:00:50 228500 -- (-1214.774) [-1213.349] (-1212.480) (-1211.199) * (-1213.269) (-1211.047) [-1211.143] (-1212.981) -- 0:00:50 229000 -- (-1213.050) [-1211.311] (-1211.379) (-1213.737) * (-1213.634) [-1212.753] (-1213.934) (-1212.281) -- 0:00:50 229500 -- (-1211.998) [-1211.231] (-1212.891) (-1212.676) * (-1213.599) (-1212.557) [-1212.131] (-1216.856) -- 0:00:50 230000 -- [-1211.909] (-1211.434) (-1211.794) (-1212.529) * (-1215.455) (-1211.547) [-1212.530] (-1214.549) -- 0:00:50 Average standard deviation of split frequencies: 0.019528 230500 -- (-1212.697) [-1211.928] (-1213.646) (-1213.544) * (-1215.476) [-1211.728] (-1212.881) (-1212.539) -- 0:00:50 231000 -- [-1212.139] (-1211.514) (-1217.887) (-1210.787) * [-1215.684] (-1212.232) (-1214.045) (-1217.553) -- 0:00:49 231500 -- (-1215.341) (-1212.281) (-1214.119) [-1211.898] * (-1214.544) (-1212.207) [-1218.943] (-1217.230) -- 0:00:49 232000 -- (-1213.916) (-1210.374) (-1210.566) [-1213.507] * (-1212.541) (-1211.624) [-1212.188] (-1212.468) -- 0:00:49 232500 -- (-1213.552) (-1211.282) (-1213.601) [-1211.223] * [-1212.561] (-1211.909) (-1212.953) (-1211.363) -- 0:00:49 233000 -- (-1213.774) (-1212.673) [-1210.364] (-1212.929) * (-1210.511) (-1212.047) [-1212.464] (-1215.494) -- 0:00:49 233500 -- (-1210.383) (-1211.287) (-1218.203) [-1215.412] * (-1212.056) [-1211.486] (-1211.009) (-1212.915) -- 0:00:49 234000 -- (-1211.345) (-1211.223) [-1211.820] (-1216.465) * (-1212.005) [-1212.144] (-1210.861) (-1215.715) -- 0:00:49 234500 -- (-1211.215) (-1212.135) (-1210.693) [-1212.723] * (-1211.789) (-1213.186) (-1211.557) [-1214.527] -- 0:00:48 235000 -- (-1212.446) (-1218.926) [-1210.764] (-1211.019) * [-1210.690] (-1216.253) (-1210.939) (-1215.833) -- 0:00:48 Average standard deviation of split frequencies: 0.020308 235500 -- (-1213.731) (-1213.881) [-1210.845] (-1213.652) * (-1216.428) (-1213.694) [-1211.932] (-1214.735) -- 0:00:48 236000 -- (-1212.071) [-1211.944] (-1212.530) (-1211.610) * (-1214.415) [-1212.212] (-1213.821) (-1211.469) -- 0:00:48 236500 -- (-1217.041) (-1211.579) (-1212.493) [-1210.463] * (-1212.689) (-1213.908) (-1214.472) [-1211.080] -- 0:00:48 237000 -- (-1214.513) (-1212.757) [-1211.191] (-1213.208) * (-1212.534) (-1211.591) (-1214.402) [-1212.368] -- 0:00:48 237500 -- (-1211.994) [-1212.130] (-1211.997) (-1216.312) * [-1212.872] (-1214.605) (-1211.763) (-1214.018) -- 0:00:48 238000 -- [-1211.534] (-1218.794) (-1210.539) (-1216.305) * (-1211.837) (-1212.994) (-1213.857) [-1212.499] -- 0:00:48 238500 -- (-1211.444) (-1215.597) [-1211.746] (-1213.904) * (-1215.159) [-1211.682] (-1215.545) (-1215.073) -- 0:00:47 239000 -- (-1213.173) (-1211.442) (-1212.691) [-1212.093] * (-1213.779) [-1212.652] (-1212.728) (-1216.390) -- 0:00:47 239500 -- (-1213.451) [-1211.729] (-1212.004) (-1211.684) * (-1216.256) (-1212.556) (-1213.212) [-1210.907] -- 0:00:47 240000 -- [-1212.437] (-1214.556) (-1211.927) (-1216.996) * [-1212.799] (-1211.053) (-1214.636) (-1211.229) -- 0:00:47 Average standard deviation of split frequencies: 0.022199 240500 -- (-1213.554) [-1212.994] (-1212.978) (-1216.810) * (-1214.628) [-1211.415] (-1215.107) (-1210.830) -- 0:00:47 241000 -- (-1221.080) (-1214.078) [-1214.837] (-1211.891) * (-1218.210) (-1211.268) (-1212.567) [-1212.018] -- 0:00:47 241500 -- (-1213.505) (-1217.548) [-1211.279] (-1211.910) * (-1217.156) [-1211.240] (-1216.980) (-1210.832) -- 0:00:50 242000 -- [-1213.548] (-1212.416) (-1212.001) (-1215.135) * [-1211.933] (-1212.615) (-1213.659) (-1210.920) -- 0:00:50 242500 -- (-1214.070) (-1213.019) (-1211.336) [-1212.572] * [-1211.897] (-1211.992) (-1215.615) (-1211.264) -- 0:00:49 243000 -- (-1216.244) (-1211.687) [-1211.103] (-1214.594) * (-1212.112) (-1211.949) (-1214.772) [-1212.534] -- 0:00:49 243500 -- (-1211.613) [-1211.420] (-1210.711) (-1214.246) * (-1211.726) [-1211.814] (-1214.779) (-1211.414) -- 0:00:49 244000 -- (-1211.985) [-1211.283] (-1214.254) (-1219.773) * (-1212.742) [-1211.323] (-1211.452) (-1214.079) -- 0:00:49 244500 -- (-1215.675) [-1211.461] (-1213.270) (-1213.706) * (-1213.050) [-1212.382] (-1211.787) (-1213.170) -- 0:00:49 245000 -- (-1212.419) (-1212.387) (-1213.016) [-1212.599] * (-1211.781) [-1212.202] (-1212.021) (-1214.791) -- 0:00:49 Average standard deviation of split frequencies: 0.020973 245500 -- (-1213.812) [-1210.763] (-1212.790) (-1213.364) * (-1212.930) [-1214.339] (-1211.823) (-1212.898) -- 0:00:49 246000 -- [-1213.485] (-1216.537) (-1213.368) (-1214.365) * (-1214.149) [-1214.192] (-1212.642) (-1212.865) -- 0:00:49 246500 -- (-1212.636) [-1212.806] (-1211.676) (-1212.781) * (-1213.815) [-1212.332] (-1210.516) (-1212.658) -- 0:00:48 247000 -- (-1214.134) (-1216.277) (-1210.568) [-1213.220] * (-1212.689) (-1213.011) (-1211.598) [-1212.415] -- 0:00:48 247500 -- (-1211.826) (-1213.906) (-1211.551) [-1213.311] * (-1213.312) [-1210.622] (-1212.561) (-1212.540) -- 0:00:48 248000 -- (-1211.091) (-1211.839) (-1211.290) [-1214.066] * (-1211.308) [-1212.176] (-1216.439) (-1212.653) -- 0:00:48 248500 -- (-1212.851) (-1215.324) [-1212.036] (-1211.854) * (-1212.213) (-1212.518) [-1210.937] (-1212.003) -- 0:00:48 249000 -- [-1211.745] (-1217.726) (-1211.929) (-1215.577) * (-1213.676) (-1213.803) [-1212.801] (-1211.480) -- 0:00:48 249500 -- (-1213.275) (-1214.158) (-1211.523) [-1214.604] * [-1211.097] (-1212.439) (-1211.788) (-1212.456) -- 0:00:48 250000 -- (-1216.828) (-1211.389) (-1212.596) [-1212.110] * (-1210.756) (-1213.186) (-1211.545) [-1210.757] -- 0:00:48 Average standard deviation of split frequencies: 0.020164 250500 -- (-1213.540) [-1211.456] (-1211.980) (-1213.844) * (-1211.228) (-1213.951) (-1212.204) [-1211.090] -- 0:00:47 251000 -- (-1210.918) [-1210.704] (-1213.421) (-1217.735) * (-1212.171) (-1210.972) (-1214.719) [-1211.185] -- 0:00:47 251500 -- (-1212.043) [-1211.515] (-1213.192) (-1213.743) * [-1213.429] (-1211.254) (-1214.303) (-1212.511) -- 0:00:47 252000 -- (-1212.733) (-1211.555) (-1213.191) [-1215.635] * (-1217.133) [-1212.324] (-1213.780) (-1212.632) -- 0:00:47 252500 -- (-1213.940) (-1211.454) [-1213.307] (-1214.708) * (-1212.514) [-1212.164] (-1211.273) (-1210.643) -- 0:00:47 253000 -- (-1211.329) [-1211.942] (-1214.229) (-1212.379) * (-1211.176) [-1212.567] (-1212.181) (-1211.787) -- 0:00:47 253500 -- (-1212.612) (-1212.411) (-1215.098) [-1212.481] * (-1212.071) [-1212.950] (-1211.676) (-1213.625) -- 0:00:47 254000 -- (-1210.584) [-1211.352] (-1215.172) (-1216.392) * (-1214.469) [-1216.547] (-1211.418) (-1212.960) -- 0:00:46 254500 -- [-1210.585] (-1217.596) (-1212.307) (-1212.242) * [-1213.790] (-1214.976) (-1212.392) (-1214.595) -- 0:00:46 255000 -- (-1215.511) (-1212.647) [-1212.337] (-1214.330) * (-1213.788) (-1211.032) [-1212.392] (-1213.113) -- 0:00:46 Average standard deviation of split frequencies: 0.019642 255500 -- [-1212.576] (-1211.982) (-1215.683) (-1214.002) * (-1211.089) (-1210.820) (-1210.601) [-1215.293] -- 0:00:46 256000 -- [-1215.652] (-1213.376) (-1212.977) (-1215.235) * [-1212.508] (-1212.646) (-1210.543) (-1212.688) -- 0:00:46 256500 -- (-1210.993) (-1211.916) [-1212.750] (-1215.545) * (-1212.469) [-1214.870] (-1212.487) (-1214.008) -- 0:00:46 257000 -- (-1210.859) (-1212.681) (-1214.531) [-1212.772] * (-1210.766) [-1220.428] (-1211.388) (-1212.643) -- 0:00:46 257500 -- (-1213.998) [-1212.003] (-1218.772) (-1214.305) * (-1210.768) (-1216.988) (-1211.159) [-1211.607] -- 0:00:49 258000 -- (-1214.025) [-1213.080] (-1215.722) (-1214.068) * (-1210.420) (-1212.279) [-1212.209] (-1213.667) -- 0:00:48 258500 -- (-1212.851) (-1212.251) [-1214.411] (-1216.649) * [-1210.759] (-1212.872) (-1212.345) (-1212.557) -- 0:00:48 259000 -- (-1211.286) (-1212.501) (-1212.164) [-1213.378] * [-1212.747] (-1210.683) (-1212.287) (-1212.713) -- 0:00:48 259500 -- (-1215.158) [-1211.547] (-1212.486) (-1211.430) * [-1210.783] (-1210.617) (-1213.265) (-1212.041) -- 0:00:48 260000 -- (-1212.637) (-1212.305) (-1214.632) [-1211.039] * (-1212.558) (-1212.927) [-1211.258] (-1213.339) -- 0:00:48 Average standard deviation of split frequencies: 0.020194 260500 -- (-1212.461) (-1211.767) [-1213.515] (-1212.159) * (-1213.662) [-1212.418] (-1211.766) (-1217.983) -- 0:00:48 261000 -- [-1212.417] (-1211.446) (-1211.560) (-1210.819) * [-1212.302] (-1214.288) (-1212.947) (-1212.677) -- 0:00:48 261500 -- (-1211.468) (-1213.589) (-1213.663) [-1213.534] * (-1210.868) (-1215.432) [-1211.958] (-1213.412) -- 0:00:48 262000 -- (-1213.461) (-1214.602) (-1211.385) [-1212.837] * (-1213.213) (-1222.083) [-1211.736] (-1215.972) -- 0:00:47 262500 -- [-1216.557] (-1212.627) (-1214.071) (-1213.638) * [-1210.634] (-1215.217) (-1211.136) (-1212.697) -- 0:00:47 263000 -- [-1210.957] (-1213.496) (-1213.124) (-1215.559) * [-1210.599] (-1214.626) (-1211.822) (-1211.863) -- 0:00:47 263500 -- (-1213.511) (-1210.758) [-1212.011] (-1216.544) * (-1210.547) (-1213.999) [-1211.333] (-1212.846) -- 0:00:47 264000 -- (-1213.101) [-1211.290] (-1213.091) (-1217.005) * (-1213.239) [-1213.187] (-1211.239) (-1212.234) -- 0:00:47 264500 -- (-1215.539) [-1212.499] (-1216.933) (-1212.255) * [-1211.671] (-1216.362) (-1215.768) (-1212.013) -- 0:00:47 265000 -- (-1216.477) (-1212.266) [-1213.240] (-1212.693) * (-1213.338) (-1213.525) (-1211.589) [-1212.912] -- 0:00:47 Average standard deviation of split frequencies: 0.019297 265500 -- [-1212.669] (-1212.950) (-1211.103) (-1213.997) * (-1211.462) (-1213.281) [-1214.107] (-1213.831) -- 0:00:47 266000 -- (-1214.860) (-1216.020) [-1213.934] (-1213.302) * (-1212.735) [-1212.462] (-1214.111) (-1213.420) -- 0:00:46 266500 -- (-1211.852) (-1213.734) [-1211.265] (-1212.590) * (-1211.976) (-1211.989) [-1212.529] (-1210.398) -- 0:00:46 267000 -- (-1214.561) (-1215.803) (-1211.861) [-1212.846] * (-1211.481) [-1210.828] (-1213.306) (-1210.829) -- 0:00:46 267500 -- (-1214.162) (-1218.413) [-1210.606] (-1213.789) * [-1210.905] (-1210.829) (-1213.348) (-1212.589) -- 0:00:46 268000 -- (-1212.601) (-1215.278) (-1211.049) [-1211.562] * (-1210.759) [-1212.374] (-1213.266) (-1215.683) -- 0:00:46 268500 -- (-1212.992) (-1210.750) (-1211.049) [-1215.670] * (-1210.749) (-1211.775) [-1214.610] (-1211.160) -- 0:00:46 269000 -- (-1211.593) (-1210.794) [-1211.446] (-1211.919) * (-1213.043) (-1216.325) (-1213.338) [-1212.114] -- 0:00:46 269500 -- (-1211.919) [-1211.058] (-1211.073) (-1210.451) * (-1214.095) (-1214.931) (-1211.861) [-1210.878] -- 0:00:46 270000 -- [-1214.572] (-1212.217) (-1210.629) (-1211.887) * [-1213.973] (-1214.873) (-1211.956) (-1210.511) -- 0:00:45 Average standard deviation of split frequencies: 0.018094 270500 -- (-1210.938) (-1215.163) (-1214.864) [-1213.286] * [-1212.922] (-1221.071) (-1211.085) (-1211.053) -- 0:00:45 271000 -- (-1210.954) (-1211.624) [-1212.811] (-1213.448) * (-1212.245) (-1215.823) (-1215.590) [-1211.656] -- 0:00:45 271500 -- [-1211.997] (-1211.530) (-1212.588) (-1214.677) * (-1210.634) [-1215.134] (-1213.533) (-1215.554) -- 0:00:45 272000 -- (-1214.163) [-1212.596] (-1212.397) (-1215.416) * (-1211.587) (-1215.549) [-1214.063] (-1210.529) -- 0:00:45 272500 -- (-1213.628) (-1213.221) [-1215.371] (-1213.394) * (-1212.316) (-1213.501) (-1212.331) [-1211.618] -- 0:00:45 273000 -- (-1212.524) [-1211.076] (-1211.920) (-1213.935) * (-1212.348) (-1213.293) (-1213.391) [-1211.071] -- 0:00:45 273500 -- (-1213.072) [-1210.983] (-1212.943) (-1216.880) * [-1212.222] (-1217.607) (-1213.770) (-1211.283) -- 0:00:47 274000 -- (-1213.454) [-1210.974] (-1214.675) (-1215.007) * (-1212.883) (-1215.487) [-1212.156] (-1211.779) -- 0:00:47 274500 -- [-1212.345] (-1213.966) (-1211.469) (-1214.155) * (-1213.363) (-1212.391) [-1211.426] (-1212.556) -- 0:00:47 275000 -- (-1212.249) (-1215.638) [-1213.087] (-1211.866) * (-1211.679) [-1213.125] (-1219.885) (-1213.336) -- 0:00:47 Average standard deviation of split frequencies: 0.019073 275500 -- (-1211.116) (-1214.612) [-1214.065] (-1211.447) * (-1211.836) (-1212.787) [-1212.020] (-1212.130) -- 0:00:47 276000 -- [-1211.071] (-1211.373) (-1217.403) (-1211.466) * [-1210.453] (-1212.771) (-1210.891) (-1216.545) -- 0:00:47 276500 -- (-1211.248) (-1211.750) [-1213.020] (-1212.502) * (-1210.392) (-1213.255) (-1210.926) [-1211.697] -- 0:00:47 277000 -- (-1211.567) (-1211.546) (-1212.342) [-1216.730] * (-1215.029) (-1213.045) [-1211.812] (-1211.581) -- 0:00:46 277500 -- [-1211.567] (-1212.627) (-1213.248) (-1212.111) * [-1212.191] (-1212.087) (-1214.160) (-1211.733) -- 0:00:46 278000 -- (-1210.976) [-1210.585] (-1212.088) (-1212.131) * (-1210.546) (-1211.774) [-1214.906] (-1211.966) -- 0:00:46 278500 -- [-1210.939] (-1212.141) (-1210.722) (-1212.216) * [-1211.330] (-1212.350) (-1211.630) (-1211.700) -- 0:00:46 279000 -- (-1215.204) [-1212.760] (-1212.078) (-1219.542) * (-1211.434) [-1210.747] (-1211.846) (-1212.977) -- 0:00:46 279500 -- [-1211.970] (-1212.952) (-1212.787) (-1216.290) * [-1211.188] (-1215.678) (-1214.212) (-1214.448) -- 0:00:46 280000 -- (-1212.602) [-1213.086] (-1212.891) (-1214.589) * [-1210.908] (-1214.298) (-1213.214) (-1211.748) -- 0:00:46 Average standard deviation of split frequencies: 0.017916 280500 -- (-1218.075) (-1212.751) (-1211.311) [-1212.558] * (-1212.070) (-1213.214) [-1213.142] (-1214.210) -- 0:00:46 281000 -- (-1213.350) (-1218.213) [-1212.922] (-1212.889) * [-1211.953] (-1213.334) (-1214.657) (-1212.190) -- 0:00:46 281500 -- (-1213.238) (-1216.125) (-1211.284) [-1211.990] * (-1211.670) [-1210.680] (-1217.245) (-1213.980) -- 0:00:45 282000 -- (-1214.856) (-1211.417) (-1211.703) [-1212.538] * [-1210.938] (-1214.516) (-1212.165) (-1213.186) -- 0:00:45 282500 -- [-1213.253] (-1215.487) (-1212.981) (-1212.285) * (-1213.458) (-1215.488) (-1216.402) [-1211.623] -- 0:00:45 283000 -- (-1215.677) (-1218.017) (-1214.625) [-1213.773] * [-1212.418] (-1214.445) (-1212.105) (-1214.199) -- 0:00:45 283500 -- [-1211.456] (-1216.944) (-1212.633) (-1214.302) * [-1212.027] (-1213.123) (-1212.604) (-1213.042) -- 0:00:45 284000 -- [-1210.714] (-1213.981) (-1211.612) (-1217.614) * (-1215.559) (-1213.738) (-1211.294) [-1212.383] -- 0:00:45 284500 -- (-1212.526) (-1213.247) [-1212.317] (-1211.034) * (-1217.602) (-1214.680) [-1210.580] (-1212.195) -- 0:00:45 285000 -- (-1212.128) (-1213.161) (-1213.900) [-1212.686] * (-1221.949) [-1212.582] (-1215.422) (-1211.389) -- 0:00:45 Average standard deviation of split frequencies: 0.016049 285500 -- [-1210.379] (-1211.953) (-1213.189) (-1215.623) * (-1213.223) [-1213.217] (-1212.270) (-1212.011) -- 0:00:45 286000 -- (-1210.610) [-1212.089] (-1213.159) (-1214.258) * (-1213.662) [-1210.580] (-1211.927) (-1210.439) -- 0:00:44 286500 -- (-1210.987) (-1213.325) [-1213.264] (-1212.892) * [-1214.093] (-1215.782) (-1215.926) (-1211.349) -- 0:00:44 287000 -- [-1211.215] (-1213.716) (-1212.730) (-1212.715) * (-1212.250) (-1215.764) (-1214.928) [-1212.281] -- 0:00:44 287500 -- (-1215.511) (-1215.271) (-1212.942) [-1211.960] * [-1212.407] (-1216.133) (-1211.312) (-1212.442) -- 0:00:44 288000 -- (-1212.355) (-1217.315) (-1212.277) [-1212.862] * (-1215.235) (-1212.931) (-1211.129) [-1211.345] -- 0:00:44 288500 -- (-1212.012) (-1216.149) (-1211.958) [-1215.604] * (-1212.520) [-1214.583] (-1214.008) (-1210.645) -- 0:00:44 289000 -- (-1212.344) (-1215.029) [-1210.571] (-1214.037) * (-1215.122) (-1213.749) [-1215.093] (-1212.756) -- 0:00:44 289500 -- (-1211.774) [-1212.006] (-1211.398) (-1211.519) * (-1214.759) [-1212.582] (-1213.757) (-1212.843) -- 0:00:44 290000 -- (-1214.999) (-1210.981) [-1213.861] (-1212.253) * [-1213.981] (-1215.106) (-1216.127) (-1212.649) -- 0:00:46 Average standard deviation of split frequencies: 0.016218 290500 -- (-1211.042) [-1212.050] (-1211.349) (-1212.075) * (-1211.387) (-1213.941) (-1215.255) [-1212.029] -- 0:00:46 291000 -- [-1212.331] (-1212.570) (-1211.619) (-1211.394) * (-1211.834) (-1213.703) [-1214.824] (-1212.946) -- 0:00:46 291500 -- (-1211.679) (-1213.628) [-1211.085] (-1213.279) * (-1211.673) (-1214.670) (-1217.040) [-1212.601] -- 0:00:46 292000 -- [-1213.109] (-1215.464) (-1211.436) (-1211.784) * (-1213.057) (-1217.157) [-1214.438] (-1211.773) -- 0:00:46 292500 -- [-1212.713] (-1215.875) (-1210.695) (-1215.640) * [-1212.950] (-1225.154) (-1211.396) (-1213.707) -- 0:00:45 293000 -- (-1214.385) [-1211.810] (-1210.746) (-1213.427) * (-1214.919) (-1221.572) [-1214.699] (-1210.741) -- 0:00:45 293500 -- (-1213.686) (-1211.128) (-1211.512) [-1211.199] * [-1211.977] (-1222.819) (-1214.555) (-1212.257) -- 0:00:45 294000 -- (-1213.424) [-1211.594] (-1215.043) (-1211.926) * [-1210.976] (-1210.970) (-1217.694) (-1211.000) -- 0:00:45 294500 -- (-1213.598) [-1214.090] (-1218.822) (-1213.929) * [-1213.076] (-1214.316) (-1214.538) (-1211.629) -- 0:00:45 295000 -- (-1212.277) (-1213.422) [-1211.031] (-1216.301) * (-1211.933) (-1212.273) [-1215.138] (-1212.159) -- 0:00:45 Average standard deviation of split frequencies: 0.014970 295500 -- (-1213.335) [-1215.537] (-1212.440) (-1213.804) * (-1211.055) (-1217.569) [-1211.229] (-1211.914) -- 0:00:45 296000 -- (-1211.935) (-1213.562) [-1212.966] (-1217.136) * (-1210.965) (-1213.564) (-1213.944) [-1214.230] -- 0:00:45 296500 -- (-1211.153) (-1214.775) [-1213.731] (-1214.027) * (-1211.411) [-1211.688] (-1214.173) (-1213.691) -- 0:00:45 297000 -- [-1212.677] (-1220.613) (-1214.481) (-1213.290) * (-1211.414) (-1212.094) [-1213.431] (-1214.117) -- 0:00:44 297500 -- (-1214.271) (-1217.535) [-1211.446] (-1210.886) * (-1211.329) [-1212.566] (-1211.628) (-1210.753) -- 0:00:44 298000 -- (-1214.864) (-1211.468) (-1211.113) [-1211.022] * (-1213.275) (-1210.765) [-1211.838] (-1211.791) -- 0:00:44 298500 -- [-1212.269] (-1211.720) (-1211.184) (-1211.727) * (-1221.064) [-1210.877] (-1211.653) (-1212.827) -- 0:00:44 299000 -- [-1211.982] (-1210.977) (-1213.514) (-1218.110) * (-1216.887) [-1211.038] (-1211.620) (-1214.633) -- 0:00:44 299500 -- (-1211.430) (-1211.689) [-1211.986] (-1213.742) * [-1214.407] (-1210.717) (-1211.775) (-1220.394) -- 0:00:44 300000 -- (-1211.927) [-1216.607] (-1211.662) (-1212.570) * (-1218.581) [-1211.043] (-1214.210) (-1213.983) -- 0:00:44 Average standard deviation of split frequencies: 0.015018 300500 -- [-1212.722] (-1212.114) (-1211.091) (-1212.777) * (-1213.189) [-1211.939] (-1215.835) (-1215.094) -- 0:00:44 301000 -- [-1212.316] (-1212.646) (-1216.116) (-1212.569) * (-1214.236) [-1216.611] (-1215.338) (-1211.567) -- 0:00:44 301500 -- (-1211.403) (-1213.021) (-1211.412) [-1211.419] * (-1213.118) (-1215.003) (-1215.316) [-1214.064] -- 0:00:44 302000 -- (-1213.127) [-1211.163] (-1215.735) (-1211.636) * (-1218.190) [-1211.210] (-1211.065) (-1216.416) -- 0:00:43 302500 -- (-1213.127) (-1212.148) (-1213.333) [-1211.641] * (-1214.876) (-1211.422) [-1211.515] (-1213.834) -- 0:00:43 303000 -- (-1216.619) (-1211.246) [-1211.063] (-1211.633) * (-1212.296) (-1211.254) [-1212.191] (-1212.981) -- 0:00:43 303500 -- (-1212.118) (-1212.350) (-1211.589) [-1212.069] * [-1212.855] (-1211.134) (-1213.057) (-1214.430) -- 0:00:43 304000 -- (-1213.296) [-1212.362] (-1211.606) (-1212.674) * (-1213.268) (-1214.966) (-1214.493) [-1212.924] -- 0:00:43 304500 -- [-1212.844] (-1212.661) (-1213.122) (-1211.986) * [-1214.346] (-1211.347) (-1213.451) (-1213.057) -- 0:00:43 305000 -- [-1212.940] (-1210.944) (-1212.035) (-1213.026) * [-1211.424] (-1211.618) (-1211.217) (-1211.801) -- 0:00:43 Average standard deviation of split frequencies: 0.015945 305500 -- (-1214.037) (-1210.954) (-1214.003) [-1210.311] * [-1211.467] (-1211.539) (-1213.625) (-1216.076) -- 0:00:43 306000 -- (-1214.784) (-1216.026) (-1211.818) [-1212.230] * [-1211.807] (-1214.390) (-1215.420) (-1212.440) -- 0:00:45 306500 -- (-1214.959) (-1214.648) (-1212.825) [-1212.249] * (-1213.724) (-1218.787) (-1213.087) [-1211.661] -- 0:00:45 307000 -- [-1213.115] (-1215.256) (-1212.705) (-1213.648) * (-1211.529) (-1216.284) (-1217.382) [-1211.116] -- 0:00:45 307500 -- [-1212.655] (-1211.866) (-1212.519) (-1211.643) * [-1211.404] (-1214.333) (-1211.667) (-1211.004) -- 0:00:45 308000 -- (-1214.341) [-1212.243] (-1212.673) (-1214.369) * [-1211.843] (-1215.828) (-1215.382) (-1210.296) -- 0:00:44 308500 -- [-1212.076] (-1213.537) (-1212.118) (-1210.688) * (-1210.511) [-1211.588] (-1214.859) (-1211.213) -- 0:00:44 309000 -- (-1212.682) (-1215.011) [-1212.901] (-1213.973) * [-1211.463] (-1212.374) (-1216.737) (-1212.418) -- 0:00:44 309500 -- [-1210.487] (-1213.837) (-1219.694) (-1211.186) * (-1211.283) [-1212.133] (-1217.134) (-1211.383) -- 0:00:44 310000 -- (-1214.037) (-1215.923) [-1211.896] (-1212.503) * (-1210.932) (-1211.610) [-1212.888] (-1213.769) -- 0:00:44 Average standard deviation of split frequencies: 0.015326 310500 -- [-1214.107] (-1213.466) (-1213.140) (-1210.717) * (-1212.019) [-1212.231] (-1217.660) (-1213.777) -- 0:00:44 311000 -- (-1214.278) (-1216.465) [-1212.541] (-1210.717) * [-1214.464] (-1213.391) (-1212.861) (-1214.580) -- 0:00:44 311500 -- [-1212.887] (-1211.317) (-1213.006) (-1211.065) * [-1211.457] (-1212.859) (-1213.134) (-1212.044) -- 0:00:44 312000 -- [-1211.636] (-1217.660) (-1213.391) (-1210.753) * (-1212.993) (-1214.801) (-1211.974) [-1215.154] -- 0:00:44 312500 -- [-1211.506] (-1213.429) (-1211.748) (-1212.946) * (-1214.133) [-1210.448] (-1212.621) (-1215.332) -- 0:00:44 313000 -- (-1212.347) [-1213.976] (-1212.218) (-1210.689) * [-1210.310] (-1211.700) (-1213.526) (-1214.217) -- 0:00:43 313500 -- (-1211.268) [-1211.425] (-1212.754) (-1211.803) * (-1215.013) (-1210.806) (-1212.982) [-1212.403] -- 0:00:43 314000 -- (-1213.646) (-1211.642) (-1213.102) [-1211.059] * (-1210.681) [-1211.864] (-1211.062) (-1213.354) -- 0:00:43 314500 -- (-1215.190) [-1211.512] (-1212.876) (-1211.155) * (-1212.741) (-1212.701) (-1213.180) [-1211.334] -- 0:00:43 315000 -- (-1212.574) (-1210.508) [-1212.324] (-1213.505) * (-1214.728) [-1214.443] (-1215.580) (-1213.680) -- 0:00:43 Average standard deviation of split frequencies: 0.015664 315500 -- (-1212.113) (-1214.608) [-1211.044] (-1214.107) * (-1212.727) [-1211.509] (-1211.772) (-1211.269) -- 0:00:43 316000 -- (-1214.911) [-1213.219] (-1212.706) (-1211.592) * (-1215.797) (-1211.018) (-1213.948) [-1210.657] -- 0:00:43 316500 -- (-1212.080) [-1211.993] (-1212.803) (-1213.482) * (-1214.215) [-1211.117] (-1211.300) (-1210.999) -- 0:00:43 317000 -- (-1212.054) (-1212.333) (-1214.644) [-1214.858] * [-1213.214] (-1213.299) (-1211.907) (-1210.348) -- 0:00:43 317500 -- [-1213.072] (-1211.486) (-1212.939) (-1215.136) * (-1212.103) [-1214.110] (-1214.259) (-1211.859) -- 0:00:42 318000 -- (-1212.917) (-1212.168) [-1213.437] (-1215.843) * [-1213.881] (-1211.207) (-1212.565) (-1213.446) -- 0:00:42 318500 -- (-1213.566) (-1211.053) (-1214.177) [-1213.235] * (-1211.039) (-1211.082) (-1213.470) [-1211.548] -- 0:00:42 319000 -- (-1216.223) [-1210.833] (-1215.735) (-1219.298) * (-1210.571) (-1214.955) [-1216.629] (-1214.403) -- 0:00:42 319500 -- [-1218.222] (-1211.633) (-1214.900) (-1217.619) * [-1212.275] (-1221.211) (-1213.682) (-1212.982) -- 0:00:42 320000 -- [-1212.090] (-1211.418) (-1214.508) (-1215.091) * (-1212.728) (-1218.549) [-1215.536] (-1210.781) -- 0:00:42 Average standard deviation of split frequencies: 0.014314 320500 -- (-1214.272) [-1211.457] (-1216.790) (-1211.341) * [-1210.289] (-1214.357) (-1216.076) (-1213.179) -- 0:00:42 321000 -- (-1216.177) [-1211.030] (-1213.129) (-1212.429) * (-1211.112) (-1213.933) [-1214.674] (-1212.253) -- 0:00:42 321500 -- [-1211.035] (-1211.812) (-1212.158) (-1213.860) * (-1213.419) (-1213.397) [-1212.844] (-1211.566) -- 0:00:44 322000 -- (-1213.089) (-1216.166) [-1215.999] (-1211.082) * (-1214.703) [-1213.233] (-1213.056) (-1210.559) -- 0:00:44 322500 -- (-1211.563) [-1211.123] (-1212.997) (-1214.171) * (-1210.942) [-1213.819] (-1212.705) (-1211.157) -- 0:00:44 323000 -- (-1213.487) (-1211.125) [-1213.530] (-1211.788) * [-1214.578] (-1214.666) (-1211.682) (-1216.222) -- 0:00:44 323500 -- (-1211.176) [-1212.992] (-1211.004) (-1211.064) * (-1216.870) [-1213.244] (-1212.311) (-1211.063) -- 0:00:43 324000 -- [-1211.802] (-1212.796) (-1214.381) (-1211.064) * (-1220.991) (-1211.771) [-1210.541] (-1211.363) -- 0:00:43 324500 -- (-1211.214) (-1211.102) (-1222.086) [-1211.146] * (-1212.568) (-1211.099) (-1212.920) [-1211.727] -- 0:00:43 325000 -- [-1213.126] (-1210.610) (-1217.949) (-1212.096) * [-1213.043] (-1217.524) (-1213.052) (-1211.192) -- 0:00:43 Average standard deviation of split frequencies: 0.014156 325500 -- (-1210.482) [-1210.388] (-1211.861) (-1212.700) * (-1210.966) (-1215.391) (-1212.872) [-1210.789] -- 0:00:43 326000 -- (-1211.342) [-1211.616] (-1212.005) (-1215.417) * [-1210.753] (-1212.927) (-1213.440) (-1211.026) -- 0:00:43 326500 -- (-1212.560) (-1213.095) (-1214.690) [-1213.975] * (-1210.702) (-1216.090) [-1214.429] (-1211.126) -- 0:00:43 327000 -- (-1212.999) [-1213.498] (-1211.210) (-1211.777) * (-1211.009) (-1214.484) (-1212.468) [-1210.916] -- 0:00:43 327500 -- (-1211.302) (-1212.770) [-1213.441] (-1212.361) * (-1211.778) (-1212.450) [-1210.736] (-1213.290) -- 0:00:43 328000 -- (-1210.762) (-1211.411) [-1213.561] (-1210.723) * [-1211.150] (-1211.618) (-1212.339) (-1213.178) -- 0:00:43 328500 -- (-1213.964) [-1213.113] (-1215.951) (-1214.902) * [-1211.007] (-1211.529) (-1212.478) (-1210.811) -- 0:00:42 329000 -- (-1213.381) [-1210.981] (-1216.429) (-1211.054) * (-1211.278) [-1211.354] (-1211.765) (-1212.559) -- 0:00:42 329500 -- (-1212.389) [-1212.714] (-1219.140) (-1212.188) * [-1210.903] (-1212.085) (-1212.835) (-1212.584) -- 0:00:42 330000 -- (-1212.611) [-1212.013] (-1216.051) (-1212.188) * (-1212.534) [-1212.374] (-1213.422) (-1214.142) -- 0:00:42 Average standard deviation of split frequencies: 0.014631 330500 -- (-1212.926) (-1213.173) [-1215.463] (-1210.787) * [-1211.110] (-1214.069) (-1210.990) (-1213.643) -- 0:00:42 331000 -- (-1212.929) [-1212.852] (-1214.763) (-1217.333) * (-1211.978) (-1211.273) [-1210.551] (-1214.672) -- 0:00:42 331500 -- (-1212.655) (-1212.574) [-1211.660] (-1210.878) * (-1212.742) (-1212.467) (-1212.255) [-1217.075] -- 0:00:42 332000 -- (-1213.052) (-1218.905) [-1212.109] (-1210.322) * [-1210.735] (-1212.861) (-1213.641) (-1214.120) -- 0:00:42 332500 -- (-1214.011) (-1210.298) [-1211.923] (-1214.954) * (-1213.672) [-1211.721] (-1212.639) (-1213.258) -- 0:00:42 333000 -- [-1214.117] (-1214.519) (-1212.114) (-1211.571) * (-1213.366) (-1213.458) [-1213.750] (-1213.732) -- 0:00:42 333500 -- (-1213.314) [-1211.727] (-1212.212) (-1213.960) * [-1211.360] (-1213.402) (-1212.103) (-1210.996) -- 0:00:41 334000 -- (-1211.038) (-1216.002) (-1210.274) [-1214.384] * [-1213.938] (-1214.693) (-1211.432) (-1210.996) -- 0:00:41 334500 -- (-1211.932) (-1213.740) (-1212.661) [-1214.440] * (-1217.507) [-1213.381] (-1211.190) (-1211.276) -- 0:00:41 335000 -- [-1211.917] (-1215.014) (-1214.555) (-1214.590) * (-1212.720) (-1212.078) [-1211.211] (-1213.457) -- 0:00:41 Average standard deviation of split frequencies: 0.013882 335500 -- (-1211.783) (-1214.414) [-1213.344] (-1216.199) * (-1213.787) [-1211.612] (-1212.026) (-1215.191) -- 0:00:41 336000 -- (-1211.894) (-1215.184) [-1213.193] (-1211.536) * (-1213.372) (-1212.357) (-1216.678) [-1212.156] -- 0:00:41 336500 -- (-1210.992) (-1213.391) (-1211.908) [-1212.210] * (-1215.231) (-1211.509) [-1217.778] (-1211.459) -- 0:00:41 337000 -- (-1210.720) [-1213.800] (-1214.573) (-1213.348) * (-1214.512) (-1212.531) (-1211.837) [-1214.594] -- 0:00:41 337500 -- (-1215.566) [-1215.872] (-1215.301) (-1210.991) * (-1211.294) [-1213.329] (-1214.895) (-1211.687) -- 0:00:41 338000 -- (-1220.223) (-1213.732) [-1214.849] (-1213.539) * (-1212.419) (-1212.440) (-1215.032) [-1212.360] -- 0:00:43 338500 -- (-1214.816) [-1211.097] (-1210.663) (-1213.771) * (-1210.970) (-1212.440) (-1214.381) [-1211.517] -- 0:00:42 339000 -- (-1212.492) [-1211.005] (-1213.532) (-1214.487) * [-1210.737] (-1212.936) (-1214.278) (-1213.263) -- 0:00:42 339500 -- (-1211.411) (-1211.857) (-1212.594) [-1214.833] * (-1210.940) (-1212.692) [-1214.474] (-1213.567) -- 0:00:42 340000 -- (-1214.651) (-1211.857) (-1210.698) [-1211.975] * (-1212.341) (-1216.388) [-1213.571] (-1214.728) -- 0:00:42 Average standard deviation of split frequencies: 0.013983 340500 -- (-1214.059) [-1213.141] (-1210.698) (-1211.790) * [-1212.341] (-1210.924) (-1210.614) (-1214.365) -- 0:00:42 341000 -- [-1214.968] (-1213.956) (-1210.251) (-1210.251) * (-1211.764) (-1211.814) [-1212.531] (-1217.698) -- 0:00:42 341500 -- (-1213.674) (-1211.865) (-1210.178) [-1213.430] * [-1212.387] (-1211.095) (-1211.681) (-1216.071) -- 0:00:42 342000 -- (-1212.516) [-1211.589] (-1214.806) (-1212.471) * (-1212.382) (-1211.539) (-1213.235) [-1215.191] -- 0:00:42 342500 -- (-1216.696) (-1211.588) [-1214.432] (-1215.255) * [-1213.486] (-1215.210) (-1211.288) (-1213.308) -- 0:00:42 343000 -- [-1216.671] (-1210.555) (-1214.636) (-1215.755) * (-1211.129) [-1212.015] (-1212.605) (-1215.045) -- 0:00:42 343500 -- (-1216.488) (-1210.558) (-1211.453) [-1211.710] * (-1213.694) (-1213.143) (-1211.620) [-1212.119] -- 0:00:42 344000 -- (-1214.791) (-1211.364) [-1211.251] (-1211.502) * (-1211.213) [-1214.554] (-1211.416) (-1214.919) -- 0:00:41 344500 -- (-1217.510) (-1211.713) (-1211.227) [-1211.520] * (-1213.289) (-1214.729) [-1210.848] (-1211.511) -- 0:00:41 345000 -- (-1213.768) [-1213.615] (-1217.953) (-1213.722) * (-1213.066) (-1211.309) [-1211.419] (-1211.348) -- 0:00:41 Average standard deviation of split frequencies: 0.013338 345500 -- (-1211.313) (-1212.894) [-1213.684] (-1210.944) * [-1210.688] (-1213.269) (-1216.569) (-1212.749) -- 0:00:41 346000 -- (-1213.390) (-1213.673) [-1211.031] (-1212.821) * (-1212.140) (-1212.928) (-1212.160) [-1214.474] -- 0:00:41 346500 -- (-1213.322) [-1213.391] (-1211.063) (-1217.833) * (-1210.922) (-1212.855) [-1212.393] (-1213.038) -- 0:00:41 347000 -- [-1212.251] (-1219.848) (-1211.571) (-1213.938) * (-1213.678) (-1212.584) [-1212.429] (-1214.671) -- 0:00:41 347500 -- (-1210.982) [-1212.274] (-1214.155) (-1213.212) * (-1213.946) (-1211.725) (-1212.479) [-1213.958] -- 0:00:41 348000 -- (-1212.051) (-1211.019) (-1212.733) [-1215.289] * [-1214.160] (-1211.846) (-1214.385) (-1213.517) -- 0:00:41 348500 -- (-1213.759) [-1213.366] (-1210.893) (-1216.593) * (-1211.489) [-1211.478] (-1212.192) (-1211.156) -- 0:00:41 349000 -- (-1216.014) (-1215.293) (-1214.366) [-1213.452] * (-1211.760) [-1212.483] (-1211.803) (-1211.340) -- 0:00:41 349500 -- (-1216.806) (-1217.813) [-1216.091] (-1212.975) * (-1211.794) (-1210.653) (-1213.065) [-1211.069] -- 0:00:40 350000 -- (-1211.399) (-1211.958) [-1211.445] (-1212.620) * (-1211.831) (-1210.653) [-1212.043] (-1211.107) -- 0:00:40 Average standard deviation of split frequencies: 0.012472 350500 -- (-1211.719) [-1211.415] (-1211.319) (-1215.808) * [-1211.136] (-1211.173) (-1211.664) (-1215.240) -- 0:00:40 351000 -- (-1210.611) [-1211.464] (-1215.051) (-1211.281) * (-1212.343) (-1215.411) [-1214.611] (-1214.941) -- 0:00:40 351500 -- (-1213.090) (-1210.396) [-1215.735] (-1215.184) * [-1213.061] (-1212.809) (-1217.112) (-1212.216) -- 0:00:40 352000 -- (-1214.631) (-1211.907) (-1211.326) [-1213.154] * [-1211.781] (-1212.013) (-1214.915) (-1211.576) -- 0:00:40 352500 -- (-1213.742) (-1214.262) [-1211.254] (-1217.707) * [-1212.140] (-1216.048) (-1215.559) (-1211.439) -- 0:00:40 353000 -- (-1212.055) (-1213.824) [-1211.697] (-1217.666) * [-1211.433] (-1216.264) (-1215.165) (-1211.401) -- 0:00:40 353500 -- (-1213.640) [-1213.018] (-1211.250) (-1213.563) * (-1211.418) [-1212.818] (-1214.493) (-1212.840) -- 0:00:40 354000 -- [-1210.809] (-1216.681) (-1219.677) (-1214.197) * [-1212.610] (-1212.000) (-1214.391) (-1211.425) -- 0:00:41 354500 -- (-1216.153) (-1213.613) [-1214.713] (-1214.922) * (-1214.196) [-1211.775] (-1213.432) (-1212.160) -- 0:00:41 355000 -- [-1214.762] (-1216.659) (-1213.015) (-1214.833) * [-1212.736] (-1211.806) (-1214.338) (-1210.977) -- 0:00:41 Average standard deviation of split frequencies: 0.012229 355500 -- (-1214.728) (-1218.224) [-1212.073] (-1211.854) * (-1215.983) (-1210.788) [-1211.472] (-1212.714) -- 0:00:41 356000 -- (-1212.049) (-1212.485) (-1213.690) [-1212.470] * (-1213.048) (-1210.956) [-1213.366] (-1212.199) -- 0:00:41 356500 -- (-1218.383) [-1213.342] (-1211.139) (-1212.395) * (-1214.470) [-1210.567] (-1211.775) (-1213.231) -- 0:00:41 357000 -- [-1213.109] (-1212.662) (-1213.104) (-1211.153) * (-1214.836) (-1212.507) [-1211.750] (-1214.082) -- 0:00:41 357500 -- (-1210.472) (-1211.796) (-1214.606) [-1212.994] * [-1217.116] (-1212.629) (-1212.375) (-1212.266) -- 0:00:41 358000 -- (-1215.048) [-1211.531] (-1212.788) (-1213.912) * [-1210.810] (-1213.788) (-1212.259) (-1211.892) -- 0:00:41 358500 -- (-1213.074) (-1211.915) [-1210.349] (-1212.268) * (-1214.178) (-1211.288) [-1212.008] (-1210.493) -- 0:00:41 359000 -- (-1212.404) (-1212.980) (-1211.466) [-1212.435] * [-1212.383] (-1212.505) (-1211.794) (-1210.496) -- 0:00:41 359500 -- (-1212.288) (-1211.101) [-1212.756] (-1219.555) * (-1211.284) (-1212.886) [-1210.734] (-1211.371) -- 0:00:40 360000 -- (-1215.566) [-1211.637] (-1211.051) (-1217.636) * (-1212.734) (-1212.934) [-1212.528] (-1211.363) -- 0:00:40 Average standard deviation of split frequencies: 0.012225 360500 -- [-1210.856] (-1211.554) (-1211.697) (-1213.178) * (-1216.577) (-1213.827) [-1213.778] (-1217.159) -- 0:00:40 361000 -- (-1214.014) (-1211.364) [-1212.106] (-1211.807) * (-1216.561) (-1212.461) (-1214.761) [-1214.388] -- 0:00:40 361500 -- [-1211.440] (-1216.931) (-1212.160) (-1212.502) * (-1210.916) [-1213.731] (-1214.658) (-1213.083) -- 0:00:40 362000 -- [-1212.189] (-1211.549) (-1217.163) (-1212.992) * (-1210.447) [-1212.356] (-1212.830) (-1213.170) -- 0:00:40 362500 -- [-1211.550] (-1213.345) (-1218.485) (-1213.656) * [-1210.514] (-1216.323) (-1213.316) (-1211.063) -- 0:00:40 363000 -- [-1212.531] (-1212.621) (-1215.602) (-1211.975) * (-1210.973) [-1211.427] (-1211.211) (-1211.464) -- 0:00:40 363500 -- (-1211.030) (-1212.326) (-1213.529) [-1211.960] * (-1211.164) [-1211.605] (-1213.446) (-1211.090) -- 0:00:40 364000 -- (-1210.965) (-1211.585) (-1213.249) [-1212.612] * [-1210.926] (-1214.053) (-1213.008) (-1214.402) -- 0:00:40 364500 -- (-1211.706) (-1211.092) [-1212.598] (-1214.074) * [-1212.351] (-1211.697) (-1215.883) (-1212.276) -- 0:00:40 365000 -- (-1213.186) (-1215.496) [-1212.260] (-1212.177) * (-1210.807) [-1214.941] (-1216.629) (-1210.929) -- 0:00:40 Average standard deviation of split frequencies: 0.012379 365500 -- (-1214.444) [-1212.452] (-1214.497) (-1210.979) * (-1216.671) [-1212.561] (-1214.072) (-1213.092) -- 0:00:39 366000 -- (-1215.533) [-1212.335] (-1211.449) (-1210.330) * [-1213.202] (-1212.945) (-1212.256) (-1211.268) -- 0:00:39 366500 -- (-1210.528) [-1216.399] (-1212.027) (-1210.792) * (-1210.799) [-1211.813] (-1211.361) (-1211.374) -- 0:00:39 367000 -- (-1214.018) (-1214.266) (-1212.244) [-1210.618] * (-1211.251) [-1217.188] (-1210.452) (-1211.300) -- 0:00:39 367500 -- (-1214.673) [-1211.622] (-1213.426) (-1211.158) * (-1211.312) [-1216.205] (-1212.385) (-1211.590) -- 0:00:39 368000 -- (-1214.408) (-1211.074) [-1212.412] (-1211.362) * (-1214.233) [-1216.338] (-1211.964) (-1211.907) -- 0:00:39 368500 -- (-1211.972) (-1212.352) [-1211.589] (-1211.836) * (-1213.269) (-1211.778) (-1212.000) [-1211.231] -- 0:00:39 369000 -- (-1212.459) (-1211.253) [-1213.149] (-1215.834) * (-1210.706) (-1216.612) [-1211.839] (-1212.272) -- 0:00:39 369500 -- [-1212.702] (-1213.566) (-1214.819) (-1210.291) * [-1210.499] (-1213.246) (-1214.762) (-1212.081) -- 0:00:39 370000 -- [-1211.081] (-1212.843) (-1222.801) (-1214.099) * [-1211.216] (-1213.453) (-1212.257) (-1214.419) -- 0:00:40 Average standard deviation of split frequencies: 0.012793 370500 -- (-1211.296) (-1212.846) [-1210.406] (-1211.598) * (-1210.172) [-1215.359] (-1211.196) (-1212.508) -- 0:00:40 371000 -- (-1212.325) (-1212.293) (-1210.126) [-1211.349] * [-1212.242] (-1214.015) (-1210.714) (-1214.336) -- 0:00:40 371500 -- (-1211.521) (-1213.164) (-1210.538) [-1215.886] * [-1211.546] (-1213.068) (-1211.324) (-1215.878) -- 0:00:40 372000 -- (-1211.258) (-1213.347) [-1211.401] (-1211.642) * (-1212.509) [-1214.023] (-1210.637) (-1212.981) -- 0:00:40 372500 -- [-1211.054] (-1214.820) (-1212.084) (-1210.601) * (-1211.976) (-1212.180) [-1212.706] (-1211.499) -- 0:00:40 373000 -- (-1211.964) (-1212.878) [-1212.465] (-1213.041) * (-1211.746) (-1212.536) [-1211.874] (-1215.780) -- 0:00:40 373500 -- (-1213.370) [-1213.066] (-1212.477) (-1211.149) * (-1211.221) [-1212.591] (-1211.312) (-1218.280) -- 0:00:40 374000 -- (-1212.791) [-1210.819] (-1213.002) (-1216.184) * [-1211.441] (-1212.057) (-1215.378) (-1215.985) -- 0:00:40 374500 -- (-1211.527) (-1214.683) [-1212.520] (-1212.756) * (-1212.154) (-1212.880) [-1212.264] (-1215.492) -- 0:00:40 375000 -- (-1210.790) (-1211.888) (-1212.762) [-1211.626] * (-1211.788) [-1211.412] (-1213.001) (-1211.111) -- 0:00:40 Average standard deviation of split frequencies: 0.013652 375500 -- [-1214.689] (-1211.740) (-1211.017) (-1212.049) * [-1210.981] (-1212.570) (-1211.114) (-1211.311) -- 0:00:39 376000 -- [-1212.866] (-1212.524) (-1211.741) (-1212.690) * (-1211.283) (-1213.053) [-1211.379] (-1212.203) -- 0:00:39 376500 -- (-1211.184) (-1212.314) [-1210.887] (-1215.902) * (-1213.781) [-1212.338] (-1216.123) (-1211.806) -- 0:00:39 377000 -- [-1210.566] (-1214.958) (-1211.364) (-1213.263) * [-1212.961] (-1211.808) (-1213.015) (-1210.340) -- 0:00:39 377500 -- (-1212.330) (-1212.943) (-1211.543) [-1212.567] * (-1211.005) [-1210.546] (-1216.656) (-1214.215) -- 0:00:39 378000 -- (-1211.410) (-1213.523) (-1211.981) [-1212.200] * (-1218.033) [-1214.167] (-1214.025) (-1211.070) -- 0:00:39 378500 -- (-1212.843) (-1213.848) [-1210.796] (-1212.218) * (-1213.761) (-1218.453) (-1210.251) [-1213.600] -- 0:00:39 379000 -- [-1213.639] (-1216.307) (-1210.357) (-1213.967) * (-1215.228) [-1212.168] (-1212.766) (-1213.778) -- 0:00:39 379500 -- (-1214.402) (-1214.479) [-1213.025] (-1213.781) * (-1215.562) [-1214.751] (-1210.852) (-1214.097) -- 0:00:39 380000 -- [-1211.115] (-1213.700) (-1212.004) (-1214.642) * [-1214.678] (-1214.459) (-1211.723) (-1215.651) -- 0:00:39 Average standard deviation of split frequencies: 0.013897 380500 -- (-1210.663) [-1211.009] (-1211.277) (-1211.786) * (-1211.612) [-1214.376] (-1212.922) (-1211.579) -- 0:00:39 381000 -- (-1210.308) (-1211.935) [-1210.843] (-1210.941) * [-1218.435] (-1215.005) (-1217.264) (-1212.698) -- 0:00:38 381500 -- [-1210.742] (-1213.087) (-1210.884) (-1212.770) * [-1212.918] (-1211.560) (-1212.714) (-1213.536) -- 0:00:38 382000 -- (-1211.072) (-1210.782) [-1211.774] (-1213.080) * (-1210.881) (-1213.777) [-1211.386] (-1210.787) -- 0:00:38 382500 -- [-1211.547] (-1216.926) (-1213.571) (-1213.280) * (-1212.601) (-1213.224) (-1211.341) [-1211.354] -- 0:00:38 383000 -- [-1211.268] (-1212.709) (-1213.764) (-1213.262) * (-1215.194) [-1212.600] (-1216.665) (-1211.460) -- 0:00:38 383500 -- (-1215.531) (-1217.815) (-1211.797) [-1211.900] * [-1214.056] (-1211.936) (-1215.089) (-1214.306) -- 0:00:38 384000 -- (-1212.087) (-1213.910) (-1217.228) [-1220.868] * (-1216.807) (-1211.297) (-1212.656) [-1214.267] -- 0:00:38 384500 -- [-1210.893] (-1212.056) (-1212.849) (-1210.904) * (-1212.066) (-1212.125) (-1215.591) [-1210.507] -- 0:00:38 385000 -- (-1214.359) (-1213.016) (-1215.355) [-1214.680] * (-1212.546) [-1212.249] (-1216.091) (-1211.201) -- 0:00:38 Average standard deviation of split frequencies: 0.013773 385500 -- [-1213.237] (-1212.971) (-1213.199) (-1216.075) * [-1211.349] (-1213.256) (-1211.880) (-1211.203) -- 0:00:38 386000 -- (-1214.649) (-1220.507) [-1211.934] (-1213.257) * (-1217.356) (-1213.043) [-1212.865] (-1211.481) -- 0:00:39 386500 -- (-1214.068) [-1213.660] (-1212.205) (-1211.854) * (-1211.690) (-1213.972) [-1211.071] (-1213.378) -- 0:00:39 387000 -- (-1213.901) [-1213.320] (-1211.123) (-1215.369) * (-1212.206) (-1212.715) [-1211.088] (-1213.812) -- 0:00:39 387500 -- (-1213.820) (-1214.261) (-1211.389) [-1213.668] * (-1216.586) (-1211.276) [-1213.923] (-1215.167) -- 0:00:39 388000 -- (-1215.985) [-1213.912] (-1214.988) (-1215.438) * (-1211.485) (-1211.084) (-1211.009) [-1211.112] -- 0:00:39 388500 -- (-1216.168) (-1212.082) [-1212.659] (-1217.485) * (-1210.816) (-1214.784) [-1213.779] (-1211.312) -- 0:00:39 389000 -- (-1213.239) (-1210.547) [-1213.284] (-1213.905) * (-1210.810) [-1214.388] (-1212.218) (-1211.915) -- 0:00:39 389500 -- (-1211.707) (-1214.943) [-1218.000] (-1215.192) * [-1210.812] (-1210.826) (-1212.743) (-1211.870) -- 0:00:39 390000 -- (-1211.696) (-1210.947) [-1212.187] (-1215.318) * (-1211.267) [-1212.886] (-1211.995) (-1214.402) -- 0:00:39 Average standard deviation of split frequencies: 0.013340 390500 -- (-1211.716) [-1211.625] (-1213.937) (-1211.874) * (-1211.333) (-1213.344) (-1211.061) [-1212.419] -- 0:00:39 391000 -- (-1211.576) (-1215.115) (-1212.546) [-1212.290] * [-1218.490] (-1211.382) (-1212.296) (-1213.926) -- 0:00:38 391500 -- (-1211.824) [-1212.671] (-1211.440) (-1213.929) * (-1212.234) (-1212.715) (-1211.211) [-1211.412] -- 0:00:38 392000 -- (-1214.157) (-1214.406) [-1210.780] (-1213.340) * (-1212.722) (-1215.325) [-1211.258] (-1211.329) -- 0:00:38 392500 -- [-1215.401] (-1213.316) (-1213.489) (-1211.854) * (-1212.802) [-1217.294] (-1214.059) (-1211.588) -- 0:00:38 393000 -- (-1214.777) (-1213.651) (-1212.528) [-1212.655] * [-1211.989] (-1212.239) (-1212.822) (-1210.837) -- 0:00:38 393500 -- (-1215.900) [-1212.033] (-1212.160) (-1212.217) * (-1212.666) (-1216.630) [-1212.021] (-1210.525) -- 0:00:38 394000 -- (-1215.391) (-1212.327) [-1211.184] (-1211.519) * [-1215.517] (-1214.130) (-1212.243) (-1210.954) -- 0:00:38 394500 -- (-1212.471) (-1212.766) (-1211.077) [-1215.711] * (-1217.595) [-1210.560] (-1212.870) (-1210.311) -- 0:00:38 395000 -- (-1213.611) (-1213.008) (-1210.881) [-1216.496] * (-1212.201) (-1211.630) (-1213.207) [-1211.156] -- 0:00:38 Average standard deviation of split frequencies: 0.013345 395500 -- (-1212.154) (-1212.712) [-1212.226] (-1216.153) * (-1212.013) (-1213.012) [-1211.763] (-1213.021) -- 0:00:38 396000 -- (-1218.877) [-1213.811] (-1211.407) (-1211.341) * (-1213.482) (-1215.648) [-1215.248] (-1211.993) -- 0:00:38 396500 -- (-1217.486) (-1218.570) (-1211.753) [-1211.974] * [-1215.702] (-1216.017) (-1213.861) (-1214.337) -- 0:00:38 397000 -- [-1213.721] (-1212.866) (-1211.982) (-1210.966) * (-1212.204) (-1214.174) (-1213.644) [-1212.549] -- 0:00:37 397500 -- (-1212.606) (-1215.071) (-1212.883) [-1210.939] * (-1212.987) (-1212.224) (-1212.477) [-1211.108] -- 0:00:37 398000 -- (-1211.624) (-1214.335) [-1212.038] (-1210.350) * (-1213.302) [-1212.353] (-1211.126) (-1213.373) -- 0:00:37 398500 -- (-1213.863) (-1210.928) (-1211.838) [-1211.102] * (-1214.145) (-1212.221) [-1215.413] (-1210.943) -- 0:00:37 399000 -- (-1213.661) (-1211.620) [-1211.557] (-1212.188) * (-1211.490) (-1214.167) [-1215.786] (-1212.300) -- 0:00:37 399500 -- (-1213.895) (-1211.242) [-1211.601] (-1213.292) * (-1210.993) [-1210.930] (-1215.414) (-1212.756) -- 0:00:37 400000 -- (-1217.822) (-1214.354) [-1212.369] (-1213.988) * (-1210.245) (-1212.510) (-1215.475) [-1213.182] -- 0:00:37 Average standard deviation of split frequencies: 0.013465 400500 -- (-1217.817) (-1213.643) [-1212.372] (-1210.686) * (-1211.055) (-1214.706) (-1210.439) [-1215.803] -- 0:00:37 401000 -- (-1216.872) [-1212.527] (-1212.284) (-1210.690) * (-1210.701) (-1212.535) [-1210.457] (-1213.817) -- 0:00:37 401500 -- (-1212.332) (-1212.885) (-1214.284) [-1210.740] * (-1211.039) (-1211.861) (-1214.869) [-1212.858] -- 0:00:37 402000 -- (-1213.704) [-1212.481] (-1211.566) (-1210.581) * [-1210.601] (-1212.681) (-1214.854) (-1215.589) -- 0:00:38 402500 -- (-1214.197) (-1212.240) (-1211.469) [-1212.595] * (-1212.198) (-1213.865) [-1210.740] (-1213.204) -- 0:00:38 403000 -- [-1212.177] (-1212.830) (-1212.857) (-1211.663) * (-1212.259) [-1211.174] (-1211.916) (-1211.951) -- 0:00:38 403500 -- (-1211.378) [-1212.087] (-1212.111) (-1212.490) * (-1215.407) (-1215.293) (-1211.347) [-1211.086] -- 0:00:38 404000 -- (-1210.689) (-1213.121) [-1214.862] (-1214.526) * (-1211.927) (-1214.818) [-1211.380] (-1214.755) -- 0:00:38 404500 -- (-1211.574) (-1211.983) (-1215.124) [-1215.251] * (-1211.830) (-1214.363) [-1213.967] (-1211.889) -- 0:00:38 405000 -- (-1210.802) (-1215.538) [-1211.362] (-1215.073) * (-1217.033) [-1217.062] (-1214.710) (-1213.113) -- 0:00:38 Average standard deviation of split frequencies: 0.012837 405500 -- [-1211.243] (-1217.063) (-1210.419) (-1211.994) * (-1211.668) (-1217.627) [-1211.716] (-1214.663) -- 0:00:38 406000 -- (-1211.057) [-1216.655] (-1213.646) (-1215.653) * [-1213.142] (-1215.996) (-1213.618) (-1211.292) -- 0:00:38 406500 -- (-1211.188) [-1214.258] (-1212.521) (-1212.910) * (-1213.647) [-1211.852] (-1213.023) (-1211.041) -- 0:00:37 407000 -- [-1211.250] (-1212.697) (-1211.491) (-1211.634) * (-1214.636) (-1211.965) (-1212.417) [-1211.275] -- 0:00:37 407500 -- [-1213.356] (-1214.174) (-1211.219) (-1213.284) * (-1211.889) (-1214.040) [-1211.584] (-1211.717) -- 0:00:37 408000 -- (-1212.997) (-1216.690) (-1211.232) [-1211.931] * (-1211.468) (-1211.889) [-1212.938] (-1212.913) -- 0:00:37 408500 -- (-1210.575) [-1215.182] (-1213.610) (-1215.740) * [-1211.449] (-1213.408) (-1214.057) (-1215.870) -- 0:00:37 409000 -- (-1210.336) (-1216.983) [-1212.214] (-1214.614) * [-1211.739] (-1212.327) (-1212.580) (-1211.377) -- 0:00:37 409500 -- (-1210.275) (-1212.671) [-1216.478] (-1211.437) * [-1210.995] (-1212.618) (-1213.132) (-1213.094) -- 0:00:37 410000 -- [-1211.014] (-1212.412) (-1211.415) (-1211.699) * [-1210.544] (-1213.328) (-1213.370) (-1213.339) -- 0:00:37 Average standard deviation of split frequencies: 0.012117 410500 -- (-1213.468) (-1211.808) [-1211.010] (-1210.550) * (-1213.088) (-1214.297) (-1213.336) [-1214.497] -- 0:00:37 411000 -- [-1214.563] (-1212.850) (-1212.200) (-1212.964) * (-1212.982) (-1215.168) (-1214.418) [-1212.764] -- 0:00:37 411500 -- (-1212.633) (-1212.717) (-1212.600) [-1210.858] * [-1211.809] (-1213.422) (-1212.753) (-1210.488) -- 0:00:37 412000 -- (-1213.262) (-1210.811) [-1212.063] (-1212.836) * (-1215.131) (-1214.078) (-1211.311) [-1212.650] -- 0:00:37 412500 -- (-1211.076) [-1211.011] (-1210.577) (-1214.634) * (-1217.183) (-1211.944) [-1211.329] (-1213.519) -- 0:00:37 413000 -- (-1212.320) [-1211.246] (-1216.594) (-1212.460) * (-1212.461) (-1213.881) [-1213.127] (-1212.860) -- 0:00:36 413500 -- [-1214.568] (-1211.452) (-1214.895) (-1210.836) * (-1214.871) (-1213.417) [-1210.753] (-1213.418) -- 0:00:36 414000 -- (-1212.567) [-1211.663] (-1211.165) (-1211.519) * [-1211.690] (-1211.349) (-1210.669) (-1219.801) -- 0:00:36 414500 -- [-1211.852] (-1213.843) (-1211.093) (-1213.614) * (-1211.492) [-1211.351] (-1213.239) (-1214.874) -- 0:00:36 415000 -- [-1210.143] (-1212.030) (-1212.430) (-1211.991) * (-1212.733) [-1212.524] (-1213.504) (-1213.925) -- 0:00:36 Average standard deviation of split frequencies: 0.011835 415500 -- (-1210.130) [-1212.051] (-1216.922) (-1216.464) * [-1211.194] (-1211.088) (-1213.999) (-1212.747) -- 0:00:36 416000 -- [-1211.329] (-1216.847) (-1214.881) (-1216.019) * (-1211.144) (-1217.916) (-1212.577) [-1212.083] -- 0:00:36 416500 -- [-1214.486] (-1211.983) (-1213.996) (-1212.822) * (-1211.252) (-1215.141) (-1212.006) [-1212.476] -- 0:00:36 417000 -- (-1212.002) (-1213.580) (-1212.982) [-1210.708] * (-1211.995) (-1213.965) (-1212.476) [-1211.209] -- 0:00:36 417500 -- (-1211.859) (-1217.240) (-1213.507) [-1212.787] * (-1213.992) [-1213.181] (-1211.882) (-1213.411) -- 0:00:36 418000 -- (-1213.168) (-1212.809) (-1210.541) [-1213.652] * (-1212.854) (-1211.745) [-1212.275] (-1212.791) -- 0:00:36 418500 -- (-1213.428) (-1213.221) [-1211.448] (-1214.012) * (-1211.198) [-1211.971] (-1212.102) (-1212.483) -- 0:00:37 419000 -- (-1211.449) (-1210.463) (-1211.339) [-1214.337] * (-1212.317) (-1212.515) (-1215.066) [-1213.364] -- 0:00:37 419500 -- [-1211.922] (-1214.874) (-1214.875) (-1214.157) * (-1211.074) [-1211.365] (-1212.552) (-1213.233) -- 0:00:37 420000 -- [-1211.944] (-1213.336) (-1213.536) (-1213.830) * (-1211.924) (-1216.873) [-1211.342] (-1212.926) -- 0:00:37 Average standard deviation of split frequencies: 0.012015 420500 -- (-1212.613) (-1211.617) (-1211.983) [-1211.190] * (-1211.924) [-1213.388] (-1211.765) (-1212.472) -- 0:00:37 421000 -- (-1211.805) (-1211.412) (-1213.363) [-1211.190] * (-1214.356) (-1215.132) (-1215.314) [-1213.276] -- 0:00:37 421500 -- (-1212.037) [-1210.797] (-1211.201) (-1211.313) * (-1213.531) (-1211.290) (-1211.655) [-1211.710] -- 0:00:37 422000 -- [-1211.725] (-1215.025) (-1211.114) (-1214.285) * [-1212.189] (-1213.819) (-1211.358) (-1211.880) -- 0:00:36 422500 -- (-1212.810) (-1212.241) [-1213.431] (-1214.757) * (-1214.437) (-1213.276) (-1213.738) [-1213.582] -- 0:00:36 423000 -- (-1212.184) [-1211.481] (-1212.498) (-1214.424) * (-1213.857) [-1210.820] (-1211.896) (-1211.592) -- 0:00:36 423500 -- (-1215.323) (-1211.009) (-1214.752) [-1210.952] * (-1211.591) [-1211.729] (-1212.419) (-1213.790) -- 0:00:36 424000 -- (-1214.297) (-1211.164) (-1212.448) [-1212.729] * (-1211.002) (-1211.719) [-1211.270] (-1214.881) -- 0:00:36 424500 -- [-1213.743] (-1211.613) (-1212.968) (-1212.621) * (-1211.208) [-1211.520] (-1212.018) (-1216.019) -- 0:00:36 425000 -- (-1213.679) (-1214.249) (-1213.240) [-1214.580] * (-1211.329) [-1212.117] (-1211.755) (-1213.659) -- 0:00:36 Average standard deviation of split frequencies: 0.011312 425500 -- (-1212.476) (-1216.852) [-1211.876] (-1213.552) * (-1211.052) (-1212.361) (-1211.264) [-1212.297] -- 0:00:36 426000 -- (-1213.867) (-1216.511) [-1210.609] (-1212.032) * (-1211.795) (-1213.352) [-1210.507] (-1213.099) -- 0:00:36 426500 -- (-1213.114) [-1212.099] (-1211.180) (-1212.584) * (-1210.587) (-1212.264) [-1211.161] (-1216.839) -- 0:00:36 427000 -- (-1213.040) (-1210.487) (-1210.645) [-1211.587] * (-1210.530) [-1211.386] (-1213.553) (-1213.208) -- 0:00:36 427500 -- (-1213.524) (-1211.750) (-1211.620) [-1211.069] * (-1211.953) [-1215.114] (-1212.390) (-1215.939) -- 0:00:36 428000 -- (-1213.122) (-1212.991) [-1212.624] (-1212.587) * (-1213.801) (-1210.795) (-1211.348) [-1215.079] -- 0:00:36 428500 -- (-1212.576) [-1211.193] (-1214.799) (-1213.855) * (-1218.520) (-1211.387) (-1211.931) [-1213.036] -- 0:00:36 429000 -- [-1213.764] (-1216.290) (-1216.123) (-1213.892) * [-1214.124] (-1213.270) (-1211.906) (-1212.127) -- 0:00:35 429500 -- (-1213.703) (-1214.365) [-1211.141] (-1210.799) * [-1216.064] (-1214.426) (-1211.751) (-1213.483) -- 0:00:35 430000 -- (-1212.309) [-1214.438] (-1211.400) (-1214.659) * [-1217.634] (-1215.945) (-1212.320) (-1211.877) -- 0:00:35 Average standard deviation of split frequencies: 0.010885 430500 -- [-1211.210] (-1211.627) (-1213.419) (-1212.019) * (-1213.340) (-1211.647) [-1212.452] (-1212.870) -- 0:00:35 431000 -- (-1212.523) (-1213.897) (-1215.142) [-1211.869] * (-1211.758) (-1210.568) (-1210.566) [-1210.869] -- 0:00:35 431500 -- (-1211.540) (-1214.932) (-1218.090) [-1214.329] * (-1213.495) (-1210.581) (-1212.485) [-1212.947] -- 0:00:35 432000 -- (-1214.642) [-1211.789] (-1218.567) (-1211.414) * (-1216.707) (-1210.867) (-1211.688) [-1210.443] -- 0:00:35 432500 -- [-1213.539] (-1212.172) (-1213.014) (-1212.463) * (-1215.529) (-1211.619) (-1216.192) [-1210.718] -- 0:00:35 433000 -- (-1210.464) (-1214.558) [-1214.742] (-1211.059) * (-1214.125) [-1214.842] (-1213.847) (-1211.847) -- 0:00:35 433500 -- (-1211.258) [-1212.114] (-1215.604) (-1212.108) * [-1210.876] (-1212.232) (-1214.050) (-1212.588) -- 0:00:35 434000 -- (-1214.676) (-1213.409) [-1212.072] (-1211.766) * (-1212.225) [-1211.703] (-1210.832) (-1215.574) -- 0:00:35 434500 -- (-1212.913) (-1211.934) [-1213.150] (-1211.300) * (-1213.348) (-1213.318) [-1212.154] (-1217.788) -- 0:00:36 435000 -- (-1216.173) (-1214.827) (-1215.364) [-1210.650] * (-1212.691) (-1211.205) [-1214.175] (-1211.921) -- 0:00:36 Average standard deviation of split frequencies: 0.010692 435500 -- (-1215.563) [-1211.979] (-1213.708) (-1212.387) * (-1215.958) (-1217.233) [-1213.916] (-1212.559) -- 0:00:36 436000 -- (-1214.245) (-1211.026) [-1214.896] (-1216.526) * [-1212.001] (-1214.189) (-1212.678) (-1212.418) -- 0:00:36 436500 -- (-1213.648) [-1213.022] (-1211.660) (-1211.382) * [-1214.169] (-1212.977) (-1212.665) (-1211.698) -- 0:00:36 437000 -- [-1214.929] (-1215.938) (-1211.452) (-1212.669) * (-1213.545) [-1212.173] (-1213.168) (-1217.279) -- 0:00:36 437500 -- (-1210.516) [-1215.881] (-1213.487) (-1211.669) * (-1213.401) [-1211.153] (-1212.701) (-1214.519) -- 0:00:36 438000 -- (-1214.838) [-1215.216] (-1214.635) (-1213.694) * [-1211.109] (-1215.673) (-1214.465) (-1211.775) -- 0:00:35 438500 -- (-1213.456) (-1212.566) (-1211.934) [-1213.330] * [-1212.329] (-1210.886) (-1214.117) (-1211.146) -- 0:00:35 439000 -- [-1211.050] (-1212.399) (-1212.864) (-1211.408) * (-1211.179) (-1214.375) [-1215.754] (-1213.858) -- 0:00:35 439500 -- (-1212.106) [-1211.235] (-1218.974) (-1212.537) * (-1211.651) (-1213.592) [-1210.896] (-1213.930) -- 0:00:35 440000 -- (-1211.062) [-1212.638] (-1211.041) (-1210.942) * (-1212.085) (-1213.707) [-1212.331] (-1211.999) -- 0:00:35 Average standard deviation of split frequencies: 0.009806 440500 -- [-1212.680] (-1212.166) (-1211.165) (-1211.336) * [-1211.228] (-1213.191) (-1212.998) (-1212.000) -- 0:00:35 441000 -- (-1212.708) (-1218.053) [-1212.064] (-1212.858) * [-1211.566] (-1214.061) (-1212.766) (-1214.155) -- 0:00:35 441500 -- (-1212.966) [-1211.690] (-1215.287) (-1212.656) * (-1212.603) (-1212.498) (-1212.811) [-1210.762] -- 0:00:35 442000 -- (-1211.668) [-1211.393] (-1211.170) (-1213.468) * (-1218.723) (-1211.816) (-1212.215) [-1211.957] -- 0:00:35 442500 -- [-1213.126] (-1212.482) (-1211.709) (-1215.788) * (-1214.045) [-1212.529] (-1211.356) (-1211.810) -- 0:00:35 443000 -- [-1210.734] (-1211.881) (-1211.877) (-1212.755) * (-1215.141) (-1211.367) [-1213.360] (-1214.040) -- 0:00:35 443500 -- [-1211.019] (-1212.501) (-1212.868) (-1212.554) * [-1211.093] (-1212.344) (-1212.661) (-1212.527) -- 0:00:35 444000 -- (-1210.937) (-1212.502) [-1214.521] (-1212.174) * (-1213.779) (-1212.860) [-1212.973] (-1213.330) -- 0:00:35 444500 -- (-1214.962) (-1210.145) [-1211.815] (-1215.355) * [-1212.683] (-1212.989) (-1217.767) (-1210.708) -- 0:00:34 445000 -- (-1215.613) (-1211.950) (-1216.892) [-1211.654] * [-1213.952] (-1211.303) (-1212.591) (-1212.319) -- 0:00:34 Average standard deviation of split frequencies: 0.009571 445500 -- [-1213.923] (-1214.543) (-1219.104) (-1211.361) * (-1211.837) (-1210.810) [-1211.787] (-1212.228) -- 0:00:34 446000 -- [-1211.998] (-1216.969) (-1213.852) (-1213.201) * (-1212.208) [-1210.327] (-1211.827) (-1217.893) -- 0:00:34 446500 -- (-1210.369) [-1211.654] (-1212.915) (-1211.439) * (-1213.662) [-1211.392] (-1212.755) (-1211.698) -- 0:00:34 447000 -- (-1211.689) (-1212.991) (-1211.715) [-1213.372] * (-1212.134) [-1214.104] (-1212.478) (-1211.665) -- 0:00:34 447500 -- (-1212.646) [-1210.942] (-1214.858) (-1211.916) * (-1211.981) [-1210.420] (-1213.636) (-1211.256) -- 0:00:34 448000 -- (-1216.472) (-1213.274) (-1213.192) [-1213.116] * [-1211.669] (-1211.181) (-1212.604) (-1211.908) -- 0:00:34 448500 -- (-1211.955) [-1211.419] (-1211.381) (-1213.609) * (-1211.265) [-1212.300] (-1211.262) (-1210.288) -- 0:00:34 449000 -- (-1210.442) (-1215.278) [-1211.834] (-1212.498) * (-1210.787) [-1217.412] (-1211.726) (-1212.657) -- 0:00:34 449500 -- (-1210.956) [-1213.326] (-1211.006) (-1213.725) * (-1213.406) (-1211.511) [-1211.655] (-1213.503) -- 0:00:34 450000 -- (-1212.399) [-1212.731] (-1214.198) (-1211.960) * (-1211.513) (-1212.278) [-1212.047] (-1211.207) -- 0:00:34 Average standard deviation of split frequencies: 0.009705 450500 -- [-1214.277] (-1212.174) (-1213.989) (-1213.152) * (-1211.581) [-1212.401] (-1212.657) (-1211.356) -- 0:00:35 451000 -- (-1213.039) (-1215.859) [-1212.977] (-1212.369) * [-1212.264] (-1211.859) (-1212.477) (-1213.374) -- 0:00:35 451500 -- (-1213.823) (-1211.356) (-1211.501) [-1213.288] * [-1211.984] (-1212.555) (-1211.227) (-1212.623) -- 0:00:35 452000 -- (-1211.190) (-1214.411) [-1211.613] (-1211.943) * [-1211.683] (-1214.690) (-1211.721) (-1212.642) -- 0:00:35 452500 -- (-1211.245) (-1210.360) [-1211.438] (-1214.039) * (-1211.467) [-1211.683] (-1214.902) (-1211.072) -- 0:00:35 453000 -- (-1217.491) [-1211.391] (-1213.898) (-1210.668) * (-1213.007) (-1213.237) [-1218.967] (-1214.394) -- 0:00:35 453500 -- (-1211.382) (-1211.501) (-1214.164) [-1210.674] * (-1216.581) (-1215.248) (-1213.723) [-1211.009] -- 0:00:34 454000 -- [-1215.735] (-1210.891) (-1216.139) (-1211.099) * (-1213.110) (-1213.659) (-1214.798) [-1210.997] -- 0:00:34 454500 -- (-1210.973) [-1215.202] (-1213.928) (-1216.128) * [-1211.632] (-1213.743) (-1213.722) (-1210.747) -- 0:00:34 455000 -- (-1211.064) (-1211.749) (-1211.771) [-1211.078] * [-1211.620] (-1214.333) (-1212.321) (-1212.283) -- 0:00:34 Average standard deviation of split frequencies: 0.009074 455500 -- (-1211.400) [-1213.530] (-1212.119) (-1210.307) * (-1212.865) [-1213.526] (-1216.432) (-1212.302) -- 0:00:34 456000 -- [-1211.457] (-1211.255) (-1211.078) (-1211.095) * (-1211.416) (-1212.689) [-1212.184] (-1213.148) -- 0:00:34 456500 -- (-1212.550) [-1210.667] (-1213.726) (-1211.601) * (-1215.457) (-1211.326) [-1211.140] (-1212.542) -- 0:00:34 457000 -- (-1214.368) (-1211.324) [-1213.475] (-1211.471) * (-1214.843) (-1212.677) [-1211.698] (-1212.436) -- 0:00:34 457500 -- (-1211.918) (-1214.660) [-1213.593] (-1212.320) * [-1211.559] (-1214.479) (-1213.248) (-1213.930) -- 0:00:34 458000 -- (-1215.376) (-1213.926) (-1213.990) [-1211.706] * (-1213.532) (-1213.025) [-1211.983] (-1212.586) -- 0:00:34 458500 -- [-1214.005] (-1213.276) (-1212.143) (-1211.815) * (-1210.998) (-1211.991) [-1210.954] (-1212.511) -- 0:00:34 459000 -- [-1213.283] (-1213.410) (-1213.024) (-1211.155) * (-1211.329) [-1212.832] (-1212.818) (-1211.697) -- 0:00:34 459500 -- (-1211.731) (-1212.850) [-1212.052] (-1212.718) * [-1212.033] (-1210.800) (-1214.061) (-1212.623) -- 0:00:34 460000 -- [-1211.553] (-1211.234) (-1210.896) (-1213.547) * (-1214.221) (-1211.997) (-1213.900) [-1217.163] -- 0:00:34 Average standard deviation of split frequencies: 0.008926 460500 -- (-1211.615) (-1212.604) (-1211.935) [-1214.015] * (-1212.513) [-1211.598] (-1211.302) (-1210.639) -- 0:00:33 461000 -- (-1211.568) (-1213.019) [-1212.920] (-1211.180) * [-1216.325] (-1219.739) (-1210.350) (-1210.775) -- 0:00:33 461500 -- [-1211.341] (-1211.121) (-1212.589) (-1211.603) * (-1212.040) [-1213.512] (-1210.405) (-1211.681) -- 0:00:33 462000 -- (-1213.419) (-1214.964) (-1214.363) [-1211.332] * (-1214.196) (-1213.066) (-1210.658) [-1212.925] -- 0:00:33 462500 -- (-1210.847) (-1211.648) [-1212.836] (-1211.869) * (-1211.007) (-1211.371) (-1216.656) [-1212.681] -- 0:00:33 463000 -- [-1211.858] (-1210.998) (-1214.337) (-1210.733) * (-1214.495) [-1211.707] (-1213.698) (-1212.242) -- 0:00:33 463500 -- (-1211.843) (-1210.678) (-1213.282) [-1213.038] * (-1215.457) [-1215.019] (-1214.093) (-1214.046) -- 0:00:33 464000 -- (-1210.960) (-1212.702) (-1216.478) [-1211.624] * [-1216.318] (-1216.671) (-1211.354) (-1213.863) -- 0:00:33 464500 -- [-1211.463] (-1212.492) (-1210.575) (-1211.156) * (-1213.037) (-1214.487) (-1211.354) [-1214.259] -- 0:00:33 465000 -- (-1212.373) (-1211.987) (-1211.517) [-1214.313] * [-1211.620] (-1213.658) (-1211.951) (-1212.049) -- 0:00:33 Average standard deviation of split frequencies: 0.008678 465500 -- (-1215.067) (-1214.871) [-1211.948] (-1213.666) * [-1211.501] (-1216.486) (-1212.710) (-1212.532) -- 0:00:33 466000 -- (-1217.706) (-1214.850) (-1211.365) [-1212.289] * [-1210.713] (-1212.816) (-1215.027) (-1214.632) -- 0:00:33 466500 -- (-1211.563) [-1214.255] (-1212.149) (-1213.064) * (-1212.145) (-1213.165) [-1212.453] (-1212.788) -- 0:00:33 467000 -- [-1212.614] (-1211.396) (-1214.285) (-1211.679) * (-1213.338) (-1214.587) [-1212.669] (-1215.564) -- 0:00:34 467500 -- [-1214.423] (-1212.843) (-1212.101) (-1212.232) * (-1213.992) (-1212.672) (-1217.872) [-1213.752] -- 0:00:34 468000 -- (-1211.878) (-1211.186) (-1215.220) [-1214.335] * (-1212.870) (-1214.633) (-1210.884) [-1212.099] -- 0:00:34 468500 -- (-1212.665) (-1214.370) [-1211.364] (-1211.073) * (-1211.934) (-1214.622) [-1210.993] (-1212.900) -- 0:00:34 469000 -- (-1212.451) [-1212.428] (-1211.152) (-1211.666) * (-1212.543) [-1212.271] (-1212.699) (-1211.861) -- 0:00:33 469500 -- (-1212.510) (-1213.380) (-1211.546) [-1214.173] * (-1214.391) [-1213.441] (-1215.104) (-1212.887) -- 0:00:33 470000 -- (-1212.059) [-1215.573] (-1213.165) (-1214.707) * (-1213.700) (-1220.510) [-1214.736] (-1211.953) -- 0:00:33 Average standard deviation of split frequencies: 0.008680 470500 -- (-1211.164) [-1210.509] (-1214.731) (-1217.802) * (-1214.861) (-1215.165) (-1216.041) [-1213.848] -- 0:00:33 471000 -- (-1211.168) (-1214.436) (-1210.708) [-1215.052] * (-1212.718) [-1212.181] (-1214.493) (-1212.764) -- 0:00:33 471500 -- (-1217.497) (-1216.166) [-1212.666] (-1211.318) * (-1212.912) [-1211.471] (-1212.053) (-1211.726) -- 0:00:33 472000 -- (-1212.742) (-1212.875) (-1212.170) [-1210.901] * [-1212.710] (-1211.756) (-1213.125) (-1213.198) -- 0:00:33 472500 -- (-1214.278) (-1213.661) (-1211.337) [-1210.675] * (-1212.414) [-1212.809] (-1213.019) (-1212.273) -- 0:00:33 473000 -- [-1214.066] (-1213.709) (-1215.079) (-1211.971) * (-1213.739) (-1211.612) [-1214.950] (-1211.354) -- 0:00:33 473500 -- (-1212.131) [-1212.335] (-1212.546) (-1212.817) * (-1212.028) [-1211.629] (-1211.163) (-1211.458) -- 0:00:33 474000 -- (-1211.764) (-1210.946) (-1211.111) [-1212.344] * (-1215.114) (-1214.053) (-1213.962) [-1213.274] -- 0:00:33 474500 -- (-1216.055) (-1211.241) [-1212.375] (-1212.683) * (-1212.347) [-1210.996] (-1212.448) (-1213.608) -- 0:00:33 475000 -- [-1210.844] (-1211.436) (-1217.857) (-1212.347) * (-1212.967) (-1216.469) [-1214.267] (-1215.743) -- 0:00:33 Average standard deviation of split frequencies: 0.008098 475500 -- (-1216.617) (-1211.929) (-1212.811) [-1211.165] * [-1210.690] (-1213.182) (-1212.833) (-1213.023) -- 0:00:33 476000 -- (-1216.521) (-1210.784) [-1213.964] (-1211.009) * (-1212.748) (-1214.730) (-1211.478) [-1213.719] -- 0:00:33 476500 -- [-1213.163] (-1211.481) (-1214.428) (-1211.710) * (-1211.334) [-1212.278] (-1211.541) (-1210.977) -- 0:00:32 477000 -- (-1215.686) (-1212.844) (-1212.963) [-1215.847] * (-1218.519) (-1212.872) (-1212.294) [-1210.336] -- 0:00:32 477500 -- (-1211.701) (-1211.210) (-1212.916) [-1211.924] * (-1214.394) (-1211.256) (-1212.883) [-1210.763] -- 0:00:32 478000 -- (-1211.844) [-1212.009] (-1215.213) (-1214.590) * (-1214.986) (-1213.368) [-1211.933] (-1211.907) -- 0:00:32 478500 -- (-1211.344) (-1216.689) [-1213.551] (-1211.984) * (-1215.744) [-1212.149] (-1211.519) (-1210.859) -- 0:00:32 479000 -- (-1214.362) (-1216.287) [-1211.319] (-1211.478) * [-1214.389] (-1211.602) (-1211.827) (-1210.571) -- 0:00:32 479500 -- (-1214.804) (-1213.996) (-1211.346) [-1212.516] * (-1214.211) (-1214.226) [-1215.754] (-1211.958) -- 0:00:32 480000 -- [-1210.687] (-1211.435) (-1212.216) (-1211.316) * (-1216.606) (-1214.330) (-1211.690) [-1211.515] -- 0:00:32 Average standard deviation of split frequencies: 0.007846 480500 -- (-1211.587) (-1212.433) (-1211.814) [-1210.688] * (-1216.372) (-1215.065) [-1210.550] (-1216.803) -- 0:00:32 481000 -- (-1210.424) (-1214.538) [-1213.929] (-1212.456) * (-1211.129) (-1213.166) (-1212.057) [-1215.073] -- 0:00:32 481500 -- [-1212.987] (-1215.133) (-1214.028) (-1210.743) * [-1211.460] (-1210.992) (-1213.555) (-1213.938) -- 0:00:32 482000 -- [-1211.837] (-1212.979) (-1215.238) (-1212.500) * (-1214.606) (-1212.193) (-1214.549) [-1214.613] -- 0:00:32 482500 -- (-1213.903) (-1213.368) [-1214.202] (-1211.937) * (-1212.673) [-1212.646] (-1215.914) (-1211.566) -- 0:00:32 483000 -- (-1214.384) (-1212.143) (-1212.296) [-1212.941] * (-1213.437) (-1210.717) [-1213.080] (-1211.456) -- 0:00:33 483500 -- (-1213.627) (-1210.905) (-1212.757) [-1212.181] * (-1213.253) (-1211.374) [-1213.005] (-1211.624) -- 0:00:33 484000 -- (-1212.025) (-1212.303) (-1213.252) [-1213.264] * (-1212.660) (-1212.278) (-1212.976) [-1212.485] -- 0:00:33 484500 -- [-1214.110] (-1214.963) (-1212.479) (-1213.260) * [-1212.164] (-1214.017) (-1212.172) (-1213.142) -- 0:00:32 485000 -- (-1212.638) [-1211.732] (-1211.143) (-1212.905) * (-1211.513) [-1213.769] (-1211.537) (-1215.390) -- 0:00:32 Average standard deviation of split frequencies: 0.008844 485500 -- (-1213.397) (-1216.284) (-1211.637) [-1212.509] * [-1210.478] (-1213.287) (-1211.536) (-1215.907) -- 0:00:32 486000 -- (-1212.838) (-1214.103) (-1212.824) [-1211.320] * (-1211.722) (-1212.984) [-1210.703] (-1212.847) -- 0:00:32 486500 -- [-1213.359] (-1214.087) (-1210.789) (-1211.014) * (-1212.629) (-1211.113) (-1210.731) [-1212.643] -- 0:00:32 487000 -- (-1211.655) (-1210.987) [-1210.523] (-1215.221) * (-1213.267) [-1212.411] (-1212.448) (-1215.489) -- 0:00:32 487500 -- (-1211.759) (-1210.988) [-1212.146] (-1212.473) * (-1211.624) [-1211.804] (-1211.239) (-1215.013) -- 0:00:32 488000 -- (-1210.731) (-1210.784) [-1210.673] (-1212.139) * [-1212.981] (-1211.208) (-1213.548) (-1211.322) -- 0:00:32 488500 -- [-1210.683] (-1213.841) (-1210.869) (-1210.619) * (-1212.677) (-1211.723) [-1210.811] (-1211.204) -- 0:00:32 489000 -- (-1211.880) (-1212.436) [-1210.883] (-1210.226) * [-1214.172] (-1211.929) (-1210.578) (-1212.707) -- 0:00:32 489500 -- [-1211.127] (-1213.020) (-1211.366) (-1214.947) * (-1213.769) [-1216.131] (-1217.487) (-1215.120) -- 0:00:32 490000 -- (-1211.463) (-1217.072) (-1213.714) [-1211.048] * (-1215.638) (-1212.430) [-1212.974] (-1216.378) -- 0:00:32 Average standard deviation of split frequencies: 0.009664 490500 -- (-1211.153) [-1214.391] (-1214.273) (-1211.665) * (-1212.206) [-1213.232] (-1212.950) (-1216.294) -- 0:00:32 491000 -- (-1212.748) (-1213.162) [-1212.003] (-1210.883) * (-1212.086) (-1214.577) [-1216.617] (-1216.278) -- 0:00:32 491500 -- (-1214.012) (-1212.914) (-1213.265) [-1211.212] * (-1214.214) (-1210.968) (-1212.406) [-1212.437] -- 0:00:32 492000 -- (-1210.893) (-1215.149) [-1210.811] (-1211.260) * (-1212.835) (-1212.230) (-1214.713) [-1210.428] -- 0:00:32 492500 -- (-1211.778) [-1213.600] (-1210.812) (-1211.509) * [-1212.394] (-1215.549) (-1213.130) (-1210.749) -- 0:00:31 493000 -- (-1211.903) (-1212.567) [-1212.706] (-1211.930) * (-1210.828) [-1211.715] (-1214.366) (-1212.097) -- 0:00:31 493500 -- (-1211.661) (-1211.344) [-1211.414] (-1211.908) * [-1211.775] (-1211.711) (-1214.455) (-1211.698) -- 0:00:31 494000 -- (-1210.662) [-1211.293] (-1210.632) (-1212.195) * (-1212.335) [-1212.785] (-1212.692) (-1212.086) -- 0:00:31 494500 -- (-1210.899) [-1211.161] (-1217.100) (-1212.658) * [-1211.419] (-1212.622) (-1215.150) (-1211.664) -- 0:00:31 495000 -- (-1211.662) (-1212.437) (-1212.044) [-1217.385] * (-1214.477) (-1213.599) (-1214.460) [-1212.618] -- 0:00:31 Average standard deviation of split frequencies: 0.009169 495500 -- (-1213.086) [-1210.373] (-1210.862) (-1214.628) * (-1214.030) (-1212.757) (-1216.691) [-1213.878] -- 0:00:31 496000 -- (-1213.093) [-1211.127] (-1213.236) (-1215.639) * (-1214.122) [-1212.019] (-1217.107) (-1213.952) -- 0:00:31 496500 -- (-1211.664) (-1210.623) [-1213.974] (-1216.330) * (-1217.862) (-1216.062) (-1211.039) [-1211.171] -- 0:00:31 497000 -- (-1212.056) [-1210.674] (-1211.331) (-1211.264) * (-1215.064) [-1214.308] (-1211.207) (-1211.582) -- 0:00:31 497500 -- (-1213.239) (-1212.633) [-1211.317] (-1212.504) * (-1215.660) [-1210.773] (-1213.776) (-1211.909) -- 0:00:31 498000 -- (-1213.477) (-1213.715) (-1212.566) [-1211.777] * (-1213.858) [-1212.969] (-1213.533) (-1212.398) -- 0:00:31 498500 -- (-1213.482) (-1214.703) [-1214.445] (-1210.931) * (-1212.340) (-1211.423) (-1212.137) [-1211.718] -- 0:00:31 499000 -- (-1216.290) (-1211.427) [-1215.723] (-1211.837) * (-1211.399) [-1210.746] (-1216.181) (-1213.947) -- 0:00:31 499500 -- (-1215.805) (-1211.511) (-1214.833) [-1213.073] * (-1211.087) (-1211.305) (-1217.174) [-1212.075] -- 0:00:32 500000 -- (-1216.432) (-1213.315) [-1210.654] (-1212.319) * (-1210.903) (-1211.025) (-1216.850) [-1211.270] -- 0:00:32 Average standard deviation of split frequencies: 0.008892 500500 -- (-1216.408) (-1211.960) [-1210.633] (-1213.773) * (-1210.894) [-1213.376] (-1214.310) (-1214.402) -- 0:00:31 501000 -- (-1212.824) (-1212.624) (-1214.474) [-1211.257] * [-1211.662] (-1218.947) (-1214.032) (-1211.793) -- 0:00:31 501500 -- (-1211.279) (-1214.443) (-1215.777) [-1212.826] * [-1211.008] (-1218.494) (-1214.646) (-1211.500) -- 0:00:31 502000 -- (-1211.171) (-1212.869) [-1213.280] (-1213.302) * (-1216.843) [-1212.405] (-1211.636) (-1214.632) -- 0:00:31 502500 -- (-1217.146) [-1211.193] (-1213.781) (-1211.706) * (-1215.520) (-1211.444) (-1217.535) [-1213.069] -- 0:00:31 503000 -- [-1213.468] (-1211.337) (-1216.086) (-1213.676) * [-1212.317] (-1211.408) (-1213.377) (-1211.899) -- 0:00:31 503500 -- (-1211.610) (-1211.278) (-1214.316) [-1212.586] * (-1210.617) [-1211.968] (-1210.974) (-1214.611) -- 0:00:31 504000 -- (-1213.074) (-1211.780) [-1210.929] (-1213.616) * (-1212.399) [-1213.543] (-1211.402) (-1211.761) -- 0:00:31 504500 -- (-1212.982) (-1210.834) (-1213.125) [-1212.244] * (-1219.361) [-1214.351] (-1213.585) (-1211.202) -- 0:00:31 505000 -- (-1211.499) (-1211.265) [-1213.661] (-1211.813) * (-1212.530) [-1212.194] (-1211.432) (-1215.524) -- 0:00:31 Average standard deviation of split frequencies: 0.008333 505500 -- (-1211.275) [-1211.514] (-1212.281) (-1211.274) * (-1211.437) (-1214.032) [-1212.579] (-1211.793) -- 0:00:31 506000 -- (-1210.307) [-1211.595] (-1213.644) (-1210.488) * (-1212.016) (-1211.483) [-1212.599] (-1211.400) -- 0:00:31 506500 -- (-1213.301) [-1211.049] (-1216.467) (-1211.126) * (-1213.156) (-1212.034) (-1218.523) [-1212.445] -- 0:00:31 507000 -- (-1214.125) (-1213.054) (-1214.117) [-1212.626] * (-1212.046) (-1212.411) [-1215.553] (-1216.044) -- 0:00:31 507500 -- (-1213.540) [-1212.817] (-1210.991) (-1211.035) * [-1213.095] (-1214.235) (-1213.055) (-1211.201) -- 0:00:31 508000 -- (-1211.416) (-1214.537) (-1210.791) [-1213.297] * (-1211.588) (-1211.268) (-1213.218) [-1212.136] -- 0:00:30 508500 -- (-1214.721) (-1217.477) (-1211.648) [-1211.973] * (-1212.232) (-1212.032) [-1212.291] (-1213.328) -- 0:00:30 509000 -- (-1210.672) (-1216.123) [-1212.335] (-1215.339) * (-1212.316) (-1211.483) [-1212.055] (-1213.347) -- 0:00:30 509500 -- (-1213.562) (-1215.796) [-1217.298] (-1214.981) * (-1212.092) (-1215.206) [-1211.913] (-1213.363) -- 0:00:30 510000 -- [-1213.084] (-1211.310) (-1218.821) (-1213.357) * [-1211.242] (-1214.768) (-1211.344) (-1212.973) -- 0:00:30 Average standard deviation of split frequencies: 0.007494 510500 -- [-1211.500] (-1213.329) (-1214.994) (-1212.155) * (-1213.241) [-1213.503] (-1212.063) (-1211.848) -- 0:00:30 511000 -- (-1213.626) (-1211.490) (-1214.690) [-1212.476] * (-1211.683) (-1217.021) (-1212.895) [-1211.459] -- 0:00:30 511500 -- (-1215.610) (-1211.483) (-1212.867) [-1211.929] * (-1211.730) (-1214.126) [-1211.080] (-1213.961) -- 0:00:30 512000 -- (-1212.438) [-1210.401] (-1212.262) (-1212.030) * (-1211.670) (-1215.239) [-1211.261] (-1211.635) -- 0:00:30 512500 -- [-1212.525] (-1212.988) (-1211.439) (-1213.127) * (-1214.366) (-1213.981) (-1210.588) [-1210.691] -- 0:00:30 513000 -- (-1214.247) [-1211.598] (-1211.380) (-1213.021) * (-1211.334) (-1213.829) (-1214.302) [-1212.406] -- 0:00:30 513500 -- (-1214.464) [-1213.556] (-1212.789) (-1213.009) * (-1211.116) (-1217.343) (-1212.318) [-1214.988] -- 0:00:30 514000 -- (-1213.975) (-1212.625) [-1211.832] (-1213.600) * [-1213.282] (-1218.165) (-1215.175) (-1212.007) -- 0:00:30 514500 -- (-1210.721) [-1211.570] (-1216.199) (-1214.075) * (-1212.581) (-1217.278) [-1212.125] (-1213.004) -- 0:00:30 515000 -- (-1211.223) (-1211.827) [-1215.254] (-1213.274) * (-1214.030) (-1215.998) (-1212.880) [-1211.668] -- 0:00:31 Average standard deviation of split frequencies: 0.007362 515500 -- (-1212.201) (-1211.700) [-1216.744] (-1212.993) * (-1212.007) (-1212.280) [-1212.033] (-1212.430) -- 0:00:31 516000 -- (-1212.306) (-1214.377) [-1215.442] (-1213.296) * [-1213.269] (-1212.046) (-1212.589) (-1212.479) -- 0:00:30 516500 -- (-1213.845) (-1216.609) [-1211.862] (-1215.836) * [-1212.961] (-1211.198) (-1213.074) (-1212.339) -- 0:00:30 517000 -- (-1214.710) (-1212.800) [-1213.090] (-1214.440) * (-1213.355) (-1211.735) (-1211.133) [-1211.571] -- 0:00:30 517500 -- (-1215.977) [-1210.559] (-1211.756) (-1217.593) * (-1214.931) (-1211.252) (-1211.745) [-1212.329] -- 0:00:30 518000 -- (-1211.332) (-1216.301) (-1212.978) [-1212.637] * (-1212.293) [-1210.607] (-1211.724) (-1211.492) -- 0:00:30 518500 -- (-1211.027) (-1212.030) (-1214.322) [-1214.207] * (-1212.717) [-1211.076] (-1211.896) (-1213.241) -- 0:00:30 519000 -- [-1214.111] (-1211.320) (-1215.058) (-1212.397) * [-1214.853] (-1211.354) (-1211.594) (-1210.449) -- 0:00:30 519500 -- (-1213.841) (-1210.546) (-1216.208) [-1213.333] * (-1212.972) (-1213.148) [-1211.310] (-1212.546) -- 0:00:30 520000 -- (-1216.912) (-1211.490) [-1214.608] (-1210.782) * (-1212.605) (-1211.060) [-1211.470] (-1214.123) -- 0:00:30 Average standard deviation of split frequencies: 0.007509 520500 -- (-1212.890) (-1210.702) [-1213.730] (-1212.006) * (-1212.115) (-1214.915) [-1214.762] (-1216.864) -- 0:00:30 521000 -- (-1212.138) (-1213.896) [-1213.299] (-1216.977) * (-1212.858) [-1214.380] (-1216.169) (-1216.323) -- 0:00:30 521500 -- (-1210.785) (-1212.966) [-1211.762] (-1214.724) * (-1212.306) (-1211.297) [-1213.550] (-1214.729) -- 0:00:30 522000 -- (-1210.729) (-1213.736) (-1216.742) [-1215.101] * [-1213.900] (-1212.761) (-1213.086) (-1210.825) -- 0:00:30 522500 -- [-1212.573] (-1211.676) (-1213.488) (-1212.148) * (-1213.086) (-1213.825) (-1212.683) [-1212.049] -- 0:00:30 523000 -- (-1213.222) (-1210.547) (-1213.094) [-1211.355] * (-1212.659) (-1214.771) (-1220.316) [-1211.587] -- 0:00:30 523500 -- (-1213.793) (-1212.735) [-1211.100] (-1213.262) * [-1213.009] (-1211.216) (-1213.495) (-1212.099) -- 0:00:30 524000 -- (-1215.006) (-1212.458) [-1214.040] (-1212.310) * (-1214.931) (-1217.202) (-1215.062) [-1213.161] -- 0:00:29 524500 -- (-1212.169) (-1211.420) [-1218.652] (-1212.417) * (-1213.902) (-1213.098) (-1212.215) [-1210.707] -- 0:00:29 525000 -- (-1210.910) [-1212.086] (-1212.615) (-1212.899) * (-1210.896) (-1216.581) (-1211.328) [-1211.532] -- 0:00:29 Average standard deviation of split frequencies: 0.007170 525500 -- [-1210.706] (-1210.668) (-1212.576) (-1215.399) * [-1211.965] (-1212.046) (-1211.837) (-1215.136) -- 0:00:29 526000 -- (-1212.624) (-1211.355) (-1213.742) [-1211.523] * (-1212.798) (-1213.700) (-1210.885) [-1212.740] -- 0:00:29 526500 -- (-1214.381) (-1211.566) [-1215.042] (-1211.699) * (-1218.945) (-1211.401) [-1210.885] (-1215.505) -- 0:00:29 527000 -- (-1211.384) (-1211.077) (-1212.817) [-1211.041] * (-1217.461) (-1211.586) (-1210.883) [-1215.546] -- 0:00:29 527500 -- (-1211.503) (-1216.519) [-1213.641] (-1210.360) * (-1215.575) (-1210.788) (-1213.796) [-1216.976] -- 0:00:29 528000 -- (-1211.470) [-1211.594] (-1212.739) (-1210.360) * (-1214.579) (-1213.373) [-1212.883] (-1212.570) -- 0:00:29 528500 -- (-1214.461) [-1211.915] (-1210.891) (-1210.687) * [-1210.991] (-1212.283) (-1216.134) (-1213.489) -- 0:00:29 529000 -- (-1214.016) [-1212.150] (-1211.327) (-1213.916) * (-1211.305) [-1212.138] (-1212.260) (-1215.853) -- 0:00:29 529500 -- (-1211.528) (-1211.477) (-1210.624) [-1213.709] * (-1212.507) (-1211.701) [-1210.832] (-1216.589) -- 0:00:29 530000 -- (-1215.670) [-1212.224] (-1210.881) (-1212.982) * [-1212.233] (-1212.069) (-1213.582) (-1212.140) -- 0:00:29 Average standard deviation of split frequencies: 0.007734 530500 -- (-1215.894) (-1210.679) [-1212.302] (-1212.079) * (-1215.837) (-1214.311) (-1213.262) [-1212.347] -- 0:00:29 531000 -- (-1211.462) (-1210.711) [-1212.376] (-1211.738) * (-1215.647) (-1211.582) (-1211.578) [-1214.953] -- 0:00:29 531500 -- (-1212.560) (-1212.004) (-1213.287) [-1213.852] * (-1213.857) (-1213.284) (-1211.271) [-1210.407] -- 0:00:29 532000 -- (-1212.872) [-1211.639] (-1213.230) (-1210.623) * (-1213.189) (-1214.888) (-1215.216) [-1211.369] -- 0:00:29 532500 -- (-1213.230) (-1213.852) (-1214.288) [-1210.971] * (-1214.005) [-1212.889] (-1211.848) (-1212.825) -- 0:00:29 533000 -- [-1212.912] (-1212.332) (-1215.282) (-1212.285) * (-1211.540) (-1212.534) [-1212.176] (-1212.453) -- 0:00:29 533500 -- (-1211.516) (-1213.993) (-1212.265) [-1213.907] * (-1212.980) (-1213.758) (-1212.839) [-1215.177] -- 0:00:29 534000 -- [-1212.096] (-1214.928) (-1213.618) (-1212.821) * (-1210.748) (-1212.146) (-1212.195) [-1211.375] -- 0:00:29 534500 -- (-1215.330) (-1216.397) (-1211.952) [-1214.345] * [-1211.169] (-1211.761) (-1211.027) (-1211.603) -- 0:00:29 535000 -- (-1212.259) [-1216.522] (-1216.223) (-1214.023) * (-1212.030) (-1212.489) (-1211.016) [-1212.456] -- 0:00:29 Average standard deviation of split frequencies: 0.007531 535500 -- (-1211.346) (-1210.644) [-1212.486] (-1214.590) * (-1212.297) [-1212.540] (-1212.051) (-1215.604) -- 0:00:29 536000 -- (-1211.065) (-1211.697) (-1211.964) [-1211.632] * (-1218.332) (-1213.858) (-1215.124) [-1215.206] -- 0:00:29 536500 -- (-1212.077) (-1210.683) (-1218.848) [-1211.091] * (-1212.523) [-1211.636] (-1212.506) (-1211.580) -- 0:00:29 537000 -- [-1210.372] (-1212.692) (-1214.408) (-1215.318) * (-1212.545) (-1210.810) (-1212.047) [-1212.275] -- 0:00:29 537500 -- [-1210.454] (-1210.900) (-1214.921) (-1212.193) * (-1212.462) [-1210.494] (-1212.042) (-1213.814) -- 0:00:29 538000 -- [-1210.485] (-1210.844) (-1217.446) (-1213.430) * (-1215.580) (-1212.423) [-1214.042] (-1214.273) -- 0:00:29 538500 -- [-1210.331] (-1211.246) (-1213.971) (-1214.712) * (-1215.376) (-1212.042) (-1212.535) [-1210.474] -- 0:00:29 539000 -- [-1212.292] (-1211.294) (-1212.273) (-1212.605) * (-1211.668) (-1211.771) (-1212.271) [-1212.667] -- 0:00:29 539500 -- (-1213.981) [-1211.108] (-1212.011) (-1214.858) * (-1211.820) (-1213.709) (-1212.976) [-1210.384] -- 0:00:29 540000 -- [-1212.993] (-1210.919) (-1212.132) (-1216.237) * (-1217.616) [-1214.102] (-1214.114) (-1210.299) -- 0:00:28 Average standard deviation of split frequencies: 0.006921 540500 -- (-1211.869) (-1210.531) (-1215.190) [-1212.362] * (-1214.140) (-1211.580) [-1211.725] (-1210.713) -- 0:00:28 541000 -- (-1211.859) (-1210.865) [-1214.978] (-1214.873) * (-1215.399) (-1212.470) [-1211.184] (-1211.221) -- 0:00:28 541500 -- (-1212.249) (-1210.566) [-1212.901] (-1211.835) * (-1212.700) (-1213.259) (-1211.557) [-1212.968] -- 0:00:28 542000 -- (-1211.539) (-1210.466) (-1212.722) [-1211.355] * (-1214.930) (-1211.962) (-1213.627) [-1212.258] -- 0:00:28 542500 -- (-1211.883) [-1214.003] (-1212.426) (-1212.409) * (-1210.785) (-1210.834) (-1213.090) [-1211.508] -- 0:00:28 543000 -- [-1211.142] (-1215.139) (-1211.097) (-1215.953) * (-1211.906) [-1214.614] (-1217.801) (-1215.464) -- 0:00:28 543500 -- [-1212.316] (-1210.908) (-1211.337) (-1212.193) * (-1212.890) [-1211.902] (-1215.040) (-1211.063) -- 0:00:28 544000 -- (-1213.467) (-1214.503) [-1211.467] (-1211.250) * (-1213.397) [-1212.237] (-1216.004) (-1210.628) -- 0:00:28 544500 -- (-1213.209) (-1214.358) [-1212.147] (-1214.136) * [-1212.698] (-1213.519) (-1217.021) (-1210.927) -- 0:00:28 545000 -- (-1211.468) (-1214.085) (-1211.179) [-1210.604] * (-1211.589) [-1210.725] (-1215.813) (-1213.217) -- 0:00:28 Average standard deviation of split frequencies: 0.007059 545500 -- (-1213.292) [-1211.360] (-1210.856) (-1212.555) * (-1214.479) [-1210.577] (-1215.135) (-1212.766) -- 0:00:28 546000 -- (-1214.757) (-1210.677) (-1215.075) [-1217.334] * (-1214.382) (-1210.860) (-1213.401) [-1212.102] -- 0:00:28 546500 -- [-1214.799] (-1210.692) (-1214.870) (-1211.063) * (-1214.521) [-1212.080] (-1214.881) (-1211.468) -- 0:00:28 547000 -- (-1214.058) [-1213.355] (-1211.955) (-1211.017) * [-1210.767] (-1213.392) (-1212.999) (-1212.567) -- 0:00:28 547500 -- (-1216.182) (-1212.393) [-1212.278] (-1213.687) * (-1212.086) (-1214.704) (-1215.552) [-1210.836] -- 0:00:28 548000 -- (-1212.906) (-1215.045) (-1211.703) [-1213.608] * (-1213.460) (-1211.808) (-1212.535) [-1211.540] -- 0:00:28 548500 -- [-1211.637] (-1212.070) (-1212.426) (-1210.953) * (-1211.912) (-1211.509) (-1212.601) [-1213.590] -- 0:00:28 549000 -- (-1212.349) (-1215.538) (-1211.425) [-1212.989] * (-1210.694) (-1211.973) [-1215.292] (-1211.253) -- 0:00:28 549500 -- (-1213.433) (-1213.917) [-1212.044] (-1213.777) * (-1212.437) (-1218.151) [-1213.376] (-1211.491) -- 0:00:28 550000 -- [-1212.918] (-1216.553) (-1211.862) (-1215.207) * (-1214.502) [-1214.343] (-1218.002) (-1213.672) -- 0:00:28 Average standard deviation of split frequencies: 0.006899 550500 -- [-1210.323] (-1213.794) (-1213.360) (-1212.492) * (-1211.775) (-1211.797) (-1221.267) [-1211.126] -- 0:00:28 551000 -- (-1210.323) (-1210.870) [-1213.931] (-1211.762) * (-1211.872) [-1212.403] (-1212.491) (-1212.317) -- 0:00:28 551500 -- (-1210.391) (-1211.835) (-1214.345) [-1213.771] * (-1213.182) (-1214.478) [-1211.495] (-1214.582) -- 0:00:28 552000 -- [-1212.917] (-1210.523) (-1215.007) (-1213.650) * (-1212.310) (-1212.022) (-1214.306) [-1210.859] -- 0:00:28 552500 -- (-1211.427) (-1210.566) [-1213.142] (-1211.041) * (-1212.538) [-1211.650] (-1215.190) (-1211.464) -- 0:00:28 553000 -- (-1213.523) [-1215.299] (-1211.899) (-1215.096) * (-1213.070) (-1213.379) (-1212.477) [-1212.975] -- 0:00:28 553500 -- (-1213.979) [-1212.268] (-1212.445) (-1215.378) * (-1214.753) [-1214.297] (-1210.742) (-1211.230) -- 0:00:28 554000 -- [-1214.990] (-1211.391) (-1212.999) (-1211.178) * (-1212.085) (-1216.055) [-1210.360] (-1213.176) -- 0:00:28 554500 -- (-1213.421) (-1210.642) [-1213.268] (-1212.276) * [-1212.561] (-1212.471) (-1212.387) (-1212.898) -- 0:00:28 555000 -- (-1212.419) [-1213.998] (-1213.280) (-1218.106) * [-1212.475] (-1211.773) (-1212.042) (-1214.228) -- 0:00:28 Average standard deviation of split frequencies: 0.007431 555500 -- (-1214.224) (-1211.061) [-1213.641] (-1212.413) * (-1211.442) (-1211.394) [-1216.715] (-1215.083) -- 0:00:28 556000 -- (-1212.344) (-1211.974) [-1211.978] (-1212.675) * [-1212.867] (-1212.717) (-1211.528) (-1213.886) -- 0:00:27 556500 -- (-1210.577) (-1211.381) [-1210.770] (-1213.676) * (-1211.042) (-1214.764) [-1210.683] (-1221.140) -- 0:00:27 557000 -- [-1212.299] (-1212.581) (-1210.702) (-1211.213) * (-1212.022) (-1211.248) (-1210.683) [-1221.911] -- 0:00:27 557500 -- (-1211.491) (-1215.224) (-1211.758) [-1210.842] * (-1218.308) [-1213.440] (-1210.660) (-1216.835) -- 0:00:27 558000 -- (-1214.478) [-1211.809] (-1211.121) (-1213.795) * (-1210.514) (-1212.631) [-1211.585] (-1214.072) -- 0:00:27 558500 -- (-1213.028) (-1211.012) [-1211.206] (-1214.232) * (-1211.211) (-1211.666) (-1215.593) [-1215.413] -- 0:00:27 559000 -- (-1212.309) (-1213.097) (-1212.867) [-1212.287] * [-1213.976] (-1212.760) (-1212.486) (-1219.538) -- 0:00:27 559500 -- [-1213.075] (-1213.606) (-1210.657) (-1211.518) * (-1214.574) (-1213.609) [-1212.592] (-1213.918) -- 0:00:27 560000 -- [-1211.808] (-1214.604) (-1210.838) (-1210.787) * (-1213.859) [-1210.781] (-1214.215) (-1212.662) -- 0:00:27 Average standard deviation of split frequencies: 0.007518 560500 -- [-1214.122] (-1210.319) (-1212.839) (-1210.794) * (-1210.661) (-1215.629) [-1218.303] (-1217.323) -- 0:00:27 561000 -- (-1214.489) (-1211.540) (-1210.896) [-1211.794] * [-1212.217] (-1211.408) (-1215.239) (-1217.158) -- 0:00:27 561500 -- (-1212.793) (-1211.462) (-1212.234) [-1211.258] * (-1212.175) (-1211.198) [-1212.780] (-1212.490) -- 0:00:27 562000 -- [-1212.795] (-1211.603) (-1211.872) (-1210.846) * (-1212.678) (-1211.024) (-1211.601) [-1212.933] -- 0:00:27 562500 -- [-1211.935] (-1211.742) (-1212.844) (-1214.815) * [-1213.124] (-1211.952) (-1216.274) (-1215.315) -- 0:00:27 563000 -- [-1213.046] (-1211.834) (-1215.955) (-1210.630) * (-1211.302) [-1210.997] (-1213.661) (-1213.287) -- 0:00:27 563500 -- (-1214.038) (-1212.417) (-1211.740) [-1213.549] * [-1212.727] (-1213.390) (-1212.962) (-1212.402) -- 0:00:27 564000 -- [-1212.828] (-1212.462) (-1211.975) (-1211.261) * (-1212.395) (-1211.436) (-1213.292) [-1212.077] -- 0:00:27 564500 -- (-1213.187) (-1211.648) (-1211.906) [-1213.349] * (-1213.117) (-1212.163) (-1213.530) [-1213.511] -- 0:00:27 565000 -- (-1212.961) [-1211.487] (-1211.394) (-1211.511) * (-1212.379) (-1212.873) [-1211.273] (-1210.909) -- 0:00:27 Average standard deviation of split frequencies: 0.007006 565500 -- (-1213.023) (-1210.674) [-1212.321] (-1212.504) * (-1215.648) (-1211.541) [-1212.615] (-1212.847) -- 0:00:27 566000 -- (-1212.583) (-1211.947) (-1211.175) [-1214.606] * (-1213.346) (-1213.710) (-1213.283) [-1215.201] -- 0:00:27 566500 -- (-1216.216) (-1210.245) [-1214.304] (-1210.525) * (-1214.539) [-1211.836] (-1212.159) (-1213.342) -- 0:00:27 567000 -- [-1211.633] (-1211.873) (-1215.412) (-1215.358) * (-1215.532) [-1214.224] (-1212.360) (-1213.504) -- 0:00:27 567500 -- (-1211.068) [-1211.554] (-1212.654) (-1213.638) * (-1212.991) [-1214.651] (-1213.078) (-1211.068) -- 0:00:27 568000 -- (-1211.767) [-1213.475] (-1211.635) (-1218.117) * (-1211.456) [-1212.413] (-1212.536) (-1211.831) -- 0:00:27 568500 -- (-1212.032) (-1212.568) [-1210.761] (-1212.039) * (-1212.438) [-1211.402] (-1212.553) (-1213.362) -- 0:00:27 569000 -- (-1213.166) (-1211.501) (-1211.081) [-1210.411] * (-1211.323) (-1212.323) [-1212.416] (-1211.203) -- 0:00:27 569500 -- (-1212.403) (-1211.007) (-1212.285) [-1210.541] * (-1211.621) (-1216.008) (-1213.396) [-1213.773] -- 0:00:27 570000 -- (-1212.144) (-1212.861) [-1211.948] (-1211.581) * (-1215.432) [-1213.370] (-1213.636) (-1215.179) -- 0:00:27 Average standard deviation of split frequencies: 0.007435 570500 -- (-1211.651) (-1212.858) (-1212.797) [-1211.208] * (-1212.227) (-1215.258) (-1212.320) [-1210.999] -- 0:00:27 571000 -- (-1210.856) [-1211.875] (-1213.875) (-1211.783) * (-1213.504) (-1212.005) [-1212.560] (-1211.649) -- 0:00:27 571500 -- (-1210.446) (-1215.312) (-1214.605) [-1210.935] * (-1216.939) (-1211.082) (-1212.744) [-1214.120] -- 0:00:26 572000 -- (-1210.738) (-1214.112) (-1217.912) [-1211.173] * (-1214.401) (-1214.020) [-1213.822] (-1212.676) -- 0:00:26 572500 -- (-1210.779) (-1210.866) (-1216.870) [-1210.942] * [-1211.860] (-1215.776) (-1210.998) (-1212.137) -- 0:00:26 573000 -- (-1215.550) (-1212.227) (-1211.558) [-1212.420] * [-1211.860] (-1215.724) (-1211.790) (-1211.527) -- 0:00:26 573500 -- (-1216.201) [-1211.504] (-1210.673) (-1212.411) * (-1214.140) [-1212.345] (-1213.792) (-1210.483) -- 0:00:26 574000 -- (-1217.170) (-1212.590) (-1211.317) [-1210.905] * (-1215.965) (-1213.002) [-1211.792] (-1210.483) -- 0:00:26 574500 -- [-1215.467] (-1211.449) (-1213.390) (-1212.081) * (-1217.577) (-1212.432) (-1211.076) [-1210.699] -- 0:00:26 575000 -- [-1212.804] (-1212.492) (-1218.697) (-1212.735) * (-1215.928) [-1214.073] (-1212.980) (-1210.919) -- 0:00:26 Average standard deviation of split frequencies: 0.007751 575500 -- (-1211.165) (-1210.922) [-1214.635] (-1213.429) * (-1213.103) (-1214.181) [-1212.629] (-1217.883) -- 0:00:26 576000 -- (-1213.985) [-1210.415] (-1214.647) (-1213.587) * (-1210.566) (-1211.814) (-1213.207) [-1212.547] -- 0:00:26 576500 -- (-1212.312) (-1211.220) (-1210.719) [-1211.868] * (-1218.236) (-1214.301) (-1213.503) [-1211.045] -- 0:00:26 577000 -- (-1212.226) (-1212.484) [-1210.391] (-1211.483) * (-1216.583) (-1216.876) [-1211.699] (-1211.249) -- 0:00:26 577500 -- [-1213.139] (-1211.997) (-1210.375) (-1213.944) * (-1215.421) [-1210.661] (-1214.752) (-1211.314) -- 0:00:26 578000 -- (-1211.935) (-1210.701) [-1210.574] (-1212.290) * (-1215.617) [-1210.836] (-1214.994) (-1217.540) -- 0:00:26 578500 -- [-1213.776] (-1210.468) (-1213.305) (-1214.959) * (-1211.585) (-1210.551) (-1217.332) [-1214.007] -- 0:00:26 579000 -- (-1211.203) (-1211.659) [-1213.120] (-1214.985) * [-1210.506] (-1210.491) (-1217.238) (-1214.739) -- 0:00:26 579500 -- (-1215.643) (-1211.659) (-1212.847) [-1212.766] * (-1210.869) (-1213.120) (-1211.416) [-1211.557] -- 0:00:26 580000 -- (-1212.406) (-1212.370) [-1215.888] (-1212.414) * (-1210.919) (-1213.346) (-1215.831) [-1211.884] -- 0:00:26 Average standard deviation of split frequencies: 0.008071 580500 -- (-1211.631) [-1213.824] (-1212.988) (-1212.158) * (-1210.361) (-1214.382) (-1214.377) [-1211.997] -- 0:00:26 581000 -- (-1211.836) [-1214.088] (-1211.992) (-1210.803) * (-1211.990) (-1216.584) (-1213.263) [-1213.725] -- 0:00:26 581500 -- [-1213.783] (-1211.230) (-1212.918) (-1213.893) * (-1213.590) (-1212.681) [-1211.772] (-1213.657) -- 0:00:26 582000 -- (-1217.057) [-1210.480] (-1212.582) (-1213.548) * (-1216.792) [-1211.702] (-1210.985) (-1213.025) -- 0:00:26 582500 -- (-1214.612) (-1211.363) [-1211.693] (-1213.872) * (-1212.818) [-1210.579] (-1210.999) (-1213.403) -- 0:00:26 583000 -- [-1214.652] (-1212.041) (-1212.715) (-1215.881) * [-1210.971] (-1213.050) (-1212.388) (-1212.473) -- 0:00:26 583500 -- (-1213.199) (-1215.438) (-1210.830) [-1217.811] * (-1212.534) [-1216.479] (-1212.073) (-1211.687) -- 0:00:26 584000 -- (-1215.194) (-1216.391) [-1211.572] (-1215.259) * [-1214.785] (-1213.897) (-1211.175) (-1213.681) -- 0:00:26 584500 -- (-1213.578) (-1212.103) (-1212.456) [-1212.690] * (-1215.628) [-1210.513] (-1211.323) (-1214.083) -- 0:00:26 585000 -- (-1216.887) (-1211.767) (-1211.375) [-1210.771] * (-1216.978) (-1210.507) [-1214.467] (-1214.232) -- 0:00:26 Average standard deviation of split frequencies: 0.008447 585500 -- [-1212.349] (-1212.484) (-1212.452) (-1210.810) * [-1218.600] (-1210.499) (-1219.417) (-1211.658) -- 0:00:26 586000 -- (-1212.614) [-1213.114] (-1214.341) (-1213.491) * (-1211.590) (-1211.259) [-1211.524] (-1214.802) -- 0:00:26 586500 -- [-1215.654] (-1217.314) (-1211.397) (-1213.754) * (-1210.930) [-1211.909] (-1211.836) (-1211.647) -- 0:00:26 587000 -- [-1214.339] (-1220.354) (-1218.196) (-1214.199) * (-1214.115) (-1211.456) (-1212.772) [-1212.598] -- 0:00:26 587500 -- (-1216.482) (-1210.826) (-1212.389) [-1212.502] * (-1217.215) (-1211.282) (-1212.852) [-1213.299] -- 0:00:25 588000 -- (-1211.923) (-1210.539) [-1210.693] (-1211.478) * [-1214.893] (-1211.960) (-1212.001) (-1212.877) -- 0:00:25 588500 -- (-1212.092) (-1211.691) [-1210.969] (-1212.193) * (-1213.192) (-1212.501) (-1210.655) [-1216.377] -- 0:00:25 589000 -- (-1211.497) (-1210.864) (-1214.907) [-1211.307] * (-1214.308) [-1213.001] (-1211.655) (-1217.401) -- 0:00:25 589500 -- (-1210.893) [-1210.284] (-1213.449) (-1211.538) * (-1213.189) [-1213.892] (-1211.916) (-1212.275) -- 0:00:25 590000 -- [-1212.437] (-1212.322) (-1211.202) (-1213.248) * (-1213.617) (-1213.951) (-1214.252) [-1213.002] -- 0:00:25 Average standard deviation of split frequencies: 0.008310 590500 -- (-1212.472) (-1211.767) [-1211.784] (-1214.598) * (-1213.559) [-1213.280] (-1212.918) (-1212.398) -- 0:00:25 591000 -- [-1212.925] (-1211.581) (-1212.904) (-1211.873) * (-1212.766) (-1211.233) [-1211.699] (-1211.939) -- 0:00:25 591500 -- (-1213.604) [-1213.366] (-1214.377) (-1212.930) * (-1212.948) (-1212.690) (-1212.458) [-1213.864] -- 0:00:25 592000 -- [-1214.330] (-1212.486) (-1216.686) (-1211.681) * [-1212.581] (-1210.658) (-1217.747) (-1214.485) -- 0:00:25 592500 -- (-1213.737) (-1214.144) (-1214.384) [-1214.487] * (-1212.432) (-1212.457) (-1216.796) [-1210.916] -- 0:00:25 593000 -- (-1214.350) [-1214.580] (-1213.356) (-1212.259) * (-1211.904) (-1212.068) [-1217.646] (-1212.196) -- 0:00:25 593500 -- (-1212.303) (-1212.016) [-1213.328] (-1211.972) * (-1212.079) [-1212.074] (-1213.398) (-1215.090) -- 0:00:25 594000 -- (-1214.727) [-1213.332] (-1212.879) (-1213.503) * [-1211.231] (-1212.132) (-1212.654) (-1211.964) -- 0:00:25 594500 -- (-1213.451) [-1214.681] (-1212.063) (-1212.296) * [-1210.833] (-1211.053) (-1211.559) (-1210.806) -- 0:00:25 595000 -- (-1211.282) (-1212.905) (-1213.579) [-1213.190] * (-1211.997) (-1210.515) (-1216.510) [-1211.967] -- 0:00:25 Average standard deviation of split frequencies: 0.007316 595500 -- (-1212.452) (-1213.110) (-1210.571) [-1213.129] * (-1212.019) (-1212.063) [-1216.066] (-1212.024) -- 0:00:25 596000 -- (-1212.987) (-1214.425) [-1210.273] (-1219.336) * [-1213.781] (-1213.167) (-1212.169) (-1213.304) -- 0:00:25 596500 -- (-1213.983) (-1211.505) [-1211.737] (-1215.202) * (-1215.841) (-1214.568) [-1212.014] (-1217.461) -- 0:00:25 597000 -- (-1214.866) [-1211.448] (-1213.175) (-1213.605) * (-1212.171) (-1211.471) (-1212.358) [-1211.255] -- 0:00:25 597500 -- (-1213.780) (-1211.511) [-1212.586] (-1212.904) * [-1210.986] (-1211.560) (-1214.770) (-1213.748) -- 0:00:25 598000 -- (-1211.934) (-1212.371) (-1210.857) [-1210.735] * (-1214.163) (-1210.885) (-1215.721) [-1212.478] -- 0:00:25 598500 -- (-1215.490) (-1211.608) (-1211.323) [-1212.549] * (-1214.766) (-1213.183) [-1211.295] (-1213.952) -- 0:00:25 599000 -- (-1214.224) (-1215.037) [-1210.700] (-1211.547) * (-1214.028) (-1211.735) [-1211.532] (-1212.852) -- 0:00:25 599500 -- [-1212.106] (-1214.188) (-1214.742) (-1213.535) * [-1210.794] (-1212.478) (-1213.655) (-1211.115) -- 0:00:25 600000 -- (-1212.477) [-1215.113] (-1212.656) (-1213.118) * (-1215.922) [-1211.827] (-1215.448) (-1210.833) -- 0:00:25 Average standard deviation of split frequencies: 0.007063 600500 -- [-1210.971] (-1211.396) (-1213.347) (-1212.713) * (-1213.763) (-1216.250) (-1212.592) [-1210.921] -- 0:00:25 601000 -- (-1210.734) [-1213.346] (-1211.181) (-1211.881) * (-1212.147) [-1212.475] (-1211.837) (-1210.908) -- 0:00:25 601500 -- [-1216.314] (-1213.976) (-1213.292) (-1212.785) * (-1214.523) [-1211.856] (-1214.776) (-1215.510) -- 0:00:25 602000 -- [-1212.709] (-1213.026) (-1210.300) (-1212.605) * (-1215.098) (-1212.736) (-1217.529) [-1212.609] -- 0:00:25 602500 -- (-1212.916) (-1211.499) [-1210.821] (-1212.155) * (-1211.635) [-1212.502] (-1213.927) (-1210.358) -- 0:00:25 603000 -- (-1210.744) (-1215.838) [-1211.148] (-1212.913) * [-1210.668] (-1213.979) (-1213.080) (-1210.797) -- 0:00:25 603500 -- (-1210.347) (-1214.426) [-1213.709] (-1211.617) * [-1212.405] (-1212.674) (-1216.036) (-1213.816) -- 0:00:24 604000 -- [-1210.943] (-1213.230) (-1215.274) (-1212.227) * (-1216.031) (-1214.780) (-1211.781) [-1213.696] -- 0:00:24 604500 -- (-1214.867) (-1214.385) [-1216.056] (-1213.350) * (-1211.136) [-1212.394] (-1212.429) (-1215.104) -- 0:00:24 605000 -- (-1211.817) (-1213.414) (-1215.174) [-1213.788] * [-1210.500] (-1212.143) (-1214.132) (-1215.068) -- 0:00:24 Average standard deviation of split frequencies: 0.007050 605500 -- (-1211.402) [-1215.537] (-1213.521) (-1213.183) * [-1211.111] (-1212.239) (-1211.111) (-1215.129) -- 0:00:24 606000 -- (-1212.562) (-1212.353) [-1211.008] (-1210.963) * (-1215.752) (-1215.683) (-1210.983) [-1212.940] -- 0:00:24 606500 -- (-1211.316) (-1213.964) (-1211.545) [-1211.006] * (-1217.610) [-1217.015] (-1214.189) (-1213.705) -- 0:00:24 607000 -- (-1210.531) [-1210.962] (-1214.688) (-1211.117) * (-1217.405) [-1211.572] (-1214.699) (-1214.315) -- 0:00:24 607500 -- [-1210.674] (-1213.658) (-1213.528) (-1211.155) * [-1211.315] (-1218.560) (-1213.857) (-1211.675) -- 0:00:24 608000 -- (-1210.854) (-1214.234) [-1212.530] (-1214.173) * [-1212.870] (-1211.662) (-1211.664) (-1215.707) -- 0:00:24 608500 -- (-1210.757) (-1217.991) [-1211.056] (-1210.778) * [-1211.449] (-1212.539) (-1211.224) (-1212.541) -- 0:00:24 609000 -- (-1212.056) [-1213.240] (-1210.995) (-1210.778) * (-1214.106) [-1213.148] (-1210.752) (-1212.844) -- 0:00:24 609500 -- (-1210.614) [-1213.308] (-1212.520) (-1210.566) * (-1211.902) [-1212.986] (-1211.918) (-1213.379) -- 0:00:24 610000 -- (-1211.549) (-1212.808) [-1210.981] (-1213.794) * [-1212.483] (-1214.372) (-1212.562) (-1213.715) -- 0:00:24 Average standard deviation of split frequencies: 0.007527 610500 -- (-1210.927) (-1210.686) (-1211.275) [-1211.998] * (-1215.440) (-1210.843) (-1210.706) [-1213.690] -- 0:00:24 611000 -- (-1211.085) (-1212.055) (-1210.304) [-1212.932] * (-1215.179) (-1213.443) (-1211.608) [-1212.011] -- 0:00:24 611500 -- (-1213.313) [-1212.515] (-1213.903) (-1214.549) * [-1216.090] (-1212.456) (-1213.159) (-1211.183) -- 0:00:24 612000 -- (-1212.920) (-1211.493) (-1212.035) [-1215.432] * (-1211.409) [-1211.479] (-1211.609) (-1211.455) -- 0:00:24 612500 -- (-1213.905) (-1211.217) (-1212.226) [-1211.557] * (-1210.665) (-1211.093) [-1214.184] (-1213.414) -- 0:00:24 613000 -- [-1212.760] (-1216.042) (-1212.857) (-1212.180) * (-1211.063) (-1211.153) [-1211.605] (-1210.583) -- 0:00:24 613500 -- [-1211.265] (-1210.772) (-1213.293) (-1212.246) * [-1210.935] (-1215.607) (-1213.718) (-1210.583) -- 0:00:24 614000 -- [-1215.591] (-1212.001) (-1212.473) (-1210.778) * (-1212.851) (-1213.973) (-1212.082) [-1212.840] -- 0:00:24 614500 -- (-1215.325) [-1210.985] (-1210.579) (-1211.857) * [-1211.964] (-1214.305) (-1211.557) (-1212.679) -- 0:00:24 615000 -- (-1213.005) (-1212.781) (-1212.660) [-1213.536] * (-1214.220) (-1212.991) (-1216.632) [-1212.768] -- 0:00:24 Average standard deviation of split frequencies: 0.007318 615500 -- [-1210.381] (-1211.389) (-1213.182) (-1212.381) * [-1213.124] (-1213.482) (-1211.117) (-1211.955) -- 0:00:24 616000 -- (-1213.203) [-1213.090] (-1212.235) (-1211.238) * (-1216.785) [-1212.097] (-1213.550) (-1212.173) -- 0:00:24 616500 -- [-1217.214] (-1212.167) (-1211.488) (-1217.796) * (-1214.740) (-1211.987) (-1214.150) [-1213.576] -- 0:00:24 617000 -- (-1213.091) [-1212.585] (-1211.324) (-1215.476) * (-1219.321) [-1210.777] (-1215.938) (-1213.870) -- 0:00:24 617500 -- (-1214.117) (-1216.185) [-1215.006] (-1212.507) * (-1214.706) (-1213.099) [-1211.261] (-1213.050) -- 0:00:24 618000 -- (-1216.128) [-1213.323] (-1215.823) (-1211.786) * (-1212.275) (-1212.475) (-1213.254) [-1212.063] -- 0:00:24 618500 -- (-1219.205) [-1212.002] (-1214.281) (-1211.188) * (-1211.856) (-1211.636) (-1213.043) [-1212.455] -- 0:00:24 619000 -- [-1212.555] (-1213.588) (-1212.699) (-1212.851) * [-1212.102] (-1212.404) (-1210.640) (-1213.255) -- 0:00:24 619500 -- (-1212.728) (-1221.660) [-1212.627] (-1216.628) * [-1210.666] (-1211.735) (-1214.268) (-1211.855) -- 0:00:23 620000 -- (-1212.707) (-1220.520) [-1211.447] (-1214.823) * (-1210.801) (-1211.171) [-1211.096] (-1212.488) -- 0:00:23 Average standard deviation of split frequencies: 0.007342 620500 -- (-1213.274) (-1219.043) (-1212.229) [-1211.474] * (-1210.889) (-1214.207) (-1210.522) [-1212.290] -- 0:00:23 621000 -- (-1211.870) (-1215.356) [-1212.163] (-1211.152) * (-1212.741) [-1211.542] (-1211.281) (-1213.927) -- 0:00:23 621500 -- (-1211.953) (-1212.935) [-1211.239] (-1210.714) * (-1213.054) [-1214.386] (-1213.091) (-1215.472) -- 0:00:23 622000 -- [-1212.629] (-1216.903) (-1210.867) (-1211.175) * [-1213.668] (-1213.296) (-1213.086) (-1214.164) -- 0:00:23 622500 -- (-1216.864) [-1216.820] (-1213.036) (-1213.770) * (-1213.180) (-1212.948) [-1215.315] (-1214.420) -- 0:00:23 623000 -- [-1213.064] (-1210.848) (-1214.392) (-1214.038) * (-1211.868) (-1216.588) [-1212.052] (-1213.252) -- 0:00:23 623500 -- (-1211.465) (-1211.814) [-1211.309] (-1219.416) * [-1211.370] (-1213.011) (-1211.837) (-1212.121) -- 0:00:23 624000 -- (-1214.760) (-1212.585) [-1210.694] (-1215.351) * (-1215.406) (-1212.914) [-1212.860] (-1212.214) -- 0:00:23 624500 -- (-1211.899) (-1213.511) (-1213.610) [-1214.777] * (-1210.826) [-1211.075] (-1215.829) (-1211.630) -- 0:00:23 625000 -- [-1212.219] (-1213.694) (-1211.382) (-1213.088) * (-1210.585) [-1214.112] (-1215.251) (-1216.207) -- 0:00:23 Average standard deviation of split frequencies: 0.007154 625500 -- (-1214.625) (-1211.934) (-1210.740) [-1211.279] * (-1212.004) [-1211.703] (-1212.336) (-1212.585) -- 0:00:23 626000 -- [-1210.823] (-1214.022) (-1210.628) (-1210.355) * (-1212.944) (-1214.637) (-1211.743) [-1211.135] -- 0:00:23 626500 -- (-1214.274) [-1211.901] (-1213.161) (-1212.924) * (-1214.988) (-1213.944) [-1214.095] (-1214.987) -- 0:00:23 627000 -- (-1215.767) [-1211.141] (-1212.403) (-1211.463) * (-1213.246) (-1211.133) [-1212.281] (-1214.567) -- 0:00:23 627500 -- (-1215.465) [-1212.592] (-1212.692) (-1212.221) * [-1217.346] (-1210.659) (-1215.736) (-1215.698) -- 0:00:23 628000 -- (-1213.143) (-1212.814) (-1212.084) [-1210.922] * (-1214.483) [-1211.037] (-1215.312) (-1212.437) -- 0:00:23 628500 -- [-1212.449] (-1211.653) (-1211.741) (-1211.031) * [-1210.566] (-1212.448) (-1214.021) (-1212.148) -- 0:00:23 629000 -- [-1212.118] (-1213.312) (-1215.041) (-1210.918) * (-1210.751) (-1210.864) (-1213.237) [-1212.717] -- 0:00:23 629500 -- (-1211.407) [-1211.602] (-1212.118) (-1211.643) * [-1212.337] (-1211.863) (-1211.550) (-1210.887) -- 0:00:23 630000 -- (-1210.627) (-1211.028) (-1211.979) [-1211.201] * (-1214.303) [-1212.254] (-1215.908) (-1210.749) -- 0:00:23 Average standard deviation of split frequencies: 0.006867 630500 -- [-1210.564] (-1210.672) (-1213.357) (-1213.493) * (-1211.912) (-1211.913) (-1213.019) [-1211.323] -- 0:00:23 631000 -- (-1212.032) [-1210.763] (-1212.606) (-1214.326) * (-1211.559) [-1213.649] (-1212.987) (-1211.780) -- 0:00:23 631500 -- (-1211.048) [-1214.017] (-1213.909) (-1213.503) * (-1214.127) (-1211.478) (-1215.797) [-1211.174] -- 0:00:23 632000 -- (-1211.456) (-1210.896) (-1214.103) [-1213.648] * (-1214.972) (-1211.546) [-1214.954] (-1210.534) -- 0:00:23 632500 -- (-1211.004) (-1212.228) (-1211.006) [-1213.348] * (-1215.626) [-1211.514] (-1211.774) (-1211.096) -- 0:00:23 633000 -- [-1211.006] (-1213.545) (-1213.167) (-1211.723) * (-1212.563) [-1211.019] (-1211.601) (-1213.178) -- 0:00:23 633500 -- (-1213.370) (-1215.416) (-1211.283) [-1212.313] * (-1214.962) [-1211.497] (-1213.017) (-1212.198) -- 0:00:23 634000 -- (-1213.326) (-1214.023) [-1211.041] (-1215.676) * [-1212.180] (-1211.328) (-1213.663) (-1213.108) -- 0:00:23 634500 -- [-1215.615] (-1212.122) (-1211.788) (-1217.248) * (-1212.553) (-1212.933) (-1212.642) [-1213.583] -- 0:00:23 635000 -- (-1214.322) [-1212.447] (-1211.589) (-1211.296) * (-1212.733) (-1214.553) [-1213.934] (-1210.566) -- 0:00:22 Average standard deviation of split frequencies: 0.007088 635500 -- (-1214.163) [-1214.118] (-1213.250) (-1211.287) * (-1211.410) (-1210.634) (-1214.717) [-1211.970] -- 0:00:22 636000 -- [-1216.313] (-1212.759) (-1212.053) (-1215.431) * (-1213.176) (-1212.684) (-1215.109) [-1212.464] -- 0:00:22 636500 -- (-1215.921) (-1211.400) (-1211.849) [-1212.889] * [-1212.310] (-1214.077) (-1211.885) (-1211.407) -- 0:00:22 637000 -- (-1211.761) (-1211.875) (-1214.856) [-1213.341] * (-1213.370) (-1210.696) [-1213.105] (-1214.419) -- 0:00:22 637500 -- (-1212.197) (-1214.058) (-1210.943) [-1212.744] * (-1212.478) (-1214.321) [-1213.882] (-1212.116) -- 0:00:22 638000 -- [-1213.162] (-1213.913) (-1212.941) (-1212.346) * (-1212.360) [-1217.577] (-1215.339) (-1210.410) -- 0:00:22 638500 -- (-1211.778) [-1214.316] (-1213.234) (-1212.061) * (-1213.084) (-1216.199) [-1212.007] (-1211.666) -- 0:00:22 639000 -- (-1211.090) (-1216.607) [-1211.434] (-1215.839) * (-1212.832) (-1213.421) (-1214.497) [-1213.930] -- 0:00:22 639500 -- (-1216.007) [-1214.398] (-1212.718) (-1217.218) * (-1212.234) [-1216.881] (-1210.943) (-1213.587) -- 0:00:22 640000 -- (-1215.904) [-1213.322] (-1215.636) (-1210.763) * (-1212.609) (-1213.499) (-1210.596) [-1211.431] -- 0:00:22 Average standard deviation of split frequencies: 0.007128 640500 -- (-1220.523) (-1212.065) (-1216.032) [-1211.993] * (-1211.840) (-1212.834) [-1213.212] (-1211.112) -- 0:00:22 641000 -- (-1219.065) (-1212.265) [-1215.571] (-1213.277) * [-1214.949] (-1212.330) (-1212.022) (-1211.263) -- 0:00:22 641500 -- (-1213.692) (-1211.041) [-1212.808] (-1210.579) * (-1211.946) [-1212.017] (-1211.647) (-1211.506) -- 0:00:22 642000 -- [-1211.590] (-1211.332) (-1212.011) (-1210.700) * (-1214.738) [-1213.053] (-1212.465) (-1212.904) -- 0:00:22 642500 -- (-1213.060) (-1212.971) (-1215.322) [-1211.464] * [-1213.457] (-1216.098) (-1213.820) (-1212.909) -- 0:00:22 643000 -- [-1212.249] (-1214.898) (-1212.156) (-1213.423) * (-1217.306) [-1214.410] (-1214.875) (-1211.923) -- 0:00:22 643500 -- [-1211.642] (-1211.440) (-1213.930) (-1212.497) * (-1213.093) (-1210.739) (-1214.012) [-1210.478] -- 0:00:22 644000 -- (-1211.391) (-1216.181) [-1214.307] (-1212.068) * (-1211.897) [-1212.223] (-1214.054) (-1211.192) -- 0:00:22 644500 -- (-1211.868) (-1212.727) [-1212.983] (-1214.920) * (-1214.378) [-1211.444] (-1213.163) (-1215.634) -- 0:00:22 645000 -- (-1211.743) [-1211.822] (-1212.045) (-1216.610) * (-1214.439) (-1216.523) (-1211.576) [-1214.482] -- 0:00:22 Average standard deviation of split frequencies: 0.007160 645500 -- (-1214.109) [-1211.823] (-1212.805) (-1212.863) * (-1213.431) (-1212.164) (-1211.993) [-1211.196] -- 0:00:22 646000 -- (-1212.824) (-1214.426) (-1211.841) [-1213.095] * (-1213.786) (-1217.003) [-1211.330] (-1211.905) -- 0:00:22 646500 -- (-1210.976) [-1218.126] (-1213.285) (-1212.348) * (-1212.047) (-1213.156) (-1216.427) [-1213.738] -- 0:00:22 647000 -- (-1211.458) (-1213.788) [-1211.747] (-1210.726) * (-1213.890) (-1212.401) (-1211.236) [-1212.497] -- 0:00:22 647500 -- (-1211.121) (-1211.634) (-1213.181) [-1214.898] * (-1215.024) (-1212.602) (-1215.251) [-1212.382] -- 0:00:22 648000 -- (-1213.630) (-1213.867) (-1214.925) [-1215.483] * [-1213.567] (-1216.464) (-1214.157) (-1216.129) -- 0:00:22 648500 -- (-1213.592) (-1211.426) [-1212.008] (-1211.779) * (-1215.830) [-1217.958] (-1211.103) (-1211.694) -- 0:00:22 649000 -- [-1212.624] (-1215.980) (-1212.076) (-1214.611) * [-1211.863] (-1215.410) (-1211.783) (-1215.797) -- 0:00:22 649500 -- [-1211.272] (-1213.890) (-1212.215) (-1212.263) * (-1210.644) (-1211.815) [-1214.349] (-1212.234) -- 0:00:22 650000 -- (-1214.339) (-1212.138) [-1214.604] (-1213.410) * [-1210.331] (-1212.248) (-1216.055) (-1212.683) -- 0:00:22 Average standard deviation of split frequencies: 0.007680 650500 -- (-1216.070) (-1212.851) [-1213.334] (-1213.763) * (-1211.082) (-1211.924) (-1212.769) [-1211.172] -- 0:00:22 651000 -- (-1214.872) [-1211.842] (-1211.500) (-1212.974) * (-1211.397) [-1210.210] (-1212.453) (-1211.204) -- 0:00:21 651500 -- (-1213.967) (-1214.827) [-1213.251] (-1212.615) * (-1212.631) (-1212.863) (-1210.337) [-1211.224] -- 0:00:21 652000 -- (-1213.033) [-1211.519] (-1215.529) (-1211.699) * (-1211.331) (-1212.031) [-1216.845] (-1211.065) -- 0:00:21 652500 -- (-1213.033) (-1211.116) (-1214.528) [-1211.385] * (-1211.654) (-1212.248) (-1216.503) [-1210.949] -- 0:00:21 653000 -- [-1211.772] (-1216.461) (-1214.622) (-1213.329) * (-1212.026) (-1212.286) (-1215.630) [-1210.683] -- 0:00:21 653500 -- (-1212.516) (-1212.206) (-1211.105) [-1210.959] * (-1211.835) (-1213.255) (-1214.107) [-1211.976] -- 0:00:21 654000 -- (-1211.042) [-1210.709] (-1211.084) (-1214.755) * (-1214.909) [-1214.592] (-1212.344) (-1210.990) -- 0:00:21 654500 -- [-1211.999] (-1213.285) (-1212.513) (-1211.334) * [-1210.624] (-1212.678) (-1211.974) (-1213.071) -- 0:00:21 655000 -- (-1211.285) (-1221.372) [-1210.406] (-1212.976) * [-1211.611] (-1213.977) (-1212.454) (-1213.633) -- 0:00:21 Average standard deviation of split frequencies: 0.007905 655500 -- (-1213.116) [-1216.625] (-1213.349) (-1212.007) * [-1212.230] (-1210.839) (-1211.339) (-1210.995) -- 0:00:21 656000 -- (-1216.993) (-1215.155) (-1210.680) [-1212.565] * (-1212.459) (-1211.110) [-1212.111] (-1211.008) -- 0:00:21 656500 -- (-1212.998) (-1211.462) (-1214.934) [-1212.374] * (-1213.839) [-1210.551] (-1211.603) (-1210.744) -- 0:00:21 657000 -- [-1212.507] (-1212.889) (-1217.678) (-1211.121) * (-1210.418) (-1212.418) (-1211.681) [-1211.063] -- 0:00:21 657500 -- (-1214.279) (-1211.318) (-1219.441) [-1212.143] * [-1210.999] (-1217.594) (-1212.269) (-1214.311) -- 0:00:21 658000 -- (-1211.591) (-1210.334) (-1219.467) [-1211.566] * (-1211.935) (-1211.444) [-1211.412] (-1215.618) -- 0:00:21 658500 -- (-1216.133) [-1213.785] (-1215.175) (-1211.247) * (-1211.935) (-1211.987) [-1213.139] (-1212.009) -- 0:00:21 659000 -- (-1213.764) (-1213.001) [-1214.172] (-1215.247) * (-1211.116) (-1211.804) (-1219.196) [-1212.130] -- 0:00:21 659500 -- (-1215.852) [-1211.507] (-1215.402) (-1212.698) * [-1212.532] (-1213.782) (-1212.648) (-1216.157) -- 0:00:21 660000 -- [-1212.723] (-1211.954) (-1216.771) (-1210.517) * (-1211.077) (-1214.161) (-1212.367) [-1211.247] -- 0:00:21 Average standard deviation of split frequencies: 0.007659 660500 -- (-1214.022) (-1212.709) [-1212.144] (-1211.209) * (-1212.685) [-1213.205] (-1212.772) (-1211.354) -- 0:00:21 661000 -- [-1212.601] (-1211.910) (-1212.964) (-1211.597) * (-1214.938) (-1210.845) [-1212.683] (-1213.380) -- 0:00:21 661500 -- (-1215.624) (-1211.349) (-1211.962) [-1210.882] * (-1214.637) [-1213.602] (-1211.941) (-1211.794) -- 0:00:21 662000 -- (-1214.438) (-1210.966) (-1212.975) [-1210.738] * (-1212.073) [-1212.422] (-1211.196) (-1216.366) -- 0:00:21 662500 -- (-1212.135) (-1214.163) [-1213.231] (-1211.660) * (-1214.566) (-1212.699) [-1211.039] (-1212.031) -- 0:00:21 663000 -- (-1211.982) (-1215.260) (-1213.386) [-1213.405] * (-1216.687) (-1210.525) (-1211.378) [-1212.491] -- 0:00:21 663500 -- [-1215.946] (-1217.065) (-1214.714) (-1212.342) * (-1213.048) [-1212.604] (-1213.993) (-1212.184) -- 0:00:21 664000 -- (-1213.571) (-1215.449) [-1219.113] (-1214.298) * (-1216.105) (-1215.034) (-1214.644) [-1211.269] -- 0:00:21 664500 -- (-1212.763) (-1213.445) (-1214.081) [-1210.259] * [-1214.651] (-1214.530) (-1213.823) (-1213.090) -- 0:00:21 665000 -- [-1213.784] (-1211.198) (-1213.600) (-1213.176) * (-1212.874) (-1213.619) (-1213.762) [-1210.812] -- 0:00:21 Average standard deviation of split frequencies: 0.007597 665500 -- (-1214.555) [-1212.438] (-1214.144) (-1217.179) * (-1212.884) [-1214.778] (-1211.295) (-1215.429) -- 0:00:21 666000 -- (-1212.882) (-1213.532) [-1212.120] (-1213.358) * (-1213.182) (-1220.024) [-1210.869] (-1214.538) -- 0:00:21 666500 -- (-1212.722) (-1212.443) [-1212.336] (-1214.098) * [-1215.341] (-1213.155) (-1212.518) (-1215.612) -- 0:00:21 667000 -- [-1216.542] (-1213.099) (-1211.554) (-1211.232) * (-1211.702) [-1213.599] (-1212.256) (-1210.858) -- 0:00:20 667500 -- (-1213.345) (-1211.248) [-1219.282] (-1215.934) * (-1213.921) (-1213.869) (-1212.911) [-1213.362] -- 0:00:20 668000 -- [-1210.787] (-1211.343) (-1216.074) (-1216.265) * [-1214.786] (-1219.194) (-1212.710) (-1211.614) -- 0:00:20 668500 -- (-1216.400) (-1211.189) (-1211.901) [-1213.955] * [-1214.380] (-1211.649) (-1213.533) (-1211.753) -- 0:00:20 669000 -- (-1217.907) (-1213.558) (-1211.705) [-1212.463] * [-1212.454] (-1212.966) (-1214.885) (-1210.374) -- 0:00:20 669500 -- (-1215.667) (-1211.524) [-1211.945] (-1211.902) * (-1215.813) (-1211.462) [-1214.580] (-1211.504) -- 0:00:20 670000 -- (-1213.695) (-1211.521) (-1212.528) [-1212.292] * [-1214.925] (-1216.524) (-1211.972) (-1213.558) -- 0:00:20 Average standard deviation of split frequencies: 0.007497 670500 -- (-1211.521) (-1211.978) [-1210.842] (-1215.395) * (-1215.645) [-1211.324] (-1219.697) (-1214.172) -- 0:00:20 671000 -- [-1211.264] (-1215.005) (-1213.314) (-1212.785) * (-1213.548) [-1211.974] (-1215.432) (-1210.876) -- 0:00:20 671500 -- (-1211.067) (-1214.653) (-1216.766) [-1211.334] * (-1211.107) (-1215.154) (-1210.770) [-1211.584] -- 0:00:20 672000 -- (-1211.393) [-1214.234] (-1211.446) (-1212.465) * (-1210.914) (-1213.617) (-1212.776) [-1212.550] -- 0:00:20 672500 -- (-1215.942) [-1211.497] (-1215.367) (-1211.558) * [-1211.233] (-1214.341) (-1214.059) (-1217.973) -- 0:00:20 673000 -- (-1214.190) (-1210.633) (-1211.754) [-1211.100] * (-1211.260) [-1210.834] (-1215.609) (-1216.093) -- 0:00:20 673500 -- (-1211.823) [-1212.013] (-1210.948) (-1211.143) * (-1210.751) (-1210.418) [-1212.095] (-1217.641) -- 0:00:20 674000 -- (-1218.196) (-1212.412) (-1212.359) [-1210.675] * (-1210.701) (-1213.727) [-1211.568] (-1212.225) -- 0:00:20 674500 -- (-1212.693) (-1210.821) (-1214.709) [-1212.004] * (-1212.257) [-1213.845] (-1211.553) (-1211.779) -- 0:00:20 675000 -- (-1213.999) (-1214.282) [-1211.419] (-1212.132) * (-1211.809) [-1215.990] (-1212.037) (-1211.955) -- 0:00:20 Average standard deviation of split frequencies: 0.006787 675500 -- (-1214.123) (-1215.136) (-1211.402) [-1211.786] * (-1213.393) (-1215.117) (-1211.697) [-1215.812] -- 0:00:20 676000 -- (-1212.535) [-1211.389] (-1212.025) (-1214.498) * (-1213.772) (-1211.345) [-1211.593] (-1210.636) -- 0:00:20 676500 -- (-1211.428) [-1211.093] (-1214.414) (-1214.150) * (-1212.954) (-1211.278) (-1215.884) [-1211.256] -- 0:00:20 677000 -- (-1213.973) (-1211.227) (-1212.714) [-1212.281] * (-1214.594) (-1216.085) [-1212.149] (-1213.247) -- 0:00:20 677500 -- (-1211.021) (-1213.782) (-1214.518) [-1213.776] * (-1214.257) (-1214.425) (-1213.404) [-1211.159] -- 0:00:20 678000 -- (-1212.386) (-1213.542) [-1211.182] (-1212.922) * (-1217.580) (-1212.105) [-1211.442] (-1214.495) -- 0:00:20 678500 -- [-1211.861] (-1212.911) (-1211.679) (-1212.216) * [-1212.445] (-1213.545) (-1213.508) (-1217.178) -- 0:00:20 679000 -- [-1212.505] (-1211.795) (-1213.851) (-1211.874) * (-1213.475) [-1212.932] (-1211.412) (-1211.800) -- 0:00:20 679500 -- [-1211.885] (-1211.311) (-1212.007) (-1211.931) * (-1211.941) (-1213.852) [-1211.137] (-1213.472) -- 0:00:20 680000 -- (-1212.145) (-1212.547) (-1213.773) [-1212.018] * (-1215.036) (-1215.772) (-1211.804) [-1210.816] -- 0:00:20 Average standard deviation of split frequencies: 0.006556 680500 -- (-1211.381) (-1213.286) (-1212.590) [-1212.964] * [-1213.129] (-1214.536) (-1214.831) (-1213.751) -- 0:00:20 681000 -- (-1213.761) [-1212.080] (-1214.251) (-1217.390) * (-1214.648) (-1220.112) [-1212.640] (-1213.990) -- 0:00:20 681500 -- [-1211.457] (-1213.626) (-1212.430) (-1212.085) * [-1215.203] (-1213.924) (-1211.402) (-1211.781) -- 0:00:20 682000 -- [-1212.714] (-1215.486) (-1214.128) (-1212.895) * (-1214.397) (-1218.350) [-1211.557] (-1215.485) -- 0:00:20 682500 -- (-1211.610) (-1213.505) [-1213.594] (-1211.374) * [-1211.461] (-1211.717) (-1212.932) (-1212.900) -- 0:00:20 683000 -- (-1212.147) (-1212.458) (-1218.846) [-1212.147] * (-1214.705) [-1212.462] (-1212.831) (-1211.835) -- 0:00:19 683500 -- (-1211.875) [-1211.121] (-1212.332) (-1213.912) * (-1211.479) [-1211.490] (-1212.398) (-1212.340) -- 0:00:19 684000 -- [-1211.759] (-1213.038) (-1213.590) (-1215.066) * (-1211.399) [-1211.516] (-1221.163) (-1212.657) -- 0:00:19 684500 -- (-1211.567) (-1211.497) [-1215.485] (-1211.560) * (-1212.116) (-1212.794) [-1214.779] (-1214.434) -- 0:00:19 685000 -- (-1213.258) [-1212.254] (-1215.442) (-1214.170) * [-1212.076] (-1214.959) (-1211.937) (-1212.426) -- 0:00:19 Average standard deviation of split frequencies: 0.006505 685500 -- [-1210.647] (-1214.245) (-1213.390) (-1214.785) * (-1212.107) [-1215.046] (-1212.081) (-1214.527) -- 0:00:19 686000 -- (-1213.533) [-1214.546] (-1219.619) (-1212.517) * (-1211.384) [-1213.215] (-1211.662) (-1214.170) -- 0:00:19 686500 -- (-1210.708) (-1210.331) [-1212.879] (-1211.288) * (-1214.182) (-1213.574) (-1213.386) [-1216.139] -- 0:00:19 687000 -- (-1213.712) (-1212.516) (-1214.029) [-1211.882] * (-1212.263) (-1214.473) (-1211.860) [-1216.768] -- 0:00:19 687500 -- (-1211.646) [-1211.437] (-1210.662) (-1213.662) * [-1211.063] (-1214.477) (-1210.175) (-1215.984) -- 0:00:19 688000 -- (-1215.022) [-1210.539] (-1210.669) (-1213.291) * [-1211.819] (-1212.982) (-1220.277) (-1214.152) -- 0:00:19 688500 -- (-1213.056) (-1212.227) (-1214.946) [-1211.468] * [-1212.709] (-1213.204) (-1213.774) (-1214.226) -- 0:00:19 689000 -- (-1212.219) [-1211.707] (-1213.878) (-1212.266) * [-1215.027] (-1216.247) (-1213.048) (-1211.428) -- 0:00:19 689500 -- (-1213.326) [-1211.852] (-1214.872) (-1215.373) * [-1210.340] (-1211.988) (-1212.162) (-1211.004) -- 0:00:19 690000 -- (-1211.977) (-1210.702) (-1213.737) [-1211.889] * (-1214.574) (-1213.181) [-1212.643] (-1212.119) -- 0:00:19 Average standard deviation of split frequencies: 0.006185 690500 -- (-1214.574) (-1211.815) (-1210.757) [-1212.736] * [-1215.021] (-1212.286) (-1212.868) (-1213.833) -- 0:00:19 691000 -- (-1212.712) (-1211.528) [-1211.295] (-1213.747) * (-1213.599) [-1211.603] (-1215.076) (-1211.456) -- 0:00:19 691500 -- (-1211.375) (-1215.377) [-1211.621] (-1214.517) * (-1212.646) (-1211.603) (-1216.035) [-1211.947] -- 0:00:19 692000 -- (-1214.180) (-1214.665) [-1213.698] (-1211.399) * (-1210.767) (-1214.632) (-1211.894) [-1211.208] -- 0:00:19 692500 -- (-1214.685) [-1213.547] (-1212.458) (-1212.897) * (-1211.757) (-1213.122) (-1212.208) [-1212.840] -- 0:00:19 693000 -- (-1211.457) (-1213.409) (-1212.680) [-1213.312] * (-1212.972) [-1211.952] (-1211.645) (-1218.215) -- 0:00:19 693500 -- (-1211.730) (-1214.975) (-1214.094) [-1211.737] * [-1212.468] (-1211.762) (-1212.043) (-1212.805) -- 0:00:19 694000 -- (-1211.385) (-1212.329) (-1213.427) [-1212.641] * (-1213.632) [-1212.987] (-1212.947) (-1212.436) -- 0:00:19 694500 -- (-1212.950) (-1213.891) (-1213.750) [-1214.546] * (-1221.848) (-1214.555) [-1213.438] (-1212.385) -- 0:00:19 695000 -- (-1213.585) (-1214.833) [-1212.325] (-1211.707) * (-1214.255) (-1214.616) (-1212.034) [-1214.485] -- 0:00:19 Average standard deviation of split frequencies: 0.006728 695500 -- (-1219.706) [-1210.879] (-1213.211) (-1211.150) * (-1214.133) (-1218.203) (-1211.087) [-1212.300] -- 0:00:19 696000 -- (-1214.625) [-1212.600] (-1215.070) (-1213.043) * (-1214.213) (-1213.084) [-1211.019] (-1214.725) -- 0:00:19 696500 -- (-1214.375) [-1211.134] (-1212.089) (-1211.567) * (-1213.699) (-1212.926) [-1211.316] (-1210.961) -- 0:00:19 697000 -- (-1214.985) (-1212.583) [-1215.295] (-1213.502) * [-1213.110] (-1213.257) (-1210.990) (-1213.357) -- 0:00:19 697500 -- (-1211.973) (-1213.265) (-1213.468) [-1212.313] * (-1212.701) (-1212.756) [-1215.384] (-1211.913) -- 0:00:19 698000 -- [-1213.365] (-1211.269) (-1212.441) (-1211.015) * [-1210.911] (-1212.383) (-1213.192) (-1212.864) -- 0:00:19 698500 -- [-1211.942] (-1211.935) (-1212.544) (-1214.910) * (-1215.438) [-1211.904] (-1215.666) (-1211.059) -- 0:00:18 699000 -- [-1210.597] (-1213.426) (-1213.388) (-1217.866) * (-1214.068) [-1213.251] (-1215.153) (-1211.680) -- 0:00:18 699500 -- (-1212.211) (-1213.252) [-1211.681] (-1211.712) * (-1215.312) [-1213.431] (-1214.899) (-1213.473) -- 0:00:18 700000 -- (-1210.987) [-1211.595] (-1211.795) (-1211.136) * [-1214.078] (-1213.174) (-1214.010) (-1212.747) -- 0:00:18 Average standard deviation of split frequencies: 0.006907 700500 -- (-1210.502) (-1215.579) (-1212.281) [-1211.273] * (-1213.324) (-1211.186) [-1214.547] (-1212.725) -- 0:00:18 701000 -- (-1213.728) [-1216.294] (-1213.904) (-1211.196) * (-1214.272) (-1211.054) (-1211.508) [-1214.433] -- 0:00:18 701500 -- (-1213.357) (-1215.981) (-1212.990) [-1211.925] * (-1214.711) (-1212.497) (-1211.936) [-1211.763] -- 0:00:18 702000 -- (-1216.688) [-1212.322] (-1211.819) (-1212.827) * (-1211.944) (-1211.970) [-1211.158] (-1211.869) -- 0:00:18 702500 -- (-1224.301) (-1212.348) (-1213.000) [-1210.705] * (-1214.069) [-1213.821] (-1211.675) (-1214.374) -- 0:00:18 703000 -- (-1216.231) (-1211.362) (-1211.917) [-1210.741] * (-1212.724) (-1212.384) [-1213.000] (-1211.076) -- 0:00:18 703500 -- (-1214.737) (-1211.445) (-1211.436) [-1211.814] * (-1212.951) (-1213.274) [-1213.885] (-1211.678) -- 0:00:18 704000 -- (-1216.050) (-1212.808) (-1212.098) [-1214.620] * (-1215.722) (-1210.640) (-1211.069) [-1210.425] -- 0:00:18 704500 -- (-1212.845) (-1214.197) [-1210.932] (-1211.337) * (-1214.065) [-1216.269] (-1211.370) (-1211.057) -- 0:00:18 705000 -- (-1216.396) [-1212.962] (-1212.554) (-1213.140) * [-1210.782] (-1210.327) (-1211.510) (-1212.243) -- 0:00:18 Average standard deviation of split frequencies: 0.006468 705500 -- (-1214.723) (-1213.550) [-1215.077] (-1214.528) * (-1215.372) (-1211.185) [-1211.670] (-1214.935) -- 0:00:18 706000 -- (-1213.764) (-1213.672) [-1213.425] (-1212.671) * (-1214.626) (-1213.344) (-1213.931) [-1214.956] -- 0:00:18 706500 -- (-1214.684) (-1218.361) [-1214.013] (-1215.383) * [-1211.489] (-1217.036) (-1213.402) (-1211.707) -- 0:00:18 707000 -- (-1215.896) [-1213.641] (-1212.515) (-1212.896) * (-1211.446) (-1214.502) [-1212.171] (-1211.769) -- 0:00:18 707500 -- (-1213.619) [-1211.844] (-1213.491) (-1212.556) * [-1216.311] (-1212.592) (-1211.564) (-1211.679) -- 0:00:18 708000 -- (-1211.472) (-1211.659) [-1215.908] (-1213.140) * [-1213.478] (-1211.088) (-1212.726) (-1210.992) -- 0:00:18 708500 -- (-1212.522) [-1210.852] (-1213.669) (-1213.554) * (-1211.270) (-1211.020) [-1211.027] (-1217.528) -- 0:00:18 709000 -- (-1212.574) (-1211.804) (-1212.866) [-1211.880] * [-1211.105] (-1214.261) (-1211.000) (-1219.067) -- 0:00:18 709500 -- (-1211.102) [-1212.034] (-1211.456) (-1213.018) * [-1214.396] (-1214.359) (-1211.462) (-1214.473) -- 0:00:18 710000 -- [-1212.266] (-1211.716) (-1211.252) (-1216.739) * (-1214.723) [-1211.923] (-1211.130) (-1215.466) -- 0:00:18 Average standard deviation of split frequencies: 0.006426 710500 -- (-1214.790) (-1210.963) (-1211.797) [-1212.549] * (-1210.922) (-1211.613) [-1211.475] (-1214.158) -- 0:00:18 711000 -- (-1210.443) (-1213.094) (-1211.681) [-1213.098] * (-1213.820) (-1218.522) [-1212.329] (-1212.438) -- 0:00:18 711500 -- (-1213.795) [-1211.428] (-1210.440) (-1211.830) * (-1214.405) (-1210.790) [-1212.311] (-1212.760) -- 0:00:18 712000 -- (-1212.614) (-1214.701) (-1214.952) [-1212.537] * (-1212.516) (-1211.261) [-1210.511] (-1211.812) -- 0:00:18 712500 -- (-1215.754) [-1214.674] (-1216.199) (-1214.382) * (-1211.917) (-1212.114) (-1213.199) [-1210.428] -- 0:00:18 713000 -- (-1212.436) [-1211.940] (-1214.779) (-1211.383) * (-1211.161) (-1212.045) [-1212.275] (-1210.233) -- 0:00:18 713500 -- (-1212.283) (-1213.475) [-1214.271] (-1212.429) * (-1212.991) [-1212.383] (-1212.597) (-1210.214) -- 0:00:18 714000 -- (-1211.942) (-1211.477) [-1213.292] (-1213.799) * (-1210.578) (-1210.847) (-1212.856) [-1210.486] -- 0:00:18 714500 -- (-1216.235) (-1214.376) [-1210.410] (-1214.988) * (-1210.277) (-1211.912) (-1211.585) [-1213.610] -- 0:00:17 715000 -- [-1211.460] (-1214.967) (-1211.798) (-1214.253) * (-1211.557) [-1211.679] (-1213.155) (-1212.231) -- 0:00:17 Average standard deviation of split frequencies: 0.006419 715500 -- (-1211.742) (-1210.893) [-1211.074] (-1217.775) * (-1211.285) [-1213.048] (-1211.712) (-1213.386) -- 0:00:17 716000 -- (-1212.081) (-1210.981) [-1212.352] (-1213.549) * (-1212.092) (-1214.024) [-1211.223] (-1213.365) -- 0:00:17 716500 -- [-1212.471] (-1210.948) (-1212.530) (-1213.222) * (-1211.784) (-1213.977) (-1212.579) [-1213.059] -- 0:00:17 717000 -- (-1212.409) (-1211.318) (-1211.976) [-1212.924] * (-1220.037) [-1212.152] (-1214.199) (-1215.369) -- 0:00:17 717500 -- [-1213.750] (-1212.805) (-1212.251) (-1212.115) * (-1213.851) (-1212.401) [-1210.576] (-1211.534) -- 0:00:17 718000 -- (-1215.658) [-1212.293] (-1211.694) (-1212.559) * (-1211.982) (-1212.242) (-1213.120) [-1213.916] -- 0:00:17 718500 -- (-1213.844) (-1212.876) (-1211.151) [-1212.698] * (-1211.753) (-1214.607) [-1212.219] (-1213.701) -- 0:00:17 719000 -- (-1213.174) (-1212.309) (-1217.763) [-1210.676] * (-1211.840) (-1213.493) (-1212.352) [-1211.629] -- 0:00:17 719500 -- (-1210.529) [-1211.202] (-1215.800) (-1216.843) * (-1213.878) [-1210.938] (-1212.262) (-1210.624) -- 0:00:17 720000 -- (-1214.895) (-1213.340) (-1210.459) [-1214.023] * (-1212.131) (-1210.988) [-1211.687] (-1213.946) -- 0:00:17 Average standard deviation of split frequencies: 0.006173 720500 -- (-1211.897) (-1211.488) (-1210.435) [-1211.331] * (-1213.388) (-1213.566) [-1212.232] (-1211.997) -- 0:00:17 721000 -- (-1214.789) (-1212.349) [-1212.103] (-1214.601) * [-1210.526] (-1213.519) (-1214.713) (-1212.317) -- 0:00:17 721500 -- (-1217.350) (-1217.498) [-1213.244] (-1210.978) * (-1212.519) (-1214.258) (-1212.058) [-1212.170] -- 0:00:17 722000 -- (-1213.610) (-1213.224) [-1210.984] (-1211.577) * (-1213.040) (-1212.174) [-1211.336] (-1213.335) -- 0:00:17 722500 -- (-1216.505) [-1211.125] (-1211.970) (-1215.672) * [-1212.088] (-1216.121) (-1211.120) (-1211.673) -- 0:00:17 723000 -- (-1211.753) [-1210.392] (-1210.921) (-1215.520) * (-1212.717) (-1213.707) (-1212.942) [-1212.643] -- 0:00:17 723500 -- (-1211.876) [-1210.616] (-1213.434) (-1211.975) * (-1215.362) (-1214.436) (-1212.060) [-1215.353] -- 0:00:17 724000 -- (-1214.987) (-1210.584) (-1211.459) [-1215.602] * (-1213.611) (-1211.813) [-1211.361] (-1216.042) -- 0:00:17 724500 -- (-1212.218) [-1213.960] (-1211.148) (-1211.920) * (-1213.761) [-1212.786] (-1210.741) (-1214.810) -- 0:00:17 725000 -- [-1212.951] (-1212.621) (-1213.224) (-1211.145) * (-1211.643) [-1213.089] (-1211.853) (-1212.971) -- 0:00:17 Average standard deviation of split frequencies: 0.005966 725500 -- (-1212.591) [-1212.788] (-1212.000) (-1210.546) * [-1212.177] (-1212.938) (-1217.293) (-1212.989) -- 0:00:17 726000 -- (-1214.138) (-1212.913) [-1214.208] (-1215.538) * (-1214.262) (-1213.180) [-1213.689] (-1212.735) -- 0:00:17 726500 -- (-1212.349) (-1217.598) [-1211.449] (-1212.395) * (-1214.233) [-1211.673] (-1210.271) (-1211.094) -- 0:00:17 727000 -- (-1212.041) [-1212.839] (-1212.828) (-1210.511) * (-1212.209) (-1210.746) (-1214.432) [-1212.037] -- 0:00:17 727500 -- (-1211.454) [-1211.816] (-1212.326) (-1214.673) * (-1212.223) (-1212.869) (-1211.221) [-1212.122] -- 0:00:17 728000 -- [-1211.091] (-1212.375) (-1214.033) (-1212.457) * [-1211.204] (-1212.225) (-1212.834) (-1216.815) -- 0:00:17 728500 -- (-1212.077) [-1213.374] (-1211.639) (-1212.641) * (-1213.125) (-1210.455) (-1219.853) [-1213.732] -- 0:00:17 729000 -- (-1211.814) (-1211.646) (-1215.545) [-1211.572] * (-1218.298) [-1211.055] (-1212.086) (-1216.715) -- 0:00:17 729500 -- [-1215.295] (-1210.740) (-1215.265) (-1212.837) * (-1215.190) (-1211.855) (-1212.001) [-1216.371] -- 0:00:17 730000 -- (-1215.369) (-1210.987) [-1215.871] (-1212.592) * (-1213.220) (-1210.896) [-1213.471] (-1215.382) -- 0:00:17 Average standard deviation of split frequencies: 0.005807 730500 -- (-1215.721) [-1216.034] (-1213.235) (-1210.741) * (-1212.861) (-1211.270) [-1215.927] (-1212.168) -- 0:00:16 731000 -- (-1213.246) (-1210.942) [-1215.334] (-1211.754) * (-1212.661) (-1211.420) [-1212.699] (-1214.065) -- 0:00:16 731500 -- (-1212.048) [-1211.273] (-1215.803) (-1213.732) * (-1212.877) (-1210.902) [-1212.781] (-1212.345) -- 0:00:16 732000 -- [-1214.567] (-1213.545) (-1218.985) (-1212.635) * (-1214.627) (-1212.964) [-1213.462] (-1215.245) -- 0:00:16 732500 -- (-1211.918) (-1212.887) (-1216.793) [-1213.444] * (-1211.155) (-1212.844) [-1211.502] (-1213.866) -- 0:00:16 733000 -- (-1213.034) (-1214.197) (-1214.310) [-1214.740] * [-1213.384] (-1215.820) (-1214.688) (-1212.239) -- 0:00:16 733500 -- [-1215.491] (-1214.809) (-1212.338) (-1213.397) * (-1212.129) [-1212.226] (-1213.114) (-1211.827) -- 0:00:16 734000 -- (-1213.083) (-1212.180) [-1213.097] (-1211.747) * (-1214.306) (-1211.497) (-1212.788) [-1213.709] -- 0:00:16 734500 -- [-1211.320] (-1212.485) (-1213.656) (-1212.786) * (-1212.422) (-1211.952) [-1210.953] (-1213.689) -- 0:00:16 735000 -- (-1211.755) (-1213.833) (-1215.302) [-1214.238] * (-1213.757) [-1214.579] (-1213.033) (-1213.085) -- 0:00:16 Average standard deviation of split frequencies: 0.006165 735500 -- (-1211.121) (-1213.695) [-1211.863] (-1215.757) * [-1211.309] (-1212.333) (-1211.195) (-1212.229) -- 0:00:16 736000 -- (-1217.689) [-1212.028] (-1211.505) (-1212.283) * (-1213.770) [-1212.547] (-1212.566) (-1211.561) -- 0:00:16 736500 -- (-1214.639) (-1212.535) (-1212.399) [-1211.579] * (-1214.305) [-1211.434] (-1217.080) (-1214.440) -- 0:00:16 737000 -- (-1216.297) (-1212.753) (-1212.460) [-1211.447] * (-1210.444) (-1213.787) (-1216.006) [-1211.937] -- 0:00:16 737500 -- (-1216.090) [-1210.843] (-1212.202) (-1210.871) * (-1211.271) [-1213.694] (-1211.655) (-1212.654) -- 0:00:16 738000 -- [-1212.013] (-1212.056) (-1215.156) (-1212.085) * (-1213.115) (-1214.806) [-1212.204] (-1211.815) -- 0:00:16 738500 -- (-1212.732) (-1212.045) [-1212.563] (-1211.184) * (-1210.959) (-1211.220) [-1211.806] (-1212.343) -- 0:00:16 739000 -- (-1212.197) [-1213.604] (-1212.214) (-1215.223) * [-1213.272] (-1212.394) (-1211.670) (-1213.799) -- 0:00:16 739500 -- [-1212.275] (-1210.949) (-1216.662) (-1213.783) * (-1215.628) (-1211.277) (-1211.787) [-1212.700] -- 0:00:16 740000 -- [-1212.448] (-1216.430) (-1214.858) (-1212.097) * (-1211.537) [-1212.324] (-1215.265) (-1212.714) -- 0:00:16 Average standard deviation of split frequencies: 0.006449 740500 -- (-1214.080) [-1214.516] (-1215.645) (-1213.023) * (-1214.151) (-1212.707) [-1214.493] (-1211.089) -- 0:00:16 741000 -- (-1211.816) (-1211.427) [-1211.182] (-1214.762) * (-1214.344) (-1213.931) (-1212.152) [-1214.719] -- 0:00:16 741500 -- (-1215.876) [-1210.649] (-1213.672) (-1214.679) * (-1213.902) (-1211.857) (-1213.430) [-1212.397] -- 0:00:16 742000 -- (-1210.673) (-1210.724) [-1212.664] (-1211.116) * (-1220.531) [-1214.877] (-1212.621) (-1211.790) -- 0:00:16 742500 -- (-1210.696) [-1211.909] (-1212.988) (-1211.299) * (-1216.621) (-1212.845) (-1211.247) [-1210.546] -- 0:00:16 743000 -- [-1212.691] (-1213.749) (-1211.317) (-1211.926) * (-1211.345) [-1212.929] (-1212.172) (-1212.633) -- 0:00:16 743500 -- [-1213.300] (-1214.756) (-1212.267) (-1218.040) * (-1212.027) (-1213.516) (-1213.221) [-1213.335] -- 0:00:16 744000 -- [-1211.401] (-1214.742) (-1211.362) (-1218.874) * (-1211.940) [-1210.814] (-1215.034) (-1218.346) -- 0:00:16 744500 -- (-1211.827) (-1213.860) [-1212.595] (-1212.988) * (-1217.134) [-1210.571] (-1212.069) (-1218.446) -- 0:00:16 745000 -- [-1213.602] (-1211.671) (-1211.984) (-1212.190) * [-1211.633] (-1211.660) (-1211.344) (-1210.985) -- 0:00:16 Average standard deviation of split frequencies: 0.006614 745500 -- (-1213.237) (-1212.044) (-1214.694) [-1211.472] * [-1212.853] (-1212.180) (-1212.128) (-1211.208) -- 0:00:16 746000 -- (-1212.248) (-1211.488) (-1219.154) [-1211.426] * (-1214.575) [-1210.834] (-1211.223) (-1211.054) -- 0:00:16 746500 -- [-1214.222] (-1211.901) (-1212.181) (-1212.460) * (-1214.296) (-1211.192) [-1212.896] (-1210.715) -- 0:00:15 747000 -- (-1211.505) (-1214.092) (-1214.988) [-1211.020] * [-1212.089] (-1211.313) (-1216.538) (-1211.901) -- 0:00:15 747500 -- [-1211.664] (-1211.554) (-1212.467) (-1213.820) * (-1211.474) (-1211.668) (-1216.760) [-1213.492] -- 0:00:15 748000 -- [-1212.985] (-1211.285) (-1212.205) (-1213.546) * (-1211.816) (-1212.848) (-1212.016) [-1212.716] -- 0:00:15 748500 -- (-1211.011) (-1213.286) (-1213.186) [-1213.582] * (-1211.642) (-1217.469) [-1210.707] (-1212.036) -- 0:00:15 749000 -- (-1212.264) (-1211.387) (-1210.877) [-1210.903] * (-1212.660) (-1215.390) (-1211.551) [-1211.867] -- 0:00:15 749500 -- [-1215.437] (-1210.592) (-1212.629) (-1210.661) * (-1212.989) [-1212.949] (-1211.500) (-1213.222) -- 0:00:15 750000 -- (-1214.787) (-1210.682) (-1210.997) [-1213.891] * (-1211.717) (-1210.688) [-1212.942] (-1213.381) -- 0:00:15 Average standard deviation of split frequencies: 0.006405 750500 -- (-1214.244) (-1216.695) (-1213.835) [-1210.844] * (-1215.500) [-1210.719] (-1215.481) (-1215.368) -- 0:00:15 751000 -- (-1210.674) (-1212.470) [-1212.643] (-1213.331) * (-1213.564) [-1213.334] (-1215.588) (-1215.348) -- 0:00:15 751500 -- [-1212.070] (-1213.889) (-1213.488) (-1211.486) * (-1214.338) (-1212.943) (-1215.271) [-1214.340] -- 0:00:15 752000 -- (-1210.621) (-1211.660) [-1210.348] (-1220.023) * (-1210.694) (-1214.018) [-1213.606] (-1212.330) -- 0:00:15 752500 -- [-1210.838] (-1213.237) (-1210.625) (-1218.729) * (-1212.214) [-1210.876] (-1212.778) (-1211.919) -- 0:00:15 753000 -- [-1215.293] (-1212.017) (-1213.058) (-1213.646) * (-1212.348) (-1213.694) (-1213.164) [-1211.887] -- 0:00:15 753500 -- (-1216.313) (-1213.593) (-1214.146) [-1212.160] * (-1211.510) (-1214.166) [-1211.155] (-1213.366) -- 0:00:15 754000 -- (-1217.780) (-1210.980) [-1214.365] (-1213.048) * (-1211.363) [-1212.088] (-1210.192) (-1210.664) -- 0:00:15 754500 -- (-1211.073) (-1212.382) (-1211.522) [-1213.390] * [-1212.314] (-1212.223) (-1210.419) (-1213.681) -- 0:00:15 755000 -- (-1212.424) (-1211.309) (-1211.019) [-1212.161] * [-1212.716] (-1212.381) (-1210.551) (-1212.580) -- 0:00:15 Average standard deviation of split frequencies: 0.006942 755500 -- (-1218.018) [-1213.752] (-1211.137) (-1214.489) * [-1211.606] (-1212.057) (-1214.201) (-1211.776) -- 0:00:15 756000 -- [-1213.761] (-1211.589) (-1212.536) (-1212.605) * (-1211.196) (-1214.468) (-1212.608) [-1212.670] -- 0:00:15 756500 -- (-1212.145) (-1213.879) (-1214.527) [-1212.671] * (-1210.675) [-1210.541] (-1220.245) (-1211.358) -- 0:00:15 757000 -- (-1213.411) [-1211.424] (-1212.848) (-1215.149) * [-1210.495] (-1212.557) (-1212.523) (-1212.180) -- 0:00:15 757500 -- (-1213.268) (-1210.867) [-1214.652] (-1213.101) * (-1211.590) (-1214.775) [-1210.800] (-1211.694) -- 0:00:15 758000 -- (-1211.214) (-1212.908) (-1211.943) [-1215.732] * (-1211.301) (-1212.909) (-1211.639) [-1211.512] -- 0:00:15 758500 -- (-1210.698) (-1212.950) (-1212.554) [-1214.763] * (-1215.593) [-1214.357] (-1210.201) (-1211.450) -- 0:00:15 759000 -- (-1211.895) (-1213.720) (-1210.463) [-1212.068] * (-1212.154) [-1214.050] (-1211.503) (-1212.113) -- 0:00:15 759500 -- (-1217.956) (-1214.243) [-1212.092] (-1213.347) * (-1215.847) (-1215.711) [-1212.424] (-1214.126) -- 0:00:15 760000 -- (-1212.479) (-1213.567) (-1210.818) [-1215.008] * (-1216.359) (-1216.959) (-1214.335) [-1210.917] -- 0:00:15 Average standard deviation of split frequencies: 0.007602 760500 -- [-1212.211] (-1213.361) (-1212.190) (-1215.052) * [-1214.846] (-1212.013) (-1211.455) (-1210.679) -- 0:00:15 761000 -- (-1212.169) (-1210.941) [-1212.450] (-1214.322) * (-1213.117) [-1213.306] (-1216.463) (-1214.470) -- 0:00:15 761500 -- (-1213.004) (-1212.254) (-1211.723) [-1212.283] * (-1211.741) [-1215.716] (-1220.340) (-1219.698) -- 0:00:15 762000 -- (-1213.495) (-1217.845) [-1214.623] (-1212.075) * [-1212.074] (-1221.036) (-1214.129) (-1215.751) -- 0:00:14 762500 -- (-1212.164) (-1211.700) (-1213.021) [-1213.042] * [-1213.552] (-1216.189) (-1212.450) (-1211.980) -- 0:00:14 763000 -- [-1213.328] (-1215.306) (-1214.406) (-1215.214) * (-1212.563) (-1213.886) (-1212.330) [-1211.292] -- 0:00:14 763500 -- (-1212.049) (-1212.207) (-1213.844) [-1214.417] * (-1211.120) (-1211.481) (-1218.667) [-1210.763] -- 0:00:14 764000 -- (-1215.237) (-1211.349) [-1211.123] (-1212.445) * [-1213.857] (-1215.965) (-1213.728) (-1215.336) -- 0:00:14 764500 -- (-1211.746) (-1211.879) [-1212.595] (-1216.868) * (-1214.814) (-1211.868) [-1210.808] (-1212.956) -- 0:00:14 765000 -- [-1211.266] (-1212.313) (-1211.515) (-1211.375) * [-1212.666] (-1213.309) (-1212.224) (-1210.746) -- 0:00:14 Average standard deviation of split frequencies: 0.007918 765500 -- (-1211.676) (-1212.595) [-1212.286] (-1212.472) * [-1213.699] (-1212.315) (-1212.932) (-1212.911) -- 0:00:14 766000 -- (-1214.306) (-1215.857) [-1211.940] (-1212.122) * [-1212.537] (-1214.013) (-1212.713) (-1214.191) -- 0:00:14 766500 -- (-1212.030) (-1215.696) [-1214.047] (-1211.893) * (-1213.146) (-1217.077) (-1211.352) [-1210.541] -- 0:00:14 767000 -- (-1210.884) (-1212.810) [-1211.336] (-1210.940) * [-1212.239] (-1218.372) (-1212.448) (-1211.890) -- 0:00:14 767500 -- (-1212.947) (-1212.090) (-1212.024) [-1211.110] * [-1216.794] (-1216.068) (-1211.541) (-1212.591) -- 0:00:14 768000 -- [-1213.150] (-1214.595) (-1210.466) (-1211.674) * (-1212.902) (-1215.717) (-1211.137) [-1210.782] -- 0:00:14 768500 -- (-1213.117) (-1217.916) (-1210.515) [-1211.856] * [-1212.259] (-1213.136) (-1211.332) (-1210.772) -- 0:00:14 769000 -- (-1211.642) (-1215.341) (-1211.999) [-1212.231] * (-1211.547) [-1214.077] (-1214.853) (-1212.115) -- 0:00:14 769500 -- (-1214.342) [-1215.390] (-1212.467) (-1215.257) * (-1215.024) [-1216.229] (-1214.137) (-1211.093) -- 0:00:14 770000 -- (-1212.939) (-1215.393) [-1210.932] (-1211.283) * (-1214.871) (-1214.630) [-1212.317] (-1210.578) -- 0:00:14 Average standard deviation of split frequencies: 0.008482 770500 -- (-1215.193) (-1215.915) (-1214.438) [-1216.651] * (-1213.036) (-1214.469) [-1212.336] (-1215.236) -- 0:00:14 771000 -- [-1215.667] (-1213.199) (-1212.387) (-1214.250) * [-1215.650] (-1215.013) (-1212.061) (-1211.308) -- 0:00:14 771500 -- [-1215.373] (-1214.359) (-1212.758) (-1213.659) * (-1214.902) [-1212.346] (-1210.759) (-1215.876) -- 0:00:14 772000 -- (-1212.748) [-1215.934] (-1212.017) (-1213.283) * [-1215.192] (-1213.009) (-1211.015) (-1212.537) -- 0:00:14 772500 -- [-1211.950] (-1212.084) (-1214.134) (-1212.456) * (-1215.743) (-1211.565) [-1211.719] (-1211.885) -- 0:00:14 773000 -- [-1211.803] (-1214.533) (-1212.335) (-1212.137) * (-1214.100) (-1217.079) [-1211.162] (-1213.150) -- 0:00:14 773500 -- [-1211.025] (-1212.654) (-1210.546) (-1210.612) * (-1211.865) (-1214.457) [-1211.088] (-1212.888) -- 0:00:14 774000 -- (-1212.433) (-1215.797) (-1212.805) [-1211.962] * (-1214.855) (-1212.608) (-1212.961) [-1212.158] -- 0:00:14 774500 -- (-1210.369) (-1214.200) (-1213.917) [-1211.855] * (-1211.878) (-1211.582) [-1211.858] (-1211.606) -- 0:00:14 775000 -- [-1213.436] (-1213.517) (-1213.453) (-1214.515) * (-1210.804) (-1212.035) (-1213.955) [-1211.847] -- 0:00:14 Average standard deviation of split frequencies: 0.008140 775500 -- (-1210.379) (-1212.421) (-1212.554) [-1214.307] * (-1211.560) (-1211.712) [-1214.160] (-1212.019) -- 0:00:14 776000 -- (-1210.960) (-1213.039) [-1211.463] (-1212.215) * (-1212.249) (-1210.303) (-1214.007) [-1214.643] -- 0:00:14 776500 -- (-1211.544) (-1218.335) (-1212.700) [-1212.722] * [-1214.770] (-1211.398) (-1218.188) (-1215.881) -- 0:00:14 777000 -- (-1211.705) [-1212.954] (-1211.612) (-1214.716) * (-1212.163) (-1213.244) (-1210.300) [-1213.686] -- 0:00:14 777500 -- [-1212.478] (-1212.841) (-1211.529) (-1214.073) * (-1212.259) [-1210.579] (-1215.801) (-1211.631) -- 0:00:14 778000 -- (-1213.398) [-1215.386] (-1210.728) (-1214.206) * (-1210.580) (-1215.577) (-1216.513) [-1212.292] -- 0:00:13 778500 -- (-1211.560) (-1215.527) [-1210.806] (-1214.726) * [-1211.932] (-1214.693) (-1212.977) (-1211.761) -- 0:00:13 779000 -- (-1210.846) (-1211.242) [-1214.024] (-1210.883) * (-1212.817) [-1211.089] (-1211.643) (-1213.965) -- 0:00:13 779500 -- (-1211.677) [-1211.092] (-1221.678) (-1213.045) * (-1213.019) [-1210.716] (-1211.792) (-1215.426) -- 0:00:13 780000 -- (-1211.749) [-1211.673] (-1214.732) (-1210.936) * [-1215.225] (-1210.900) (-1213.178) (-1217.349) -- 0:00:13 Average standard deviation of split frequencies: 0.007729 780500 -- (-1211.609) (-1212.101) [-1211.214] (-1217.920) * (-1213.291) (-1210.971) [-1213.205] (-1212.800) -- 0:00:13 781000 -- [-1212.283] (-1213.717) (-1211.079) (-1214.120) * (-1212.129) [-1214.396] (-1210.333) (-1213.016) -- 0:00:13 781500 -- (-1216.298) (-1211.260) [-1211.083] (-1213.923) * [-1211.468] (-1211.783) (-1211.467) (-1214.727) -- 0:00:13 782000 -- (-1216.585) (-1213.760) [-1210.982] (-1212.497) * [-1212.392] (-1211.579) (-1211.977) (-1214.797) -- 0:00:13 782500 -- [-1213.949] (-1214.368) (-1213.525) (-1210.908) * (-1212.455) (-1211.450) (-1215.073) [-1211.471] -- 0:00:13 783000 -- (-1214.757) [-1212.624] (-1212.484) (-1214.023) * [-1213.056] (-1212.754) (-1211.581) (-1212.176) -- 0:00:13 783500 -- (-1215.601) [-1213.708] (-1213.052) (-1211.898) * (-1211.535) (-1213.066) [-1211.381] (-1214.806) -- 0:00:13 784000 -- (-1213.252) (-1212.205) (-1212.153) [-1211.900] * [-1212.279] (-1213.089) (-1212.077) (-1214.752) -- 0:00:13 784500 -- (-1210.615) (-1210.940) (-1211.187) [-1215.982] * [-1213.775] (-1213.724) (-1211.696) (-1211.980) -- 0:00:13 785000 -- [-1211.115] (-1213.384) (-1217.799) (-1215.370) * [-1211.414] (-1214.743) (-1212.673) (-1212.103) -- 0:00:13 Average standard deviation of split frequencies: 0.007757 785500 -- (-1211.278) (-1213.483) (-1212.255) [-1214.472] * (-1214.708) (-1212.539) [-1211.393] (-1212.965) -- 0:00:13 786000 -- (-1213.214) (-1211.427) (-1211.003) [-1214.475] * (-1215.857) (-1218.165) [-1211.495] (-1212.733) -- 0:00:13 786500 -- (-1213.775) (-1214.521) (-1214.658) [-1215.319] * (-1212.406) [-1212.517] (-1213.656) (-1219.741) -- 0:00:13 787000 -- [-1212.039] (-1210.868) (-1217.072) (-1211.861) * [-1213.590] (-1212.480) (-1212.294) (-1214.942) -- 0:00:13 787500 -- (-1211.565) [-1210.847] (-1212.453) (-1211.333) * [-1213.107] (-1212.486) (-1210.586) (-1211.023) -- 0:00:13 788000 -- [-1211.075] (-1210.713) (-1211.992) (-1212.548) * (-1214.273) (-1213.423) (-1212.281) [-1212.155] -- 0:00:13 788500 -- (-1211.339) (-1211.413) (-1211.377) [-1211.536] * (-1213.315) (-1210.997) (-1215.420) [-1213.257] -- 0:00:13 789000 -- (-1211.741) (-1211.829) (-1212.253) [-1211.051] * (-1210.783) (-1215.321) (-1214.453) [-1211.708] -- 0:00:13 789500 -- (-1213.669) [-1216.904] (-1212.363) (-1212.130) * [-1211.702] (-1213.848) (-1214.851) (-1215.669) -- 0:00:13 790000 -- (-1212.263) (-1216.466) (-1212.228) [-1211.804] * (-1211.651) (-1212.213) (-1212.118) [-1213.406] -- 0:00:13 Average standard deviation of split frequencies: 0.007989 790500 -- (-1211.144) (-1213.714) (-1211.712) [-1213.406] * [-1211.339] (-1215.322) (-1210.975) (-1211.548) -- 0:00:13 791000 -- (-1210.908) [-1213.590] (-1212.042) (-1212.704) * (-1213.559) [-1211.902] (-1214.344) (-1215.324) -- 0:00:13 791500 -- (-1210.364) (-1215.734) [-1214.410] (-1213.221) * (-1215.782) (-1212.216) (-1211.676) [-1211.731] -- 0:00:13 792000 -- [-1214.671] (-1212.082) (-1215.350) (-1213.289) * (-1212.936) (-1212.702) [-1213.991] (-1210.933) -- 0:00:13 792500 -- [-1211.856] (-1214.533) (-1212.734) (-1213.218) * (-1210.286) (-1210.250) (-1210.524) [-1211.628] -- 0:00:13 793000 -- (-1213.507) (-1213.835) (-1212.910) [-1210.788] * (-1211.315) (-1213.704) (-1210.573) [-1210.863] -- 0:00:13 793500 -- (-1212.701) (-1217.068) [-1212.228] (-1213.947) * (-1210.614) [-1216.391] (-1214.482) (-1210.574) -- 0:00:13 794000 -- (-1214.387) (-1214.257) (-1211.811) [-1214.562] * [-1212.643] (-1213.648) (-1216.813) (-1210.731) -- 0:00:12 794500 -- (-1214.304) (-1214.518) [-1211.673] (-1211.328) * (-1216.836) (-1214.292) [-1212.657] (-1211.439) -- 0:00:12 795000 -- (-1214.654) (-1212.174) [-1210.946] (-1217.555) * (-1212.160) (-1216.035) (-1213.130) [-1213.288] -- 0:00:12 Average standard deviation of split frequencies: 0.007501 795500 -- (-1212.703) (-1211.702) [-1211.779] (-1216.346) * (-1213.723) (-1215.749) (-1212.606) [-1212.990] -- 0:00:12 796000 -- (-1211.550) (-1212.858) (-1212.122) [-1210.557] * (-1217.147) (-1213.730) (-1210.793) [-1218.100] -- 0:00:12 796500 -- (-1214.215) (-1213.181) (-1211.722) [-1210.703] * (-1216.704) (-1211.407) (-1211.988) [-1216.371] -- 0:00:12 797000 -- (-1216.338) [-1213.175] (-1213.045) (-1213.053) * (-1215.516) (-1211.759) (-1211.576) [-1211.920] -- 0:00:12 797500 -- (-1213.201) [-1212.388] (-1212.682) (-1211.876) * (-1212.895) (-1212.360) (-1210.504) [-1212.372] -- 0:00:12 798000 -- (-1216.015) [-1212.860] (-1212.019) (-1212.022) * (-1213.753) [-1211.151] (-1212.374) (-1212.084) -- 0:00:12 798500 -- [-1214.367] (-1211.084) (-1213.018) (-1212.556) * (-1215.021) [-1210.731] (-1215.664) (-1214.319) -- 0:00:12 799000 -- [-1211.603] (-1214.035) (-1213.531) (-1215.490) * (-1214.745) (-1213.003) [-1211.606] (-1211.307) -- 0:00:12 799500 -- (-1212.635) (-1212.484) (-1212.802) [-1213.923] * [-1214.722] (-1215.788) (-1212.650) (-1211.123) -- 0:00:12 800000 -- (-1213.643) (-1213.108) [-1212.188] (-1215.127) * [-1211.244] (-1211.285) (-1212.897) (-1214.696) -- 0:00:12 Average standard deviation of split frequencies: 0.007497 800500 -- (-1217.658) (-1215.277) (-1212.244) [-1215.572] * (-1211.911) [-1216.337] (-1211.587) (-1211.603) -- 0:00:12 801000 -- (-1216.195) (-1213.762) (-1212.023) [-1213.123] * (-1212.966) (-1215.388) [-1214.301] (-1212.632) -- 0:00:12 801500 -- (-1210.684) (-1212.291) [-1213.241] (-1214.836) * (-1213.223) (-1215.333) [-1214.225] (-1211.362) -- 0:00:12 802000 -- (-1212.637) (-1211.406) [-1212.360] (-1214.802) * (-1213.076) (-1213.732) [-1210.817] (-1213.671) -- 0:00:12 802500 -- (-1214.656) (-1211.476) [-1212.120] (-1214.576) * (-1217.837) (-1214.698) [-1214.438] (-1211.227) -- 0:00:12 803000 -- (-1212.889) [-1211.279] (-1215.119) (-1213.333) * (-1215.496) [-1214.344] (-1211.589) (-1211.274) -- 0:00:12 803500 -- [-1214.616] (-1215.138) (-1212.404) (-1211.867) * (-1211.000) (-1215.132) [-1210.565] (-1211.633) -- 0:00:12 804000 -- (-1216.951) (-1213.275) [-1212.777] (-1212.972) * (-1215.189) [-1211.739] (-1211.824) (-1214.976) -- 0:00:12 804500 -- (-1211.575) (-1212.824) [-1211.773] (-1211.555) * (-1213.637) (-1212.046) [-1211.672] (-1213.662) -- 0:00:12 805000 -- (-1216.911) (-1211.391) (-1210.356) [-1214.016] * (-1213.296) (-1213.684) (-1213.604) [-1218.688] -- 0:00:12 Average standard deviation of split frequencies: 0.007447 805500 -- (-1216.840) (-1215.820) (-1210.942) [-1211.759] * [-1212.212] (-1211.080) (-1212.811) (-1213.071) -- 0:00:12 806000 -- [-1213.146] (-1212.621) (-1212.819) (-1211.325) * (-1211.530) [-1211.322] (-1212.848) (-1212.081) -- 0:00:12 806500 -- (-1212.577) (-1213.773) (-1212.326) [-1210.800] * (-1214.638) [-1214.757] (-1215.652) (-1211.469) -- 0:00:12 807000 -- (-1213.031) (-1212.785) (-1214.862) [-1211.369] * (-1214.628) (-1210.526) (-1214.904) [-1210.959] -- 0:00:12 807500 -- (-1211.010) [-1210.406] (-1212.390) (-1212.524) * (-1211.266) (-1212.068) (-1213.180) [-1210.652] -- 0:00:12 808000 -- [-1212.622] (-1214.306) (-1212.834) (-1212.933) * (-1212.074) [-1212.540] (-1212.337) (-1213.544) -- 0:00:12 808500 -- (-1211.999) [-1212.447] (-1211.309) (-1212.294) * (-1210.201) (-1220.886) [-1211.751] (-1211.329) -- 0:00:12 809000 -- (-1212.736) (-1212.251) (-1213.696) [-1212.821] * [-1210.940] (-1212.828) (-1211.458) (-1213.133) -- 0:00:12 809500 -- [-1210.779] (-1211.591) (-1211.292) (-1210.998) * (-1212.119) (-1215.047) (-1213.269) [-1216.350] -- 0:00:12 810000 -- (-1213.271) [-1213.122] (-1213.351) (-1211.548) * [-1212.453] (-1212.845) (-1212.416) (-1212.055) -- 0:00:11 Average standard deviation of split frequencies: 0.007443 810500 -- (-1211.998) (-1213.687) [-1212.035] (-1214.456) * [-1211.127] (-1217.881) (-1213.633) (-1215.428) -- 0:00:11 811000 -- (-1212.217) [-1214.523] (-1212.111) (-1212.984) * (-1210.770) [-1217.706] (-1213.086) (-1212.321) -- 0:00:11 811500 -- (-1210.571) (-1214.815) (-1211.175) [-1216.011] * (-1211.192) (-1212.722) (-1210.617) [-1211.309] -- 0:00:11 812000 -- (-1211.900) (-1210.985) [-1210.655] (-1213.133) * (-1212.091) (-1211.898) (-1211.823) [-1213.777] -- 0:00:11 812500 -- (-1212.168) (-1213.310) [-1210.404] (-1213.473) * [-1211.752] (-1215.831) (-1210.873) (-1213.678) -- 0:00:11 813000 -- (-1211.430) (-1215.879) (-1213.762) [-1213.314] * (-1213.556) [-1213.270] (-1211.933) (-1213.782) -- 0:00:11 813500 -- (-1214.347) (-1214.503) (-1213.306) [-1211.369] * (-1214.119) (-1212.755) [-1212.291] (-1216.437) -- 0:00:11 814000 -- [-1214.709] (-1211.108) (-1213.275) (-1211.763) * [-1211.451] (-1214.172) (-1212.599) (-1217.310) -- 0:00:11 814500 -- [-1211.239] (-1211.421) (-1210.936) (-1211.441) * (-1210.677) [-1213.885] (-1217.083) (-1211.236) -- 0:00:11 815000 -- (-1215.486) [-1214.017] (-1211.761) (-1211.206) * (-1215.551) [-1210.667] (-1214.564) (-1213.365) -- 0:00:11 Average standard deviation of split frequencies: 0.007510 815500 -- [-1213.365] (-1212.251) (-1212.193) (-1211.191) * (-1213.440) (-1215.496) (-1214.167) [-1210.415] -- 0:00:11 816000 -- (-1217.962) [-1212.924] (-1215.330) (-1211.274) * (-1214.243) (-1211.932) (-1214.880) [-1212.092] -- 0:00:11 816500 -- (-1215.863) (-1212.984) [-1212.435] (-1210.957) * (-1212.300) (-1215.950) [-1213.228] (-1211.282) -- 0:00:11 817000 -- (-1215.556) (-1212.578) (-1213.276) [-1213.047] * (-1214.195) (-1214.559) [-1212.127] (-1214.486) -- 0:00:11 817500 -- [-1217.169] (-1212.270) (-1213.734) (-1213.359) * (-1212.182) (-1211.792) [-1212.813] (-1214.205) -- 0:00:11 818000 -- (-1214.291) (-1210.838) (-1211.044) [-1212.562] * (-1212.681) [-1215.228] (-1216.210) (-1214.410) -- 0:00:11 818500 -- (-1214.978) (-1211.735) (-1210.976) [-1212.895] * (-1214.724) (-1211.814) (-1217.197) [-1214.026] -- 0:00:11 819000 -- [-1210.527] (-1213.009) (-1214.650) (-1212.813) * (-1212.127) (-1212.982) [-1216.822] (-1212.696) -- 0:00:11 819500 -- (-1215.562) (-1213.789) (-1214.022) [-1212.558] * [-1211.228] (-1212.074) (-1214.202) (-1212.425) -- 0:00:11 820000 -- [-1214.888] (-1211.870) (-1211.631) (-1213.051) * (-1211.879) (-1212.362) [-1212.897] (-1212.421) -- 0:00:11 Average standard deviation of split frequencies: 0.007429 820500 -- (-1216.563) (-1211.165) [-1217.126] (-1213.768) * (-1218.273) (-1213.534) (-1212.026) [-1211.606] -- 0:00:11 821000 -- (-1213.142) [-1211.040] (-1216.591) (-1213.118) * (-1213.637) (-1216.914) [-1210.839] (-1212.760) -- 0:00:11 821500 -- (-1213.541) (-1213.814) [-1214.408] (-1211.524) * [-1213.135] (-1213.472) (-1211.718) (-1215.880) -- 0:00:11 822000 -- (-1213.041) (-1217.657) [-1214.296] (-1214.174) * (-1211.496) [-1212.325] (-1214.800) (-1216.520) -- 0:00:11 822500 -- (-1214.991) [-1213.718] (-1211.413) (-1214.548) * (-1214.745) [-1212.316] (-1215.928) (-1212.971) -- 0:00:11 823000 -- (-1212.258) (-1211.880) [-1212.320] (-1210.388) * (-1212.301) (-1212.905) (-1211.752) [-1213.366] -- 0:00:11 823500 -- [-1212.996] (-1215.157) (-1213.326) (-1215.120) * (-1211.796) (-1215.861) [-1211.356] (-1211.363) -- 0:00:11 824000 -- (-1210.719) (-1213.697) [-1211.017] (-1217.667) * (-1211.607) (-1213.866) (-1211.356) [-1212.136] -- 0:00:11 824500 -- [-1210.617] (-1212.486) (-1215.939) (-1213.655) * (-1211.970) (-1213.507) [-1218.365] (-1210.796) -- 0:00:11 825000 -- (-1212.857) (-1212.079) [-1210.595] (-1212.280) * (-1212.435) (-1214.191) [-1211.495] (-1211.814) -- 0:00:11 Average standard deviation of split frequencies: 0.007838 825500 -- (-1211.817) (-1213.256) (-1213.214) [-1212.337] * [-1216.744] (-1214.214) (-1211.142) (-1210.859) -- 0:00:10 826000 -- [-1214.037] (-1212.248) (-1211.029) (-1214.097) * (-1211.802) (-1213.201) [-1211.539] (-1211.108) -- 0:00:10 826500 -- (-1211.583) (-1213.522) (-1211.979) [-1211.522] * (-1213.631) (-1211.522) (-1212.989) [-1211.791] -- 0:00:10 827000 -- [-1214.017] (-1214.537) (-1213.873) (-1211.513) * (-1211.537) (-1210.822) [-1212.188] (-1210.590) -- 0:00:10 827500 -- (-1216.390) (-1212.088) [-1212.629] (-1211.742) * (-1215.395) [-1212.944] (-1210.458) (-1212.612) -- 0:00:10 828000 -- [-1220.885] (-1216.599) (-1211.513) (-1213.700) * [-1212.552] (-1211.699) (-1212.571) (-1211.260) -- 0:00:10 828500 -- (-1216.132) [-1213.935] (-1214.118) (-1212.458) * (-1211.643) (-1218.537) [-1213.071] (-1213.513) -- 0:00:10 829000 -- [-1218.284] (-1215.751) (-1215.299) (-1215.683) * (-1211.598) (-1214.247) [-1212.813] (-1214.448) -- 0:00:10 829500 -- (-1213.581) (-1216.423) [-1213.332] (-1215.124) * (-1211.947) [-1214.914] (-1211.762) (-1211.755) -- 0:00:10 830000 -- (-1213.720) (-1213.385) [-1211.902] (-1213.894) * (-1212.855) (-1213.830) (-1211.749) [-1210.977] -- 0:00:10 Average standard deviation of split frequencies: 0.007680 830500 -- (-1214.898) (-1214.760) [-1213.674] (-1213.272) * (-1216.441) (-1212.052) (-1212.438) [-1210.653] -- 0:00:10 831000 -- (-1212.496) (-1212.716) (-1218.590) [-1214.527] * (-1213.050) [-1211.684] (-1211.679) (-1210.952) -- 0:00:10 831500 -- (-1213.384) (-1214.267) [-1211.471] (-1214.699) * (-1211.461) (-1213.015) [-1212.283] (-1213.046) -- 0:00:10 832000 -- [-1211.822] (-1214.356) (-1212.498) (-1213.891) * (-1213.468) (-1211.920) (-1214.276) [-1211.741] -- 0:00:10 832500 -- (-1213.999) [-1211.960] (-1213.834) (-1213.015) * [-1212.568] (-1212.256) (-1213.850) (-1214.750) -- 0:00:10 833000 -- [-1210.937] (-1215.876) (-1212.491) (-1212.341) * (-1214.214) [-1210.703] (-1213.075) (-1212.388) -- 0:00:10 833500 -- (-1214.875) (-1211.578) (-1212.224) [-1213.095] * (-1213.314) [-1210.799] (-1213.625) (-1214.795) -- 0:00:10 834000 -- (-1212.242) (-1219.340) [-1211.593] (-1210.363) * (-1218.599) (-1212.158) [-1210.458] (-1212.338) -- 0:00:10 834500 -- (-1213.062) [-1213.191] (-1212.141) (-1215.282) * (-1214.341) [-1211.349] (-1219.337) (-1213.726) -- 0:00:10 835000 -- (-1219.932) (-1214.223) [-1213.949] (-1211.932) * (-1212.701) (-1213.123) [-1211.644] (-1214.626) -- 0:00:10 Average standard deviation of split frequencies: 0.007180 835500 -- (-1216.380) [-1211.254] (-1212.961) (-1214.521) * (-1216.656) [-1214.284] (-1211.383) (-1213.575) -- 0:00:10 836000 -- [-1210.831] (-1211.580) (-1213.250) (-1216.816) * (-1211.764) (-1210.890) (-1213.918) [-1212.606] -- 0:00:10 836500 -- (-1213.175) (-1211.205) (-1214.352) [-1211.770] * [-1211.631] (-1210.149) (-1210.872) (-1211.095) -- 0:00:10 837000 -- (-1213.914) (-1210.634) [-1214.456] (-1213.166) * (-1211.248) [-1210.200] (-1210.872) (-1214.862) -- 0:00:10 837500 -- (-1213.394) (-1211.719) (-1212.898) [-1211.842] * [-1210.687] (-1217.558) (-1213.585) (-1215.385) -- 0:00:10 838000 -- (-1211.539) (-1216.403) [-1211.676] (-1214.376) * (-1215.150) (-1214.189) (-1214.454) [-1211.100] -- 0:00:10 838500 -- (-1211.585) (-1214.225) [-1211.458] (-1213.587) * [-1213.522] (-1211.858) (-1213.413) (-1215.514) -- 0:00:10 839000 -- (-1210.794) [-1212.902] (-1214.204) (-1215.249) * (-1211.141) (-1212.059) (-1214.013) [-1214.974] -- 0:00:10 839500 -- (-1213.069) (-1211.174) [-1211.739] (-1212.128) * (-1213.920) [-1212.456] (-1214.606) (-1213.418) -- 0:00:10 840000 -- (-1213.649) (-1212.246) (-1211.105) [-1214.419] * [-1213.156] (-1211.894) (-1213.463) (-1213.402) -- 0:00:10 Average standard deviation of split frequencies: 0.007477 840500 -- (-1215.857) (-1214.233) [-1210.643] (-1211.609) * [-1212.188] (-1211.135) (-1214.342) (-1215.829) -- 0:00:10 841000 -- (-1213.464) [-1211.153] (-1212.211) (-1210.532) * (-1211.335) [-1213.215] (-1212.374) (-1213.452) -- 0:00:10 841500 -- [-1213.489] (-1216.203) (-1210.949) (-1216.505) * (-1212.399) (-1211.859) (-1214.139) [-1213.562] -- 0:00:09 842000 -- (-1212.471) (-1211.804) [-1211.402] (-1216.129) * (-1216.266) [-1214.199] (-1215.102) (-1212.838) -- 0:00:09 842500 -- (-1214.571) (-1212.266) [-1212.660] (-1215.892) * (-1214.104) (-1211.098) (-1212.815) [-1216.771] -- 0:00:09 843000 -- (-1211.498) (-1211.226) [-1212.158] (-1212.597) * (-1214.403) (-1212.275) (-1211.308) [-1217.673] -- 0:00:09 843500 -- (-1212.097) [-1214.305] (-1213.049) (-1212.102) * (-1212.086) (-1214.791) [-1211.717] (-1212.917) -- 0:00:09 844000 -- (-1214.324) (-1216.858) [-1213.129] (-1211.714) * [-1211.781] (-1213.036) (-1211.444) (-1210.762) -- 0:00:09 844500 -- (-1212.738) [-1212.070] (-1213.165) (-1213.705) * (-1211.218) [-1213.360] (-1212.356) (-1212.946) -- 0:00:09 845000 -- (-1210.835) (-1214.495) (-1210.834) [-1214.631] * [-1212.313] (-1211.358) (-1214.389) (-1214.784) -- 0:00:09 Average standard deviation of split frequencies: 0.007430 845500 -- (-1214.145) (-1216.778) [-1211.123] (-1211.308) * (-1212.372) [-1213.422] (-1211.801) (-1212.648) -- 0:00:09 846000 -- [-1212.717] (-1214.422) (-1211.800) (-1211.971) * (-1213.745) (-1211.610) (-1211.402) [-1213.599] -- 0:00:09 846500 -- (-1210.833) (-1212.628) (-1213.844) [-1215.289] * (-1214.478) (-1212.077) (-1213.458) [-1212.077] -- 0:00:09 847000 -- (-1210.734) (-1212.531) [-1212.471] (-1213.659) * (-1214.662) (-1212.087) [-1212.030] (-1211.567) -- 0:00:09 847500 -- (-1213.069) [-1211.311] (-1212.805) (-1212.781) * [-1219.857] (-1211.483) (-1211.638) (-1214.087) -- 0:00:09 848000 -- (-1216.209) (-1211.630) [-1215.676] (-1213.081) * (-1219.023) [-1210.973] (-1210.469) (-1212.466) -- 0:00:09 848500 -- (-1211.208) (-1215.379) (-1215.241) [-1212.683] * (-1213.593) (-1213.771) (-1211.691) [-1210.597] -- 0:00:09 849000 -- [-1211.654] (-1213.679) (-1210.565) (-1216.211) * (-1214.026) (-1213.049) [-1213.840] (-1210.662) -- 0:00:09 849500 -- (-1212.776) (-1210.884) [-1211.745] (-1211.134) * (-1213.598) (-1214.338) (-1211.879) [-1210.829] -- 0:00:09 850000 -- (-1212.965) (-1214.252) (-1211.749) [-1213.682] * (-1215.143) (-1217.573) [-1212.228] (-1210.872) -- 0:00:09 Average standard deviation of split frequencies: 0.007463 850500 -- (-1213.131) (-1212.918) (-1214.037) [-1212.315] * (-1214.838) (-1213.057) [-1211.551] (-1213.341) -- 0:00:09 851000 -- [-1213.826] (-1212.739) (-1211.205) (-1213.144) * (-1212.760) [-1210.306] (-1211.175) (-1213.036) -- 0:00:09 851500 -- (-1214.514) (-1214.905) [-1211.865] (-1215.221) * (-1215.912) [-1211.628] (-1210.400) (-1214.772) -- 0:00:09 852000 -- (-1211.816) [-1212.501] (-1216.121) (-1211.772) * (-1211.802) [-1211.088] (-1216.037) (-1214.187) -- 0:00:09 852500 -- [-1211.254] (-1212.242) (-1211.629) (-1211.209) * (-1213.478) [-1212.362] (-1211.060) (-1214.754) -- 0:00:09 853000 -- (-1212.629) [-1214.802] (-1213.042) (-1212.481) * [-1212.226] (-1214.852) (-1212.691) (-1213.745) -- 0:00:09 853500 -- (-1213.302) (-1213.029) (-1215.069) [-1212.574] * (-1211.676) [-1212.942] (-1211.953) (-1212.494) -- 0:00:09 854000 -- (-1211.673) (-1210.931) [-1211.339] (-1212.138) * [-1212.870] (-1216.148) (-1210.347) (-1214.422) -- 0:00:09 854500 -- (-1211.235) (-1214.599) (-1211.520) [-1210.733] * (-1213.303) (-1211.391) (-1214.131) [-1212.958] -- 0:00:09 855000 -- (-1218.142) [-1212.171] (-1212.672) (-1214.115) * (-1212.441) (-1211.947) (-1212.292) [-1211.488] -- 0:00:09 Average standard deviation of split frequencies: 0.007233 855500 -- (-1210.938) [-1213.051] (-1213.087) (-1211.302) * (-1212.479) (-1211.947) [-1212.090] (-1210.684) -- 0:00:09 856000 -- (-1211.735) (-1211.410) (-1214.639) [-1211.499] * [-1211.340] (-1212.175) (-1211.227) (-1211.216) -- 0:00:09 856500 -- [-1212.876] (-1211.744) (-1211.011) (-1211.055) * [-1212.253] (-1210.229) (-1213.451) (-1212.018) -- 0:00:09 857000 -- (-1213.331) [-1210.503] (-1212.297) (-1214.376) * (-1210.249) (-1215.972) (-1211.713) [-1210.408] -- 0:00:09 857500 -- (-1215.322) (-1215.342) [-1214.189] (-1212.587) * [-1211.741] (-1210.521) (-1214.658) (-1212.387) -- 0:00:08 858000 -- [-1213.825] (-1218.998) (-1212.290) (-1212.463) * (-1211.284) (-1210.857) (-1213.931) [-1211.521] -- 0:00:08 858500 -- (-1211.508) [-1211.880] (-1213.301) (-1211.809) * (-1213.859) (-1210.751) [-1213.784] (-1213.721) -- 0:00:08 859000 -- (-1215.522) (-1212.525) [-1213.777] (-1213.127) * (-1214.783) [-1210.798] (-1213.344) (-1215.323) -- 0:00:08 859500 -- (-1212.266) [-1211.537] (-1211.306) (-1211.973) * [-1212.645] (-1211.848) (-1216.261) (-1213.222) -- 0:00:08 860000 -- [-1210.857] (-1211.382) (-1211.681) (-1211.931) * (-1213.418) [-1214.782] (-1213.354) (-1214.195) -- 0:00:08 Average standard deviation of split frequencies: 0.007668 860500 -- [-1211.313] (-1210.414) (-1212.686) (-1212.142) * (-1212.285) (-1211.952) [-1212.387] (-1211.821) -- 0:00:08 861000 -- [-1210.247] (-1211.456) (-1213.117) (-1211.146) * (-1212.111) [-1212.295] (-1212.987) (-1212.894) -- 0:00:08 861500 -- (-1211.046) [-1214.459] (-1210.678) (-1212.903) * (-1213.073) (-1214.018) (-1211.980) [-1210.831] -- 0:00:08 862000 -- [-1213.321] (-1211.936) (-1213.734) (-1213.388) * (-1213.396) [-1212.217] (-1213.901) (-1211.491) -- 0:00:08 862500 -- [-1212.764] (-1211.177) (-1213.633) (-1212.662) * [-1213.200] (-1212.787) (-1210.387) (-1211.440) -- 0:00:08 863000 -- (-1213.596) (-1211.480) [-1212.718] (-1213.828) * (-1212.968) [-1214.364] (-1211.835) (-1212.208) -- 0:00:08 863500 -- (-1211.101) (-1214.872) (-1212.132) [-1212.444] * (-1217.317) (-1212.542) (-1212.648) [-1212.223] -- 0:00:08 864000 -- (-1213.141) [-1212.083] (-1211.772) (-1210.969) * (-1216.143) (-1211.400) [-1212.359] (-1217.020) -- 0:00:08 864500 -- [-1211.636] (-1213.683) (-1212.993) (-1210.842) * (-1213.321) (-1212.602) [-1214.215] (-1216.817) -- 0:00:08 865000 -- (-1216.012) [-1214.625] (-1211.598) (-1210.795) * (-1210.327) (-1214.094) (-1212.388) [-1215.969] -- 0:00:08 Average standard deviation of split frequencies: 0.007875 865500 -- [-1211.681] (-1212.198) (-1210.172) (-1210.637) * [-1210.878] (-1213.186) (-1213.276) (-1210.685) -- 0:00:08 866000 -- [-1214.517] (-1211.755) (-1216.845) (-1213.362) * (-1214.467) (-1211.391) (-1212.941) [-1211.651] -- 0:00:08 866500 -- (-1212.023) (-1214.083) (-1211.883) [-1210.769] * [-1213.262] (-1212.329) (-1211.647) (-1214.750) -- 0:00:08 867000 -- (-1213.978) [-1212.181] (-1211.938) (-1218.121) * (-1212.799) (-1212.008) (-1211.546) [-1212.581] -- 0:00:08 867500 -- (-1212.372) [-1214.543] (-1214.464) (-1212.368) * [-1212.234] (-1212.098) (-1211.358) (-1212.517) -- 0:00:08 868000 -- [-1212.346] (-1212.396) (-1216.101) (-1214.379) * (-1214.550) (-1212.889) [-1211.447] (-1211.056) -- 0:00:08 868500 -- (-1212.106) (-1214.128) (-1211.354) [-1211.664] * [-1213.859] (-1211.443) (-1214.699) (-1212.207) -- 0:00:08 869000 -- (-1211.692) (-1215.984) [-1211.225] (-1213.476) * (-1211.187) (-1214.605) [-1216.678] (-1213.072) -- 0:00:08 869500 -- [-1216.043] (-1213.359) (-1214.643) (-1213.484) * (-1213.184) (-1216.228) (-1214.263) [-1213.081] -- 0:00:08 870000 -- [-1215.983] (-1213.082) (-1214.273) (-1211.077) * (-1212.328) [-1214.834] (-1213.980) (-1212.010) -- 0:00:08 Average standard deviation of split frequencies: 0.007580 870500 -- (-1211.633) (-1213.017) (-1212.414) [-1211.698] * (-1211.384) (-1218.643) [-1213.607] (-1213.573) -- 0:00:08 871000 -- (-1213.056) (-1211.690) (-1211.797) [-1213.585] * (-1211.157) (-1211.049) (-1214.187) [-1212.203] -- 0:00:08 871500 -- (-1215.168) (-1212.146) [-1211.892] (-1211.011) * (-1212.340) (-1211.588) (-1216.743) [-1212.645] -- 0:00:08 872000 -- (-1218.044) [-1215.751] (-1212.300) (-1212.393) * (-1211.651) [-1211.383] (-1216.311) (-1212.056) -- 0:00:08 872500 -- (-1213.811) [-1213.016] (-1214.796) (-1214.277) * (-1211.870) [-1215.863] (-1215.103) (-1210.562) -- 0:00:08 873000 -- (-1212.071) (-1214.685) (-1213.077) [-1212.090] * [-1212.615] (-1213.923) (-1211.318) (-1211.583) -- 0:00:08 873500 -- (-1215.166) [-1213.292] (-1214.304) (-1215.264) * (-1212.122) (-1211.469) [-1212.448] (-1210.801) -- 0:00:07 874000 -- [-1212.121] (-1213.121) (-1211.964) (-1214.282) * (-1214.904) (-1212.615) (-1214.220) [-1210.994] -- 0:00:07 874500 -- (-1211.057) (-1211.613) [-1214.475] (-1217.118) * (-1215.191) (-1212.833) [-1215.480] (-1212.459) -- 0:00:07 875000 -- (-1211.102) (-1212.171) [-1213.881] (-1215.515) * [-1213.765] (-1210.933) (-1210.690) (-1215.293) -- 0:00:07 Average standard deviation of split frequencies: 0.007534 875500 -- (-1215.301) (-1216.438) (-1213.127) [-1212.385] * (-1210.830) (-1210.772) [-1210.839] (-1211.271) -- 0:00:07 876000 -- [-1213.228] (-1214.395) (-1212.029) (-1216.593) * (-1215.395) (-1213.087) (-1212.179) [-1213.306] -- 0:00:07 876500 -- (-1212.854) (-1212.562) (-1212.123) [-1212.553] * [-1212.837] (-1211.982) (-1212.313) (-1212.451) -- 0:00:07 877000 -- (-1214.078) [-1212.420] (-1214.708) (-1218.157) * (-1214.899) (-1211.806) (-1211.468) [-1213.725] -- 0:00:07 877500 -- (-1215.948) [-1211.113] (-1213.566) (-1213.782) * (-1215.823) (-1212.061) [-1212.455] (-1211.319) -- 0:00:07 878000 -- (-1214.173) [-1212.366] (-1212.908) (-1214.679) * (-1215.155) [-1212.162] (-1214.907) (-1210.874) -- 0:00:07 878500 -- (-1214.168) (-1211.649) [-1212.315] (-1216.416) * (-1213.878) (-1215.236) [-1212.770] (-1211.994) -- 0:00:07 879000 -- (-1211.877) [-1210.667] (-1210.990) (-1217.304) * (-1210.705) (-1216.957) (-1212.580) [-1210.693] -- 0:00:07 879500 -- (-1213.042) (-1213.554) [-1211.539] (-1213.955) * (-1211.083) [-1211.104] (-1216.728) (-1213.406) -- 0:00:07 880000 -- [-1213.092] (-1213.219) (-1211.234) (-1212.150) * (-1210.921) [-1214.216] (-1211.677) (-1212.099) -- 0:00:07 Average standard deviation of split frequencies: 0.007494 880500 -- [-1210.643] (-1213.920) (-1212.898) (-1212.150) * (-1211.738) (-1212.083) [-1211.486] (-1211.744) -- 0:00:07 881000 -- (-1212.627) (-1212.674) (-1213.384) [-1212.673] * (-1210.609) (-1215.480) (-1214.500) [-1213.287] -- 0:00:07 881500 -- [-1212.855] (-1212.673) (-1211.577) (-1212.408) * (-1210.517) (-1210.780) (-1214.487) [-1211.023] -- 0:00:07 882000 -- (-1213.714) [-1213.522] (-1212.471) (-1210.994) * (-1213.538) (-1211.392) [-1214.573] (-1217.038) -- 0:00:07 882500 -- [-1214.859] (-1217.022) (-1214.343) (-1214.956) * (-1212.098) (-1211.976) [-1214.910] (-1215.252) -- 0:00:07 883000 -- (-1213.724) (-1216.907) (-1212.470) [-1210.502] * (-1213.601) (-1213.005) [-1214.630] (-1214.797) -- 0:00:07 883500 -- (-1212.063) [-1212.012] (-1211.632) (-1210.490) * (-1213.031) (-1212.120) (-1212.557) [-1211.873] -- 0:00:07 884000 -- (-1214.532) [-1210.902] (-1211.732) (-1211.770) * (-1213.641) [-1219.482] (-1211.499) (-1211.420) -- 0:00:07 884500 -- (-1211.687) (-1213.382) (-1213.094) [-1214.916] * (-1215.249) (-1220.260) [-1213.636] (-1211.301) -- 0:00:07 885000 -- [-1211.621] (-1215.033) (-1213.692) (-1211.963) * (-1213.678) [-1212.205] (-1215.044) (-1210.995) -- 0:00:07 Average standard deviation of split frequencies: 0.007910 885500 -- (-1212.530) (-1212.498) (-1211.158) [-1210.488] * [-1212.626] (-1214.175) (-1210.901) (-1211.092) -- 0:00:07 886000 -- [-1212.476] (-1212.374) (-1214.661) (-1211.372) * [-1211.932] (-1212.007) (-1210.844) (-1212.754) -- 0:00:07 886500 -- (-1211.681) (-1212.113) (-1212.044) [-1212.866] * [-1212.100] (-1214.838) (-1211.775) (-1211.898) -- 0:00:07 887000 -- (-1211.082) (-1212.775) [-1212.216] (-1210.633) * (-1212.477) (-1215.532) [-1211.098] (-1215.776) -- 0:00:07 887500 -- [-1212.005] (-1215.056) (-1211.294) (-1211.269) * (-1213.432) [-1211.853] (-1211.115) (-1211.132) -- 0:00:07 888000 -- (-1212.794) (-1212.450) (-1215.688) [-1213.303] * (-1212.575) (-1211.306) [-1210.649] (-1213.967) -- 0:00:07 888500 -- (-1212.093) [-1213.865] (-1216.277) (-1215.268) * (-1213.555) (-1214.521) [-1213.596] (-1213.734) -- 0:00:07 889000 -- (-1212.286) (-1215.854) [-1211.827] (-1212.642) * [-1214.198] (-1211.886) (-1214.192) (-1213.891) -- 0:00:06 889500 -- (-1211.119) (-1211.976) [-1214.000] (-1213.369) * (-1217.234) (-1210.861) (-1215.019) [-1214.634] -- 0:00:06 890000 -- [-1211.857] (-1212.354) (-1213.545) (-1215.682) * (-1216.009) (-1212.505) [-1211.692] (-1211.425) -- 0:00:06 Average standard deviation of split frequencies: 0.007339 890500 -- [-1212.795] (-1211.374) (-1213.994) (-1215.152) * [-1217.112] (-1211.761) (-1211.837) (-1213.400) -- 0:00:06 891000 -- (-1211.398) [-1214.413] (-1211.931) (-1215.588) * (-1212.467) (-1212.631) (-1211.803) [-1214.577] -- 0:00:06 891500 -- (-1210.671) (-1214.576) (-1212.523) [-1215.893] * [-1212.659] (-1212.649) (-1211.818) (-1212.213) -- 0:00:06 892000 -- (-1211.483) (-1211.772) (-1214.251) [-1212.402] * (-1214.295) (-1212.655) (-1214.530) [-1212.385] -- 0:00:06 892500 -- (-1213.726) (-1211.757) (-1216.503) [-1212.745] * (-1213.954) (-1213.059) (-1211.523) [-1212.313] -- 0:00:06 893000 -- (-1211.309) [-1211.841] (-1213.856) (-1211.281) * (-1215.654) (-1212.612) [-1212.679] (-1210.352) -- 0:00:06 893500 -- (-1215.875) [-1212.632] (-1212.584) (-1214.279) * (-1213.182) (-1216.163) (-1212.435) [-1212.536] -- 0:00:06 894000 -- (-1213.525) (-1212.464) (-1217.123) [-1212.871] * (-1213.194) (-1218.071) (-1212.655) [-1210.545] -- 0:00:06 894500 -- (-1212.072) (-1211.028) [-1212.929] (-1223.248) * (-1212.830) [-1211.537] (-1212.207) (-1212.592) -- 0:00:06 895000 -- (-1215.790) (-1212.065) [-1211.098] (-1213.365) * [-1217.418] (-1212.775) (-1210.838) (-1211.738) -- 0:00:06 Average standard deviation of split frequencies: 0.007225 895500 -- (-1212.941) (-1212.709) (-1211.655) [-1211.482] * (-1215.210) (-1218.033) (-1217.010) [-1213.536] -- 0:00:06 896000 -- [-1215.936] (-1218.170) (-1214.146) (-1213.256) * (-1212.596) (-1224.064) [-1211.172] (-1211.259) -- 0:00:06 896500 -- (-1210.931) [-1213.079] (-1210.905) (-1214.227) * (-1212.189) [-1211.958] (-1212.630) (-1210.862) -- 0:00:06 897000 -- (-1212.928) (-1211.766) [-1210.448] (-1215.462) * (-1214.306) (-1213.333) (-1214.811) [-1210.606] -- 0:00:06 897500 -- (-1213.926) (-1212.225) (-1210.535) [-1210.749] * (-1213.659) (-1212.021) (-1214.738) [-1211.290] -- 0:00:06 898000 -- (-1211.580) [-1211.538] (-1213.033) (-1214.526) * [-1213.295] (-1212.802) (-1211.265) (-1213.161) -- 0:00:06 898500 -- [-1212.860] (-1212.056) (-1212.954) (-1216.098) * (-1211.158) [-1210.631] (-1213.677) (-1216.381) -- 0:00:06 899000 -- (-1213.038) (-1217.766) [-1211.038] (-1212.106) * (-1210.692) (-1210.520) (-1214.035) [-1211.479] -- 0:00:06 899500 -- (-1212.884) [-1216.936] (-1215.027) (-1212.515) * (-1211.217) [-1211.984] (-1213.162) (-1210.820) -- 0:00:06 900000 -- (-1217.191) (-1212.469) [-1213.113] (-1213.926) * (-1215.172) [-1212.718] (-1217.230) (-1213.229) -- 0:00:06 Average standard deviation of split frequencies: 0.007293 900500 -- (-1217.791) (-1211.772) [-1213.417] (-1214.255) * (-1211.935) [-1215.745] (-1213.626) (-1214.868) -- 0:00:06 901000 -- (-1213.483) [-1212.912] (-1212.421) (-1213.217) * [-1213.300] (-1211.946) (-1213.414) (-1215.226) -- 0:00:06 901500 -- [-1213.141] (-1212.145) (-1213.520) (-1214.447) * [-1214.608] (-1213.415) (-1211.979) (-1213.911) -- 0:00:06 902000 -- (-1213.435) (-1212.954) (-1213.887) [-1214.671] * (-1214.616) [-1213.222] (-1211.350) (-1212.989) -- 0:00:06 902500 -- (-1218.933) (-1213.810) (-1213.841) [-1210.698] * (-1213.733) (-1210.481) [-1212.619] (-1217.790) -- 0:00:06 903000 -- (-1218.166) (-1214.033) (-1212.876) [-1210.874] * [-1210.557] (-1211.583) (-1215.727) (-1213.083) -- 0:00:06 903500 -- (-1212.819) [-1210.766] (-1212.161) (-1213.328) * (-1213.511) [-1213.853] (-1213.072) (-1213.668) -- 0:00:06 904000 -- [-1216.514] (-1211.363) (-1211.433) (-1213.494) * [-1216.184] (-1214.690) (-1211.450) (-1213.670) -- 0:00:06 904500 -- (-1212.370) (-1211.771) [-1210.503] (-1215.653) * (-1216.511) (-1213.199) (-1211.970) [-1214.825] -- 0:00:06 905000 -- (-1212.609) [-1212.272] (-1212.384) (-1215.552) * (-1212.025) (-1211.334) (-1215.462) [-1212.434] -- 0:00:05 Average standard deviation of split frequencies: 0.007215 905500 -- [-1213.258] (-1213.813) (-1210.718) (-1213.633) * (-1219.679) (-1210.956) [-1211.179] (-1216.602) -- 0:00:05 906000 -- (-1211.957) (-1212.044) (-1214.358) [-1211.323] * (-1215.994) [-1210.773] (-1212.042) (-1216.110) -- 0:00:05 906500 -- [-1213.341] (-1212.090) (-1214.120) (-1212.068) * (-1212.859) [-1210.745] (-1212.293) (-1213.854) -- 0:00:05 907000 -- [-1213.559] (-1217.775) (-1215.111) (-1213.664) * (-1214.816) (-1210.773) [-1214.865] (-1214.203) -- 0:00:05 907500 -- (-1211.777) (-1214.101) (-1215.022) [-1210.895] * (-1214.521) (-1211.383) (-1214.810) [-1214.827] -- 0:00:05 908000 -- (-1216.152) (-1213.630) (-1215.141) [-1211.059] * [-1211.435] (-1210.653) (-1211.513) (-1216.804) -- 0:00:05 908500 -- (-1211.199) (-1212.754) (-1215.773) [-1211.704] * (-1212.850) (-1211.889) [-1212.068] (-1214.875) -- 0:00:05 909000 -- (-1211.553) [-1210.323] (-1216.555) (-1211.229) * (-1214.784) (-1212.247) [-1212.505] (-1214.552) -- 0:00:05 909500 -- [-1211.555] (-1212.364) (-1215.563) (-1210.690) * (-1214.338) [-1212.523] (-1215.556) (-1212.266) -- 0:00:05 910000 -- (-1213.417) (-1211.532) [-1211.126] (-1211.292) * (-1216.274) [-1212.301] (-1211.666) (-1215.619) -- 0:00:05 Average standard deviation of split frequencies: 0.006833 910500 -- (-1213.724) (-1210.989) (-1215.229) [-1210.756] * (-1213.887) (-1211.793) (-1210.916) [-1212.665] -- 0:00:05 911000 -- [-1211.870] (-1210.805) (-1211.009) (-1210.997) * (-1215.602) (-1212.346) (-1215.753) [-1211.303] -- 0:00:05 911500 -- [-1210.218] (-1213.278) (-1217.605) (-1211.414) * [-1214.673] (-1218.793) (-1215.466) (-1211.842) -- 0:00:05 912000 -- [-1213.458] (-1215.104) (-1211.378) (-1211.685) * (-1212.698) (-1218.809) [-1211.292] (-1214.036) -- 0:00:05 912500 -- [-1216.882] (-1213.974) (-1210.583) (-1212.498) * (-1213.233) (-1211.249) (-1212.333) [-1210.458] -- 0:00:05 913000 -- (-1213.327) (-1211.829) (-1214.082) [-1212.854] * (-1219.012) [-1212.074] (-1211.995) (-1216.803) -- 0:00:05 913500 -- (-1212.556) [-1211.235] (-1213.591) (-1213.629) * (-1217.088) [-1212.720] (-1215.038) (-1211.546) -- 0:00:05 914000 -- (-1211.082) [-1211.334] (-1213.721) (-1211.971) * (-1214.250) (-1211.578) [-1214.456] (-1214.628) -- 0:00:05 914500 -- (-1211.178) [-1212.783] (-1215.115) (-1211.720) * (-1213.364) (-1211.868) [-1213.405] (-1210.977) -- 0:00:05 915000 -- (-1213.881) (-1211.508) (-1218.033) [-1210.996] * (-1214.610) [-1210.945] (-1215.859) (-1212.992) -- 0:00:05 Average standard deviation of split frequencies: 0.006656 915500 -- (-1211.760) [-1212.338] (-1213.887) (-1212.864) * (-1216.948) (-1211.602) (-1212.920) [-1213.148] -- 0:00:05 916000 -- (-1211.733) (-1214.320) [-1211.288] (-1214.284) * (-1211.062) (-1216.832) [-1213.486] (-1215.853) -- 0:00:05 916500 -- (-1213.618) (-1214.020) [-1213.795] (-1212.408) * [-1211.568] (-1211.814) (-1211.030) (-1211.500) -- 0:00:05 917000 -- (-1222.454) [-1212.312] (-1211.755) (-1214.372) * [-1211.741] (-1215.783) (-1213.431) (-1211.094) -- 0:00:05 917500 -- (-1212.902) (-1212.237) (-1211.969) [-1213.633] * [-1210.727] (-1217.665) (-1212.576) (-1211.047) -- 0:00:05 918000 -- (-1211.803) (-1211.168) [-1212.467] (-1212.275) * (-1212.069) (-1212.940) [-1211.745] (-1214.847) -- 0:00:05 918500 -- (-1214.557) (-1211.388) (-1213.844) [-1215.772] * (-1214.951) [-1211.532] (-1216.825) (-1213.520) -- 0:00:05 919000 -- (-1213.381) (-1212.918) (-1218.093) [-1212.946] * (-1214.120) [-1213.237] (-1214.408) (-1211.751) -- 0:00:05 919500 -- [-1215.812] (-1215.073) (-1211.870) (-1213.331) * [-1213.914] (-1212.604) (-1212.138) (-1211.454) -- 0:00:05 920000 -- (-1210.772) (-1216.424) [-1212.549] (-1213.373) * [-1211.762] (-1217.293) (-1211.851) (-1213.760) -- 0:00:05 Average standard deviation of split frequencies: 0.006452 920500 -- (-1210.416) (-1213.163) (-1212.585) [-1213.040] * [-1215.096] (-1211.411) (-1214.996) (-1212.286) -- 0:00:05 921000 -- (-1212.559) [-1213.870] (-1215.526) (-1212.771) * [-1213.629] (-1212.818) (-1211.867) (-1212.741) -- 0:00:04 921500 -- (-1212.724) [-1212.267] (-1212.984) (-1213.377) * (-1212.457) (-1212.496) (-1215.883) [-1214.699] -- 0:00:04 922000 -- (-1213.256) (-1210.961) (-1211.313) [-1213.923] * (-1213.126) (-1213.270) [-1212.585] (-1214.331) -- 0:00:04 922500 -- (-1213.778) (-1211.701) (-1212.000) [-1212.151] * (-1217.185) (-1213.233) (-1211.284) [-1210.843] -- 0:00:04 923000 -- (-1215.022) (-1213.035) (-1212.453) [-1213.764] * (-1210.943) (-1211.817) (-1212.564) [-1213.523] -- 0:00:04 923500 -- (-1212.738) (-1212.213) [-1211.387] (-1215.060) * (-1212.489) (-1212.701) (-1212.404) [-1212.123] -- 0:00:04 924000 -- [-1214.988] (-1215.725) (-1212.617) (-1213.548) * (-1212.393) (-1212.562) [-1212.600] (-1210.710) -- 0:00:04 924500 -- (-1214.543) (-1215.773) [-1211.062] (-1214.743) * (-1212.134) (-1212.514) (-1213.221) [-1210.848] -- 0:00:04 925000 -- (-1222.046) [-1212.060] (-1215.851) (-1214.436) * [-1211.870] (-1211.290) (-1212.883) (-1210.991) -- 0:00:04 Average standard deviation of split frequencies: 0.006448 925500 -- [-1212.265] (-1213.249) (-1210.892) (-1213.248) * (-1212.372) (-1212.329) [-1213.652] (-1212.967) -- 0:00:04 926000 -- [-1214.533] (-1213.905) (-1211.008) (-1212.801) * [-1211.573] (-1213.333) (-1214.479) (-1211.223) -- 0:00:04 926500 -- (-1214.106) (-1214.099) [-1212.266] (-1214.064) * [-1214.059] (-1212.419) (-1214.162) (-1210.928) -- 0:00:04 927000 -- [-1211.742] (-1211.723) (-1211.896) (-1213.410) * (-1214.957) [-1211.696] (-1215.050) (-1211.541) -- 0:00:04 927500 -- [-1215.840] (-1211.161) (-1214.015) (-1213.963) * (-1212.743) [-1210.886] (-1211.378) (-1213.244) -- 0:00:04 928000 -- (-1217.471) [-1211.790] (-1213.055) (-1210.930) * (-1212.378) [-1213.398] (-1216.421) (-1213.918) -- 0:00:04 928500 -- (-1216.130) (-1211.331) (-1214.334) [-1211.818] * [-1211.580] (-1211.570) (-1214.909) (-1217.459) -- 0:00:04 929000 -- [-1210.970] (-1211.726) (-1213.973) (-1212.585) * (-1213.647) (-1211.272) (-1217.236) [-1213.241] -- 0:00:04 929500 -- (-1212.255) (-1212.757) (-1213.473) [-1211.624] * [-1215.747] (-1214.763) (-1212.250) (-1213.623) -- 0:00:04 930000 -- [-1212.636] (-1212.674) (-1211.326) (-1210.155) * (-1213.203) [-1212.171] (-1212.549) (-1213.410) -- 0:00:04 Average standard deviation of split frequencies: 0.006619 930500 -- (-1214.459) (-1212.039) (-1213.420) [-1212.846] * (-1214.509) (-1211.841) [-1211.907] (-1213.383) -- 0:00:04 931000 -- (-1212.163) (-1213.137) [-1211.965] (-1212.053) * (-1213.218) [-1214.110] (-1211.857) (-1212.113) -- 0:00:04 931500 -- (-1211.068) [-1210.204] (-1212.553) (-1211.680) * (-1211.629) [-1212.335] (-1212.440) (-1211.681) -- 0:00:04 932000 -- (-1212.271) [-1211.417] (-1214.655) (-1211.764) * (-1218.540) (-1217.070) (-1212.208) [-1213.293] -- 0:00:04 932500 -- (-1211.001) (-1210.916) (-1214.561) [-1211.790] * (-1213.986) [-1212.525] (-1212.378) (-1213.594) -- 0:00:04 933000 -- (-1210.912) [-1211.303] (-1213.760) (-1212.863) * [-1213.158] (-1212.430) (-1211.353) (-1213.502) -- 0:00:04 933500 -- [-1213.777] (-1212.204) (-1211.773) (-1213.919) * (-1215.161) (-1212.798) [-1212.010] (-1215.785) -- 0:00:04 934000 -- [-1212.288] (-1212.220) (-1210.835) (-1213.109) * (-1213.914) (-1212.804) (-1211.071) [-1215.359] -- 0:00:04 934500 -- (-1212.055) [-1212.367] (-1211.602) (-1211.735) * (-1211.611) (-1211.413) [-1214.267] (-1213.175) -- 0:00:04 935000 -- [-1212.046] (-1211.985) (-1211.708) (-1212.730) * [-1213.535] (-1215.401) (-1217.934) (-1214.085) -- 0:00:04 Average standard deviation of split frequencies: 0.006581 935500 -- (-1212.262) (-1213.152) (-1210.902) [-1212.921] * [-1216.024] (-1213.075) (-1214.556) (-1210.533) -- 0:00:04 936000 -- (-1214.822) (-1213.517) (-1213.063) [-1212.302] * (-1213.711) [-1212.046] (-1211.514) (-1210.539) -- 0:00:04 936500 -- (-1210.876) (-1214.104) [-1211.692] (-1214.387) * (-1214.703) (-1211.812) [-1211.105] (-1211.448) -- 0:00:04 937000 -- (-1211.284) (-1211.364) (-1212.056) [-1214.154] * (-1211.588) (-1212.332) (-1211.181) [-1214.289] -- 0:00:03 937500 -- (-1211.599) [-1212.244] (-1215.102) (-1211.915) * (-1215.274) (-1211.299) (-1211.491) [-1214.443] -- 0:00:03 938000 -- (-1211.400) (-1210.199) (-1212.491) [-1211.626] * [-1213.973] (-1211.319) (-1215.249) (-1212.215) -- 0:00:03 938500 -- (-1210.700) (-1214.272) (-1211.925) [-1210.854] * [-1215.848] (-1214.680) (-1216.154) (-1210.903) -- 0:00:03 939000 -- (-1215.733) (-1216.597) (-1210.754) [-1215.200] * (-1219.209) [-1216.373] (-1212.894) (-1215.368) -- 0:00:03 939500 -- [-1210.697] (-1214.778) (-1210.799) (-1213.710) * [-1212.915] (-1213.982) (-1216.125) (-1211.232) -- 0:00:03 940000 -- (-1212.236) (-1211.997) (-1211.904) [-1211.110] * (-1211.321) (-1211.897) [-1214.295] (-1211.278) -- 0:00:03 Average standard deviation of split frequencies: 0.006749 940500 -- (-1212.325) (-1213.720) (-1211.965) [-1211.052] * (-1211.917) (-1214.605) (-1215.240) [-1213.789] -- 0:00:03 941000 -- (-1214.305) (-1212.043) (-1214.614) [-1211.414] * (-1211.731) [-1216.433] (-1216.132) (-1210.959) -- 0:00:03 941500 -- [-1212.622] (-1211.797) (-1213.334) (-1213.898) * (-1213.849) (-1213.029) (-1212.026) [-1214.199] -- 0:00:03 942000 -- (-1211.551) [-1211.208] (-1216.214) (-1213.444) * (-1212.690) (-1211.362) (-1215.638) [-1211.585] -- 0:00:03 942500 -- [-1211.807] (-1211.844) (-1216.539) (-1216.939) * [-1212.493] (-1213.114) (-1213.704) (-1212.050) -- 0:00:03 943000 -- (-1214.770) (-1211.694) [-1213.023] (-1212.507) * [-1212.102] (-1213.039) (-1210.521) (-1211.689) -- 0:00:03 943500 -- (-1213.047) [-1212.992] (-1214.176) (-1212.115) * (-1215.023) (-1215.919) [-1211.863] (-1211.505) -- 0:00:03 944000 -- (-1212.351) (-1212.200) (-1212.578) [-1211.971] * (-1213.163) (-1214.080) (-1214.112) [-1212.167] -- 0:00:03 944500 -- (-1210.491) (-1210.758) (-1213.880) [-1213.040] * (-1212.927) (-1212.612) [-1211.521] (-1212.230) -- 0:00:03 945000 -- [-1211.274] (-1211.756) (-1218.517) (-1212.155) * (-1213.292) (-1212.857) [-1215.054] (-1212.697) -- 0:00:03 Average standard deviation of split frequencies: 0.007010 945500 -- (-1211.727) [-1211.291] (-1214.683) (-1213.066) * [-1213.166] (-1216.897) (-1214.160) (-1215.546) -- 0:00:03 946000 -- (-1210.801) (-1212.810) (-1215.367) [-1211.203] * (-1215.852) (-1210.892) [-1211.352] (-1214.851) -- 0:00:03 946500 -- (-1210.798) [-1213.981] (-1211.651) (-1215.198) * (-1213.829) (-1212.406) [-1211.611] (-1214.960) -- 0:00:03 947000 -- (-1211.949) (-1214.757) (-1211.447) [-1213.705] * (-1211.669) [-1210.989] (-1219.198) (-1216.605) -- 0:00:03 947500 -- (-1211.697) (-1216.662) (-1211.406) [-1212.812] * (-1211.899) [-1212.452] (-1214.497) (-1214.453) -- 0:00:03 948000 -- (-1211.683) (-1215.668) [-1210.917] (-1211.636) * (-1212.331) (-1213.600) [-1211.237] (-1214.559) -- 0:00:03 948500 -- (-1214.471) [-1212.762] (-1213.923) (-1211.760) * (-1213.523) (-1213.215) (-1211.294) [-1211.696] -- 0:00:03 949000 -- (-1212.640) (-1211.083) (-1213.421) [-1213.907] * (-1220.521) (-1215.265) (-1215.675) [-1213.530] -- 0:00:03 949500 -- (-1214.281) [-1212.652] (-1212.810) (-1212.618) * (-1211.707) (-1212.904) [-1211.549] (-1218.033) -- 0:00:03 950000 -- (-1211.314) (-1212.138) [-1210.602] (-1214.532) * (-1212.067) (-1212.025) [-1211.331] (-1213.291) -- 0:00:03 Average standard deviation of split frequencies: 0.006942 950500 -- (-1212.545) (-1210.618) [-1211.706] (-1211.285) * (-1214.621) [-1211.722] (-1214.978) (-1214.781) -- 0:00:03 951000 -- (-1211.544) (-1210.851) [-1213.026] (-1211.100) * (-1212.887) [-1211.643] (-1211.495) (-1211.819) -- 0:00:03 951500 -- [-1215.385] (-1212.965) (-1213.492) (-1214.621) * (-1213.378) (-1211.177) [-1211.738] (-1213.654) -- 0:00:03 952000 -- (-1211.483) [-1211.330] (-1211.335) (-1213.185) * (-1214.551) (-1212.568) [-1213.236] (-1211.988) -- 0:00:03 952500 -- [-1211.233] (-1211.934) (-1210.873) (-1211.638) * (-1212.917) (-1212.500) (-1214.057) [-1214.121] -- 0:00:02 953000 -- (-1211.532) (-1217.977) [-1212.774] (-1211.953) * (-1210.859) [-1216.483] (-1215.641) (-1213.274) -- 0:00:02 953500 -- [-1213.986] (-1211.633) (-1211.960) (-1212.065) * (-1212.368) (-1213.266) [-1211.253] (-1212.538) -- 0:00:02 954000 -- (-1215.906) [-1213.647] (-1210.459) (-1210.891) * (-1215.497) (-1211.551) (-1211.629) [-1210.671] -- 0:00:02 954500 -- (-1214.883) (-1215.450) [-1215.667] (-1213.111) * (-1212.552) (-1211.996) (-1211.518) [-1211.541] -- 0:00:02 955000 -- (-1216.660) (-1217.827) (-1217.772) [-1211.504] * [-1211.221] (-1214.595) (-1212.165) (-1212.083) -- 0:00:02 Average standard deviation of split frequencies: 0.006969 955500 -- [-1215.234] (-1216.100) (-1213.604) (-1211.041) * (-1212.469) (-1212.295) (-1211.708) [-1212.916] -- 0:00:02 956000 -- (-1210.906) (-1216.648) (-1211.332) [-1211.319] * [-1211.197] (-1212.243) (-1212.538) (-1214.224) -- 0:00:02 956500 -- (-1210.455) (-1213.426) (-1213.412) [-1213.815] * (-1211.202) (-1211.888) (-1212.455) [-1212.256] -- 0:00:02 957000 -- (-1213.641) [-1210.995] (-1213.867) (-1212.092) * (-1215.015) (-1212.334) [-1212.473] (-1218.119) -- 0:00:02 957500 -- (-1211.641) [-1210.553] (-1211.330) (-1215.234) * [-1212.912] (-1217.298) (-1211.906) (-1211.680) -- 0:00:02 958000 -- (-1214.095) [-1212.080] (-1211.078) (-1213.136) * (-1212.933) [-1211.216] (-1216.416) (-1211.314) -- 0:00:02 958500 -- (-1210.639) (-1211.923) [-1210.739] (-1211.157) * (-1210.981) (-1212.450) (-1214.622) [-1211.338] -- 0:00:02 959000 -- (-1212.191) (-1216.051) [-1213.827] (-1212.045) * [-1210.819] (-1212.450) (-1214.394) (-1211.627) -- 0:00:02 959500 -- [-1212.347] (-1212.374) (-1211.860) (-1213.392) * (-1211.250) [-1212.303] (-1213.843) (-1215.328) -- 0:00:02 960000 -- (-1211.634) [-1212.915] (-1213.864) (-1213.547) * [-1211.398] (-1218.324) (-1212.885) (-1211.893) -- 0:00:02 Average standard deviation of split frequencies: 0.006641 960500 -- (-1211.015) (-1214.725) [-1212.398] (-1214.463) * (-1218.256) [-1220.201] (-1212.500) (-1212.350) -- 0:00:02 961000 -- (-1210.907) (-1211.663) (-1211.196) [-1214.122] * (-1221.101) [-1214.814] (-1213.716) (-1213.056) -- 0:00:02 961500 -- [-1211.769] (-1213.463) (-1212.238) (-1214.073) * (-1217.354) (-1213.109) (-1212.522) [-1213.560] -- 0:00:02 962000 -- (-1212.942) [-1212.108] (-1212.020) (-1214.373) * (-1216.006) (-1214.663) (-1210.608) [-1211.001] -- 0:00:02 962500 -- (-1212.181) (-1211.646) (-1211.816) [-1214.652] * (-1211.640) (-1213.160) [-1211.704] (-1211.782) -- 0:00:02 963000 -- (-1214.531) (-1214.330) (-1217.016) [-1212.829] * (-1211.788) [-1213.067] (-1212.929) (-1214.753) -- 0:00:02 963500 -- (-1212.674) (-1213.982) (-1212.053) [-1210.621] * (-1212.732) (-1213.275) (-1215.960) [-1212.948] -- 0:00:02 964000 -- (-1210.962) (-1214.333) [-1212.163] (-1213.463) * (-1211.612) [-1213.507] (-1213.225) (-1212.846) -- 0:00:02 964500 -- [-1213.129] (-1215.846) (-1212.453) (-1214.077) * (-1212.674) (-1215.776) [-1214.225] (-1215.873) -- 0:00:02 965000 -- (-1214.906) [-1214.016] (-1211.945) (-1212.009) * (-1215.478) (-1213.979) (-1214.590) [-1218.583] -- 0:00:02 Average standard deviation of split frequencies: 0.007625 965500 -- (-1219.961) (-1212.544) (-1210.995) [-1213.535] * (-1212.415) (-1214.671) [-1210.628] (-1212.539) -- 0:00:02 966000 -- (-1214.496) (-1211.942) (-1213.240) [-1213.412] * (-1211.741) (-1214.663) [-1213.283] (-1215.569) -- 0:00:02 966500 -- (-1213.326) [-1211.983] (-1211.083) (-1212.516) * (-1214.312) (-1215.556) [-1215.567] (-1212.386) -- 0:00:02 967000 -- [-1212.584] (-1211.395) (-1214.494) (-1214.229) * [-1211.273] (-1213.931) (-1213.713) (-1213.288) -- 0:00:02 967500 -- (-1211.469) (-1212.178) [-1212.957] (-1214.255) * (-1215.660) (-1212.931) (-1213.733) [-1211.966] -- 0:00:02 968000 -- [-1210.257] (-1211.969) (-1221.513) (-1212.201) * (-1220.103) (-1212.915) (-1215.221) [-1212.844] -- 0:00:02 968500 -- (-1211.563) [-1212.594] (-1221.182) (-1213.558) * (-1217.846) [-1212.445] (-1210.468) (-1213.282) -- 0:00:01 969000 -- (-1211.872) (-1213.409) (-1213.190) [-1213.005] * (-1213.751) [-1211.404] (-1216.864) (-1211.682) -- 0:00:01 969500 -- (-1214.187) (-1211.000) (-1217.028) [-1211.723] * (-1217.843) (-1211.402) [-1216.377] (-1217.244) -- 0:00:01 970000 -- (-1212.018) (-1212.823) [-1213.732] (-1213.404) * [-1219.496] (-1213.236) (-1213.630) (-1211.206) -- 0:00:01 Average standard deviation of split frequencies: 0.007406 970500 -- (-1212.414) (-1212.895) [-1211.877] (-1212.130) * (-1212.780) [-1216.201] (-1210.969) (-1212.204) -- 0:00:01 971000 -- (-1211.734) (-1212.353) [-1216.056] (-1211.608) * (-1214.430) (-1213.841) [-1211.584] (-1211.482) -- 0:00:01 971500 -- (-1212.069) [-1211.074] (-1210.849) (-1212.749) * (-1213.896) (-1211.621) [-1211.802] (-1210.645) -- 0:00:01 972000 -- [-1213.567] (-1214.093) (-1211.537) (-1212.843) * (-1214.494) [-1211.649] (-1211.956) (-1211.554) -- 0:00:01 972500 -- [-1212.671] (-1211.307) (-1211.500) (-1213.288) * [-1211.377] (-1215.036) (-1212.738) (-1214.217) -- 0:00:01 973000 -- (-1212.480) (-1215.274) [-1212.961] (-1210.508) * (-1211.661) (-1217.366) [-1213.468] (-1213.450) -- 0:00:01 973500 -- (-1215.979) (-1213.592) (-1214.159) [-1214.956] * (-1212.237) (-1215.789) (-1212.609) [-1213.140] -- 0:00:01 974000 -- (-1213.635) [-1210.515] (-1210.413) (-1214.494) * (-1213.570) (-1216.539) [-1212.387] (-1212.801) -- 0:00:01 974500 -- (-1215.026) [-1214.367] (-1214.016) (-1211.327) * (-1215.374) (-1213.940) (-1211.932) [-1210.494] -- 0:00:01 975000 -- (-1215.433) (-1210.261) (-1211.498) [-1211.684] * (-1213.546) (-1212.322) (-1212.187) [-1216.207] -- 0:00:01 Average standard deviation of split frequencies: 0.007305 975500 -- (-1215.453) [-1210.320] (-1211.563) (-1214.161) * (-1211.344) (-1213.242) (-1212.383) [-1211.484] -- 0:00:01 976000 -- (-1213.349) [-1212.876] (-1214.012) (-1211.926) * (-1212.541) [-1211.711] (-1211.145) (-1211.275) -- 0:00:01 976500 -- [-1211.513] (-1212.144) (-1211.998) (-1213.272) * (-1212.083) [-1212.476] (-1210.450) (-1212.600) -- 0:00:01 977000 -- [-1211.531] (-1211.387) (-1213.022) (-1211.426) * (-1213.778) (-1214.815) (-1211.818) [-1212.718] -- 0:00:01 977500 -- (-1212.792) (-1212.929) [-1211.860] (-1211.565) * (-1213.367) (-1216.368) (-1210.899) [-1213.835] -- 0:00:01 978000 -- (-1211.172) (-1210.862) [-1213.079] (-1214.337) * (-1215.258) (-1211.157) [-1213.796] (-1211.239) -- 0:00:01 978500 -- (-1213.272) (-1212.180) (-1216.343) [-1211.775] * (-1214.826) (-1212.738) [-1214.745] (-1211.099) -- 0:00:01 979000 -- [-1213.167] (-1212.659) (-1212.428) (-1212.566) * [-1211.849] (-1210.939) (-1211.060) (-1212.905) -- 0:00:01 979500 -- (-1210.329) (-1215.395) (-1216.686) [-1214.772] * (-1218.305) [-1211.010] (-1211.901) (-1219.870) -- 0:00:01 980000 -- [-1213.375] (-1214.220) (-1213.570) (-1210.852) * (-1221.541) [-1212.141] (-1217.333) (-1214.856) -- 0:00:01 Average standard deviation of split frequencies: 0.007271 980500 -- [-1212.205] (-1214.370) (-1215.081) (-1212.737) * (-1213.947) [-1211.693] (-1211.959) (-1214.101) -- 0:00:01 981000 -- (-1212.617) (-1215.090) (-1215.038) [-1211.642] * (-1211.886) [-1213.411] (-1212.740) (-1212.449) -- 0:00:01 981500 -- (-1214.177) [-1211.884] (-1212.753) (-1218.004) * (-1213.631) (-1213.665) (-1211.294) [-1210.986] -- 0:00:01 982000 -- [-1211.502] (-1213.610) (-1211.474) (-1212.079) * (-1210.513) (-1214.492) [-1212.759] (-1214.032) -- 0:00:01 982500 -- (-1211.319) (-1216.359) [-1212.466] (-1214.019) * (-1210.643) (-1211.747) [-1212.196] (-1217.282) -- 0:00:01 983000 -- (-1212.471) (-1213.487) [-1213.043] (-1219.559) * (-1211.959) [-1212.109] (-1211.810) (-1212.837) -- 0:00:01 983500 -- (-1210.466) [-1214.390] (-1211.302) (-1214.255) * (-1214.743) [-1211.841] (-1210.843) (-1212.740) -- 0:00:01 984000 -- (-1211.525) (-1220.617) (-1210.545) [-1212.135] * (-1212.955) (-1211.254) [-1213.193] (-1219.650) -- 0:00:01 984500 -- (-1212.598) [-1211.714] (-1212.141) (-1211.087) * (-1212.654) (-1212.564) (-1217.893) [-1213.265] -- 0:00:00 985000 -- (-1211.672) [-1212.693] (-1211.362) (-1212.183) * (-1212.728) [-1217.703] (-1216.828) (-1216.364) -- 0:00:00 Average standard deviation of split frequencies: 0.007171 985500 -- [-1212.683] (-1212.735) (-1214.151) (-1212.867) * (-1211.676) [-1214.798] (-1216.559) (-1216.465) -- 0:00:00 986000 -- (-1213.418) (-1212.840) (-1215.634) [-1211.850] * (-1213.133) (-1211.196) (-1212.804) [-1215.827] -- 0:00:00 986500 -- (-1215.274) [-1212.977] (-1212.556) (-1211.104) * (-1213.034) (-1212.694) (-1212.534) [-1212.066] -- 0:00:00 987000 -- (-1210.584) [-1211.651] (-1211.935) (-1212.287) * (-1212.419) (-1212.653) [-1216.772] (-1211.597) -- 0:00:00 987500 -- (-1210.554) [-1211.561] (-1212.410) (-1211.492) * (-1210.639) [-1210.405] (-1214.147) (-1210.506) -- 0:00:00 988000 -- [-1210.767] (-1213.397) (-1212.852) (-1211.429) * (-1212.489) (-1210.408) [-1213.661] (-1211.215) -- 0:00:00 988500 -- [-1211.094] (-1210.590) (-1213.825) (-1212.835) * (-1212.581) (-1211.147) (-1211.657) [-1212.687] -- 0:00:00 989000 -- [-1211.310] (-1217.182) (-1214.426) (-1219.943) * (-1211.291) [-1216.303] (-1211.190) (-1212.467) -- 0:00:00 989500 -- (-1214.699) (-1212.105) (-1216.007) [-1214.524] * (-1213.070) [-1216.428] (-1211.584) (-1213.732) -- 0:00:00 990000 -- (-1214.617) (-1215.780) (-1214.096) [-1211.279] * (-1211.288) [-1214.002] (-1214.584) (-1213.597) -- 0:00:00 Average standard deviation of split frequencies: 0.006930 990500 -- (-1213.074) (-1214.026) (-1212.502) [-1211.280] * [-1211.782] (-1212.846) (-1210.372) (-1213.245) -- 0:00:00 991000 -- [-1212.788] (-1213.515) (-1214.360) (-1218.354) * (-1214.934) (-1211.161) (-1214.498) [-1213.950] -- 0:00:00 991500 -- (-1213.780) (-1210.644) (-1215.606) [-1211.247] * (-1215.010) [-1212.755] (-1216.763) (-1216.309) -- 0:00:00 992000 -- (-1213.322) (-1211.611) (-1212.269) [-1212.256] * (-1213.442) [-1212.410] (-1215.545) (-1213.916) -- 0:00:00 992500 -- (-1215.525) [-1211.622] (-1214.812) (-1212.930) * (-1212.248) (-1213.267) [-1212.092] (-1213.871) -- 0:00:00 993000 -- (-1213.990) [-1211.426] (-1212.694) (-1211.545) * [-1211.586] (-1211.153) (-1211.135) (-1215.824) -- 0:00:00 993500 -- (-1213.046) [-1210.952] (-1211.715) (-1213.260) * [-1211.652] (-1211.359) (-1211.289) (-1213.195) -- 0:00:00 994000 -- (-1212.346) (-1212.212) [-1211.755] (-1212.744) * (-1211.728) [-1211.095] (-1212.670) (-1211.290) -- 0:00:00 994500 -- (-1212.009) [-1215.318] (-1213.194) (-1212.583) * (-1211.143) (-1211.337) (-1212.512) [-1211.998] -- 0:00:00 995000 -- (-1211.776) (-1216.605) [-1211.209] (-1213.782) * (-1211.168) [-1211.135] (-1213.244) (-1212.596) -- 0:00:00 Average standard deviation of split frequencies: 0.006833 995500 -- (-1212.424) (-1213.730) (-1210.906) [-1214.967] * (-1211.014) (-1212.390) [-1212.351] (-1212.380) -- 0:00:00 996000 -- (-1210.628) [-1211.761] (-1214.089) (-1211.522) * [-1213.163] (-1211.533) (-1220.359) (-1211.881) -- 0:00:00 996500 -- (-1210.622) (-1212.350) [-1212.286] (-1214.698) * (-1212.311) (-1211.660) (-1211.409) [-1211.319] -- 0:00:00 997000 -- (-1213.675) (-1213.770) (-1213.436) [-1212.296] * (-1211.053) (-1210.636) [-1211.410] (-1210.888) -- 0:00:00 997500 -- [-1211.052] (-1215.375) (-1216.596) (-1216.218) * [-1210.929] (-1210.364) (-1218.864) (-1213.756) -- 0:00:00 998000 -- (-1211.975) (-1213.754) (-1212.434) [-1214.456] * (-1211.023) (-1211.265) (-1216.805) [-1213.143] -- 0:00:00 998500 -- (-1211.181) (-1210.928) (-1217.616) [-1211.021] * (-1212.575) (-1214.900) (-1211.896) [-1213.143] -- 0:00:00 999000 -- (-1212.001) (-1213.525) (-1212.989) [-1210.830] * (-1214.383) (-1210.389) [-1212.106] (-1214.356) -- 0:00:00 999500 -- (-1212.568) [-1215.831] (-1211.612) (-1212.030) * (-1215.114) [-1210.440] (-1217.435) (-1214.373) -- 0:00:00 1000000 -- (-1210.823) (-1211.790) [-1211.581] (-1212.317) * (-1211.902) (-1210.919) [-1215.662] (-1213.881) -- 0:00:00 Average standard deviation of split frequencies: 0.007155 Analysis completed in 1 mins 3 seconds Analysis used 61.63 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1210.13 Likelihood of best state for "cold" chain of run 2 was -1210.13 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 74.8 % ( 71 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 26.4 % ( 24 %) Dirichlet(Pi{all}) 28.5 % ( 19 %) Slider(Pi{all}) 78.7 % ( 54 %) Multiplier(Alpha{1,2}) 77.9 % ( 63 %) Multiplier(Alpha{3}) 19.0 % ( 25 %) Slider(Pinvar{all}) 98.6 % ( 98 %) ExtSPR(Tau{all},V{all}) 70.1 % ( 69 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 89 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 25 %) Multiplier(V{all}) 97.4 % (100 %) Nodeslider(V{all}) 30.7 % ( 23 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 76.4 % ( 75 %) Dirichlet(Revmat{all}) 100.0 % ( 99 %) Slider(Revmat{all}) 26.8 % ( 25 %) Dirichlet(Pi{all}) 28.4 % ( 18 %) Slider(Pi{all}) 78.9 % ( 53 %) Multiplier(Alpha{1,2}) 77.8 % ( 52 %) Multiplier(Alpha{3}) 18.8 % ( 18 %) Slider(Pinvar{all}) 98.6 % ( 98 %) ExtSPR(Tau{all},V{all}) 70.2 % ( 70 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 86 %) ParsSPR(Tau{all},V{all}) 28.2 % ( 31 %) Multiplier(V{all}) 97.4 % (100 %) Nodeslider(V{all}) 30.4 % ( 22 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 167545 0.82 0.67 3 | 166422 166589 0.84 4 | 166932 165581 166931 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 167864 0.82 0.67 3 | 166580 166667 0.84 4 | 166938 166277 165674 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1211.95 | 2 2 2 2 | | 1 2 1 | | 1 2 1 2 1 1| | 2 1 2 2 1 2 1 11 1 | | 1 1 2 1 2 1 1 1 1 1 1 1 | | 12 2 1 1 * 1 2 2 *2 1 2 | |11 1 1 1 2 22 2 2 2 1 * 2| | 2 2 2 2 12 1 1 2 | |2 2 * 11 2 2 2 2 2 | | 1 1 2 2 112 1 1 | | 2 1 12 1 2 2 | | 1 1 1 2 1 122 | | 1 1 | | 2 2 2 2 22 | | 1 1 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1213.38 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1211.83 -1215.00 2 -1211.83 -1215.59 -------------------------------------- TOTAL -1211.83 -1215.34 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.902929 0.090933 0.340560 1.468242 0.866663 1338.20 1419.60 1.000 r(A<->C){all} 0.156191 0.016989 0.000090 0.413737 0.120180 273.26 279.10 1.000 r(A<->G){all} 0.174254 0.020816 0.000006 0.450563 0.132999 353.05 365.82 1.000 r(A<->T){all} 0.154523 0.018210 0.000010 0.417109 0.120192 143.20 198.47 1.000 r(C<->G){all} 0.173399 0.023337 0.000013 0.485969 0.129772 91.32 166.09 1.001 r(C<->T){all} 0.161640 0.020389 0.000063 0.456397 0.122087 87.97 175.45 1.000 r(G<->T){all} 0.179993 0.021434 0.000097 0.468358 0.145224 197.68 200.69 1.000 pi(A){all} 0.227447 0.000199 0.200766 0.255604 0.226878 1243.94 1372.47 1.000 pi(C){all} 0.322152 0.000250 0.289688 0.352248 0.321927 1264.47 1269.64 1.001 pi(G){all} 0.273376 0.000217 0.244180 0.302288 0.273348 1234.46 1367.73 1.000 pi(T){all} 0.177024 0.000166 0.153066 0.202545 0.176955 1239.85 1344.16 1.000 alpha{1,2} 0.419204 0.223461 0.000331 1.343187 0.252949 1159.76 1280.12 1.001 alpha{3} 0.445114 0.215608 0.000288 1.371328 0.296529 1323.68 1326.29 1.000 pinvar{all} 0.998294 0.000004 0.994496 0.999999 0.998964 1096.66 1138.65 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .*...* 8 -- ...**. 9 -- .***.* 10 -- .*.*** 11 -- ....** 12 -- ..**** 13 -- ...*.* 14 -- ..*..* 15 -- .**... 16 -- .*..*. 17 -- .**.** 18 -- .*.*.. 19 -- ..**.. 20 -- ..*.*. 21 -- .****. 22 -- ...*** ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 456 0.151899 0.009422 0.145237 0.158561 2 8 451 0.150233 0.007066 0.145237 0.155230 2 9 442 0.147235 0.008480 0.141239 0.153231 2 10 442 0.147235 0.008480 0.141239 0.153231 2 11 435 0.144903 0.003298 0.142572 0.147235 2 12 435 0.144903 0.000471 0.144570 0.145237 2 13 434 0.144570 0.001884 0.143238 0.145903 2 14 433 0.144237 0.003298 0.141905 0.146569 2 15 432 0.143904 0.021670 0.128581 0.159227 2 16 430 0.143238 0.006595 0.138574 0.147901 2 17 427 0.142239 0.003298 0.139907 0.144570 2 18 410 0.136576 0.007537 0.131246 0.141905 2 19 404 0.134577 0.001884 0.133245 0.135909 2 20 402 0.133911 0.009422 0.127249 0.140573 2 21 398 0.132578 0.000942 0.131912 0.133245 2 22 260 0.086609 0.020728 0.071952 0.101266 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.102646 0.011392 0.000031 0.323737 0.068305 1.000 2 length{all}[2] 0.102903 0.010459 0.000021 0.308160 0.070607 1.001 2 length{all}[3] 0.098962 0.009594 0.000008 0.296395 0.069188 1.000 2 length{all}[4] 0.099191 0.009360 0.000028 0.296111 0.070552 1.000 2 length{all}[5] 0.096635 0.009102 0.000011 0.287662 0.066797 1.000 2 length{all}[6] 0.101892 0.010360 0.000001 0.302688 0.073519 1.000 2 length{all}[7] 0.103013 0.010254 0.000358 0.291715 0.076595 1.001 2 length{all}[8] 0.101578 0.011128 0.000158 0.283185 0.069574 0.999 2 length{all}[9] 0.106167 0.008732 0.000025 0.296821 0.078552 1.002 2 length{all}[10] 0.102374 0.011388 0.000501 0.304670 0.070379 0.999 2 length{all}[11] 0.105778 0.011527 0.000029 0.348024 0.076370 0.999 2 length{all}[12] 0.093740 0.009569 0.000055 0.280207 0.065776 0.998 2 length{all}[13] 0.100592 0.011118 0.000237 0.298768 0.069946 0.999 2 length{all}[14] 0.102769 0.010283 0.000139 0.296851 0.074906 1.013 2 length{all}[15] 0.092885 0.009294 0.000012 0.275286 0.060981 0.998 2 length{all}[16] 0.098104 0.010580 0.000060 0.332659 0.064560 1.001 2 length{all}[17] 0.101299 0.009173 0.000252 0.304841 0.074368 0.999 2 length{all}[18] 0.113650 0.011014 0.000636 0.324878 0.084686 1.003 2 length{all}[19] 0.093025 0.008507 0.000673 0.267550 0.062246 0.999 2 length{all}[20] 0.090483 0.007405 0.000519 0.265471 0.060911 0.999 2 length{all}[21] 0.101340 0.010074 0.000505 0.289383 0.072407 1.000 2 length{all}[22] 0.108876 0.011800 0.000098 0.317490 0.074854 0.996 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.007155 Maximum standard deviation of split frequencies = 0.021670 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.013 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /------------------------------------------------------------------- C1 (1) | |--------------------------------------------------------------------- C2 (2) | |-------------------------------------------------------------------- C3 (3) + |--------------------------------------------------------------------- C4 (4) | |----------------------------------------------------------------- C5 (5) | \------------------------------------------------------------------------ C6 (6) |--------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 45 trees 90 % credible set contains 90 trees 95 % credible set contains 97 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 888 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 53 patterns at 296 / 296 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 53 patterns at 296 / 296 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 51728 bytes for conP 4664 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.069148 0.018437 0.077442 0.032111 0.012568 0.045781 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1240.339289 Iterating by ming2 Initial: fx= 1240.339289 x= 0.06915 0.01844 0.07744 0.03211 0.01257 0.04578 0.30000 1.30000 1 h-m-p 0.0000 0.0000 709.1877 ++ 1218.610885 m 0.0000 13 | 1/8 2 h-m-p 0.0005 0.0059 52.0072 -----------.. | 1/8 3 h-m-p 0.0000 0.0000 648.1819 ++ 1210.126405 m 0.0000 44 | 2/8 4 h-m-p 0.0003 0.0075 41.1468 ----------.. | 2/8 5 h-m-p 0.0000 0.0000 579.5664 ++ 1194.273389 m 0.0000 74 | 3/8 6 h-m-p 0.0007 0.0098 31.8204 -----------.. | 3/8 7 h-m-p 0.0000 0.0000 502.4455 ++ 1182.331645 m 0.0000 105 | 4/8 8 h-m-p 0.0009 0.0147 21.5820 -----------.. | 4/8 9 h-m-p 0.0000 0.0001 410.5860 ++ 1168.627698 m 0.0001 136 | 5/8 10 h-m-p 0.0020 0.0280 11.8750 ------------.. | 5/8 11 h-m-p 0.0000 0.0000 291.3716 ++ 1166.177862 m 0.0000 168 | 6/8 12 h-m-p 0.0979 8.0000 0.0000 Y 1166.177862 0 0.0979 179 | 6/8 13 h-m-p 1.6000 8.0000 0.0000 Y 1166.177862 0 0.4000 192 Out.. lnL = -1166.177862 193 lfun, 193 eigenQcodon, 1158 P(t) Time used: 0:01 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.072457 0.082074 0.016300 0.026972 0.080362 0.015191 0.299963 0.728034 0.169372 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 14.516894 np = 9 lnL0 = -1246.175258 Iterating by ming2 Initial: fx= 1246.175258 x= 0.07246 0.08207 0.01630 0.02697 0.08036 0.01519 0.29996 0.72803 0.16937 1 h-m-p 0.0000 0.0001 629.3630 ++ 1222.534506 m 0.0001 14 | 1/9 2 h-m-p 0.0000 0.0000 395.2658 ++ 1220.975752 m 0.0000 26 | 2/9 3 h-m-p 0.0000 0.0001 375.4306 ++ 1211.196511 m 0.0001 38 | 3/9 4 h-m-p 0.0000 0.0002 896.2367 ++ 1172.995012 m 0.0002 50 | 4/9 5 h-m-p 0.0000 0.0000 3857.0179 ++ 1170.860468 m 0.0000 62 | 5/9 6 h-m-p 0.0014 0.0071 5.9854 -----------.. | 5/9 7 h-m-p 0.0000 0.0000 404.0220 ++ 1166.860845 m 0.0000 95 | 6/9 8 h-m-p 0.0017 0.0691 4.1869 -----------.. | 6/9 9 h-m-p 0.0000 0.0000 290.8344 ++ 1166.177864 m 0.0000 128 | 7/9 10 h-m-p 0.0160 8.0000 0.0000 +++++ 1166.177864 m 8.0000 143 | 7/9 11 h-m-p 0.0481 8.0000 0.0026 --------Y 1166.177864 0 0.0000 165 | 7/9 12 h-m-p 0.0160 8.0000 0.0000 --C 1166.177864 0 0.0003 181 | 7/9 13 h-m-p 0.0160 8.0000 0.0000 --N 1166.177864 0 0.0003 197 | 7/9 14 h-m-p 0.0160 8.0000 0.0002 +++++ 1166.177864 m 8.0000 214 | 7/9 15 h-m-p 0.0082 4.1050 0.1969 +++++ 1166.177861 m 4.1050 231 | 7/9 16 h-m-p 0.0000 0.0000 0.0448 h-m-p: 2.94188738e-16 1.47094369e-15 4.48315378e-02 1166.177861 .. | 7/9 17 h-m-p 0.0160 8.0000 0.0000 +++++ 1166.177861 m 8.0000 259 | 7/9 18 h-m-p 0.0001 0.0005 0.3288 -----Y 1166.177861 0 0.0000 278 | 7/9 19 h-m-p 0.0029 1.4542 0.0000 ------------.. | 7/9 20 h-m-p 0.0160 8.0000 0.0000 +++++ 1166.177861 m 8.0000 319 | 7/9 21 h-m-p 0.0007 0.3609 0.5566 +++++ 1166.177856 m 0.3609 336 | 8/9 22 h-m-p 0.1615 0.8077 0.0177 -----------C 1166.177856 0 0.0000 361 | 8/9 23 h-m-p 0.0160 8.0000 0.0000 -N 1166.177856 0 0.0010 375 | 8/9 24 h-m-p 0.0160 8.0000 0.0000 -----N 1166.177856 0 0.0000 393 Out.. lnL = -1166.177856 394 lfun, 1182 eigenQcodon, 4728 P(t) Time used: 0:02 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.098120 0.079711 0.103302 0.095438 0.010457 0.046103 0.000100 1.101670 0.136379 0.238817 1.534561 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 11.638575 np = 11 lnL0 = -1280.098304 Iterating by ming2 Initial: fx= 1280.098304 x= 0.09812 0.07971 0.10330 0.09544 0.01046 0.04610 0.00011 1.10167 0.13638 0.23882 1.53456 1 h-m-p 0.0000 0.0000 587.0831 ++ 1279.537766 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0001 496.9910 ++ 1263.373280 m 0.0001 30 | 2/11 3 h-m-p 0.0001 0.0005 150.4060 ++ 1224.610684 m 0.0005 44 | 3/11 4 h-m-p 0.0010 0.0055 68.2455 ++ 1187.031583 m 0.0055 58 | 4/11 5 h-m-p 0.0000 0.0000 216615.6262 ++ 1185.729012 m 0.0000 72 | 5/11 6 h-m-p 0.0007 0.0036 22.9080 ++ 1185.450680 m 0.0036 86 | 6/11 7 h-m-p 0.0000 0.0002 140.5708 ++ 1181.013949 m 0.0002 100 | 7/11 8 h-m-p 0.0002 0.0083 90.2233 +++ 1166.177846 m 0.0083 115 | 8/11 9 h-m-p 1.6000 8.0000 0.0000 ++ 1166.177846 m 8.0000 129 | 8/11 10 h-m-p 0.0506 8.0000 0.0011 ++++ 1166.177846 m 8.0000 148 | 8/11 11 h-m-p 0.0136 6.8108 2.4537 ----------Y 1166.177846 0 0.0000 175 | 8/11 12 h-m-p 0.0160 8.0000 0.0004 +++++ 1166.177846 m 8.0000 192 | 8/11 13 h-m-p 0.0160 8.0000 1.8519 ----------Y 1166.177846 0 0.0000 219 | 8/11 14 h-m-p 0.0160 8.0000 0.0002 +++++ 1166.177846 m 8.0000 236 | 8/11 15 h-m-p 0.0160 8.0000 3.2119 -----------Y 1166.177846 0 0.0000 264 | 8/11 16 h-m-p 0.0160 8.0000 0.0000 Y 1166.177846 0 0.0160 278 | 8/11 17 h-m-p 0.0179 8.0000 0.0000 C 1166.177846 0 0.0045 295 Out.. lnL = -1166.177846 296 lfun, 1184 eigenQcodon, 5328 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1166.205911 S = -1166.174148 -0.012217 Calculating f(w|X), posterior probabilities of site classes. did 10 / 53 patterns 0:04 did 20 / 53 patterns 0:04 did 30 / 53 patterns 0:04 did 40 / 53 patterns 0:04 did 50 / 53 patterns 0:04 did 53 / 53 patterns 0:04 Time used: 0:04 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.096036 0.016765 0.083764 0.023046 0.052181 0.109613 0.000100 0.643552 1.705952 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 21.134440 np = 9 lnL0 = -1269.829635 Iterating by ming2 Initial: fx= 1269.829635 x= 0.09604 0.01677 0.08376 0.02305 0.05218 0.10961 0.00011 0.64355 1.70595 1 h-m-p 0.0000 0.0000 626.9899 ++ 1269.334364 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0079 76.6811 +++++ 1232.319458 m 0.0079 29 | 2/9 3 h-m-p 0.0000 0.0001 362.9492 ++ 1226.680277 m 0.0001 41 | 3/9 4 h-m-p 0.0001 0.0007 166.0200 ++ 1167.184079 m 0.0007 53 | 4/9 5 h-m-p 0.0000 0.0000 146.0809 ++ 1166.778759 m 0.0000 65 | 5/9 6 h-m-p 0.0000 0.0000 330.5540 ++ 1166.463633 m 0.0000 77 | 6/9 7 h-m-p 0.0160 8.0000 1.2245 -------------.. | 6/9 8 h-m-p 0.0000 0.0000 289.8743 ++ 1166.177822 m 0.0000 112 | 7/9 9 h-m-p 0.0507 8.0000 0.0000 -Y 1166.177822 0 0.0107 125 | 7/9 10 h-m-p 0.1451 8.0000 0.0000 ---Y 1166.177822 0 0.0006 142 Out.. lnL = -1166.177822 143 lfun, 1573 eigenQcodon, 8580 P(t) Time used: 0:06 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.049120 0.098822 0.082746 0.022188 0.099720 0.072006 0.000100 0.900000 0.951546 1.507429 1.300004 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 14.752431 np = 11 lnL0 = -1280.325007 Iterating by ming2 Initial: fx= 1280.325007 x= 0.04912 0.09882 0.08275 0.02219 0.09972 0.07201 0.00011 0.90000 0.95155 1.50743 1.30000 1 h-m-p 0.0000 0.0000 611.7642 ++ 1279.752845 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0006 266.0150 +++ 1243.596452 m 0.0006 31 | 2/11 3 h-m-p 0.0000 0.0002 389.2483 ++ 1208.141597 m 0.0002 45 | 3/11 4 h-m-p 0.0005 0.0027 133.4623 ++ 1180.953778 m 0.0027 59 | 4/11 5 h-m-p 0.0000 0.0000 7617.3559 ++ 1172.935238 m 0.0000 73 | 5/11 6 h-m-p 0.0001 0.0003 2015.9574 ++ 1166.307311 m 0.0003 87 | 6/11 7 h-m-p 0.0000 0.0000 12131.3258 ++ 1166.177854 m 0.0000 101 | 7/11 8 h-m-p 1.6000 8.0000 0.0254 ++ 1166.177854 m 8.0000 115 | 7/11 9 h-m-p 0.0275 0.1373 1.7925 ----------Y 1166.177854 0 0.0000 143 | 7/11 10 h-m-p 0.0160 8.0000 0.0001 +++++ 1166.177854 m 8.0000 160 | 7/11 11 h-m-p 0.0160 8.0000 0.2152 +++++ 1166.177852 m 8.0000 181 | 7/11 12 h-m-p 1.5921 7.9604 0.2442 Y 1166.177852 0 0.6825 199 | 7/11 13 h-m-p 1.6000 8.0000 0.0007 ++ 1166.177852 m 8.0000 217 | 7/11 14 h-m-p 0.4640 8.0000 0.0128 ++C 1166.177852 0 7.4246 237 | 7/11 15 h-m-p 1.6000 8.0000 0.0020 ++ 1166.177852 m 8.0000 255 | 7/11 16 h-m-p 0.0173 0.4131 0.9315 -------------.. | 7/11 17 h-m-p 0.0160 8.0000 0.0000 +++++ 1166.177852 m 8.0000 305 | 7/11 18 h-m-p 0.0011 0.5700 1.5810 -----------.. | 7/11 19 h-m-p 0.0160 8.0000 0.0000 +++++ 1166.177852 m 8.0000 349 | 7/11 20 h-m-p 0.0285 8.0000 0.0037 +++++ 1166.177851 m 8.0000 370 | 7/11 21 h-m-p 0.0500 1.5781 0.5901 ---------Y 1166.177851 0 0.0000 397 | 7/11 22 h-m-p 0.0160 8.0000 0.0001 -------------.. | 7/11 23 h-m-p 0.0160 8.0000 0.0000 +++++ 1166.177851 m 8.0000 447 | 7/11 24 h-m-p 0.0045 2.2475 0.4130 --------N 1166.177851 0 0.0000 473 | 7/11 25 h-m-p 0.0160 8.0000 0.0000 +++++ 1166.177851 m 8.0000 494 | 7/11 26 h-m-p 0.0005 0.2743 0.6326 +++++ 1166.177849 m 0.2743 515 | 8/11 27 h-m-p 0.0476 1.6115 2.4942 --------------.. | 8/11 28 h-m-p 0.0160 8.0000 0.0000 +++++ 1166.177849 m 8.0000 562 | 8/11 29 h-m-p 0.1049 8.0000 0.0004 ----Y 1166.177849 0 0.0001 583 | 8/11 30 h-m-p 0.0160 8.0000 0.0002 +++++ 1166.177849 m 8.0000 603 | 8/11 31 h-m-p 0.0017 0.8328 1.5950 -------Y 1166.177849 0 0.0000 627 | 8/11 32 h-m-p 0.0160 8.0000 0.0000 --N 1166.177849 0 0.0003 643 | 8/11 33 h-m-p 0.0160 8.0000 0.0000 +++++ 1166.177849 m 8.0000 663 | 8/11 34 h-m-p 0.0013 0.6530 1.2215 -------C 1166.177849 0 0.0000 687 | 8/11 35 h-m-p 0.1753 8.0000 0.0000 N 1166.177849 0 0.0438 701 | 8/11 36 h-m-p 0.1562 8.0000 0.0000 C 1166.177849 0 0.2031 718 Out.. lnL = -1166.177849 719 lfun, 8628 eigenQcodon, 47454 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1166.207764 S = -1166.173573 -0.015092 Calculating f(w|X), posterior probabilities of site classes. did 10 / 53 patterns 0:19 did 20 / 53 patterns 0:19 did 30 / 53 patterns 0:19 did 40 / 53 patterns 0:19 did 50 / 53 patterns 0:19 did 53 / 53 patterns 0:19 Time used: 0:19 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=296 NC_011896_1_WP_010907892_1_762_MLBR_RS03600 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG NC_002677_1_NP_301568_1_440_sseA VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG NZ_LVXE01000001_1_WP_010907892_1_147_A3216_RS00745 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG NZ_LYPH01000001_1_WP_010907892_1_136_A8144_RS00690 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG NZ_CP029543_1_WP_010907892_1_782_DIJ64_RS03980 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG NZ_AP014567_1_WP_010907892_1_794_JK2ML_RS04040 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG ************************************************** NC_011896_1_WP_010907892_1_762_MLBR_RS03600 HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS NC_002677_1_NP_301568_1_440_sseA HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS NZ_LVXE01000001_1_WP_010907892_1_147_A3216_RS00745 HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS NZ_LYPH01000001_1_WP_010907892_1_136_A8144_RS00690 HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS NZ_CP029543_1_WP_010907892_1_782_DIJ64_RS03980 HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS NZ_AP014567_1_WP_010907892_1_794_JK2ML_RS04040 HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS ************************************************** NC_011896_1_WP_010907892_1_762_MLBR_RS03600 NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV NC_002677_1_NP_301568_1_440_sseA NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV NZ_LVXE01000001_1_WP_010907892_1_147_A3216_RS00745 NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV NZ_LYPH01000001_1_WP_010907892_1_136_A8144_RS00690 NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV NZ_CP029543_1_WP_010907892_1_782_DIJ64_RS03980 NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV NZ_AP014567_1_WP_010907892_1_794_JK2ML_RS04040 NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV ************************************************** NC_011896_1_WP_010907892_1_762_MLBR_RS03600 VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR NC_002677_1_NP_301568_1_440_sseA VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR NZ_LVXE01000001_1_WP_010907892_1_147_A3216_RS00745 VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR NZ_LYPH01000001_1_WP_010907892_1_136_A8144_RS00690 VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR NZ_CP029543_1_WP_010907892_1_782_DIJ64_RS03980 VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR NZ_AP014567_1_WP_010907892_1_794_JK2ML_RS04040 VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR ************************************************** NC_011896_1_WP_010907892_1_762_MLBR_RS03600 AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER NC_002677_1_NP_301568_1_440_sseA AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER NZ_LVXE01000001_1_WP_010907892_1_147_A3216_RS00745 AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER NZ_LYPH01000001_1_WP_010907892_1_136_A8144_RS00690 AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER NZ_CP029543_1_WP_010907892_1_782_DIJ64_RS03980 AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER NZ_AP014567_1_WP_010907892_1_794_JK2ML_RS04040 AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER ************************************************** NC_011896_1_WP_010907892_1_762_MLBR_RS03600 SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV NC_002677_1_NP_301568_1_440_sseA SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV NZ_LVXE01000001_1_WP_010907892_1_147_A3216_RS00745 SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV NZ_LYPH01000001_1_WP_010907892_1_136_A8144_RS00690 SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV NZ_CP029543_1_WP_010907892_1_782_DIJ64_RS03980 SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV NZ_AP014567_1_WP_010907892_1_794_JK2ML_RS04040 SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV **********************************************
>NC_011896_1_WP_010907892_1_762_MLBR_RS03600 GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC >NC_002677_1_NP_301568_1_440_sseA GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC >NZ_LVXE01000001_1_WP_010907892_1_147_A3216_RS00745 GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC >NZ_LYPH01000001_1_WP_010907892_1_136_A8144_RS00690 GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC >NZ_CP029543_1_WP_010907892_1_782_DIJ64_RS03980 GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC >NZ_AP014567_1_WP_010907892_1_794_JK2ML_RS04040 GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC
>NC_011896_1_WP_010907892_1_762_MLBR_RS03600 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV >NC_002677_1_NP_301568_1_440_sseA VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV >NZ_LVXE01000001_1_WP_010907892_1_147_A3216_RS00745 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV >NZ_LYPH01000001_1_WP_010907892_1_136_A8144_RS00690 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV >NZ_CP029543_1_WP_010907892_1_782_DIJ64_RS03980 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV >NZ_AP014567_1_WP_010907892_1_794_JK2ML_RS04040 VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV
#NEXUS [ID: 0244374402] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010907892_1_762_MLBR_RS03600 NC_002677_1_NP_301568_1_440_sseA NZ_LVXE01000001_1_WP_010907892_1_147_A3216_RS00745 NZ_LYPH01000001_1_WP_010907892_1_136_A8144_RS00690 NZ_CP029543_1_WP_010907892_1_782_DIJ64_RS03980 NZ_AP014567_1_WP_010907892_1_794_JK2ML_RS04040 ; end; begin trees; translate 1 NC_011896_1_WP_010907892_1_762_MLBR_RS03600, 2 NC_002677_1_NP_301568_1_440_sseA, 3 NZ_LVXE01000001_1_WP_010907892_1_147_A3216_RS00745, 4 NZ_LYPH01000001_1_WP_010907892_1_136_A8144_RS00690, 5 NZ_CP029543_1_WP_010907892_1_782_DIJ64_RS03980, 6 NZ_AP014567_1_WP_010907892_1_794_JK2ML_RS04040 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.06830493,2:0.07060719,3:0.06918764,4:0.0705523,5:0.06679731,6:0.07351907); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.06830493,2:0.07060719,3:0.06918764,4:0.0705523,5:0.06679731,6:0.07351907); end;
Estimated marginal likelihoods for runs sampled in files "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1211.83 -1215.00 2 -1211.83 -1215.59 -------------------------------------- TOTAL -1211.83 -1215.34 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.902929 0.090933 0.340560 1.468242 0.866663 1338.20 1419.60 1.000 r(A<->C){all} 0.156191 0.016989 0.000090 0.413737 0.120180 273.26 279.10 1.000 r(A<->G){all} 0.174254 0.020816 0.000006 0.450563 0.132999 353.05 365.82 1.000 r(A<->T){all} 0.154523 0.018210 0.000010 0.417109 0.120192 143.20 198.47 1.000 r(C<->G){all} 0.173399 0.023337 0.000013 0.485969 0.129772 91.32 166.09 1.001 r(C<->T){all} 0.161640 0.020389 0.000063 0.456397 0.122087 87.97 175.45 1.000 r(G<->T){all} 0.179993 0.021434 0.000097 0.468358 0.145224 197.68 200.69 1.000 pi(A){all} 0.227447 0.000199 0.200766 0.255604 0.226878 1243.94 1372.47 1.000 pi(C){all} 0.322152 0.000250 0.289688 0.352248 0.321927 1264.47 1269.64 1.001 pi(G){all} 0.273376 0.000217 0.244180 0.302288 0.273348 1234.46 1367.73 1.000 pi(T){all} 0.177024 0.000166 0.153066 0.202545 0.176955 1239.85 1344.16 1.000 alpha{1,2} 0.419204 0.223461 0.000331 1.343187 0.252949 1159.76 1280.12 1.001 alpha{3} 0.445114 0.215608 0.000288 1.371328 0.296529 1323.68 1326.29 1.000 pinvar{all} 0.998294 0.000004 0.994496 0.999999 0.998964 1096.66 1138.65 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/12res/sseA/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 296 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 4 4 4 4 4 4 | Cys TGT 0 0 0 0 0 0 TTC 7 7 7 7 7 7 | TCC 5 5 5 5 5 5 | TAC 7 7 7 7 7 7 | TGC 2 2 2 2 2 2 Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 4 4 4 4 4 4 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 10 10 10 10 10 10 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 0 0 0 0 0 0 | Pro CCT 3 3 3 3 3 3 | His CAT 4 4 4 4 4 4 | Arg CGT 3 3 3 3 3 3 CTC 8 8 8 8 8 8 | CCC 10 10 10 10 10 10 | CAC 4 4 4 4 4 4 | CGC 6 6 6 6 6 6 CTA 3 3 3 3 3 3 | CCA 2 2 2 2 2 2 | Gln CAA 1 1 1 1 1 1 | CGA 6 6 6 6 6 6 CTG 12 12 12 12 12 12 | CCG 7 7 7 7 7 7 | CAG 1 1 1 1 1 1 | CGG 4 4 4 4 4 4 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 1 1 1 1 1 1 | Thr ACT 4 4 4 4 4 4 | Asn AAT 2 2 2 2 2 2 | Ser AGT 1 1 1 1 1 1 ATC 12 12 12 12 12 12 | ACC 14 14 14 14 14 14 | AAC 9 9 9 9 9 9 | AGC 9 9 9 9 9 9 ATA 1 1 1 1 1 1 | ACA 3 3 3 3 3 3 | Lys AAA 6 6 6 6 6 6 | Arg AGA 0 0 0 0 0 0 Met ATG 3 3 3 3 3 3 | ACG 0 0 0 0 0 0 | AAG 5 5 5 5 5 5 | AGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 0 0 0 0 0 0 | Ala GCT 2 2 2 2 2 2 | Asp GAT 6 6 6 6 6 6 | Gly GGT 4 4 4 4 4 4 GTC 6 6 6 6 6 6 | GCC 10 10 10 10 10 10 | GAC 19 19 19 19 19 19 | GGC 14 14 14 14 14 14 GTA 7 7 7 7 7 7 | GCA 4 4 4 4 4 4 | Glu GAA 11 11 11 11 11 11 | GGA 3 3 3 3 3 3 GTG 13 13 13 13 13 13 | GCG 2 2 2 2 2 2 | GAG 5 5 5 5 5 5 | GGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010907892_1_762_MLBR_RS03600 position 1: T:0.14865 C:0.25000 A:0.23986 G:0.36149 position 2: T:0.26351 C:0.23649 A:0.28378 G:0.21622 position 3: T:0.11824 C:0.47973 A:0.15878 G:0.24324 Average T:0.17680 C:0.32207 A:0.22748 G:0.27365 #2: NC_002677_1_NP_301568_1_440_sseA position 1: T:0.14865 C:0.25000 A:0.23986 G:0.36149 position 2: T:0.26351 C:0.23649 A:0.28378 G:0.21622 position 3: T:0.11824 C:0.47973 A:0.15878 G:0.24324 Average T:0.17680 C:0.32207 A:0.22748 G:0.27365 #3: NZ_LVXE01000001_1_WP_010907892_1_147_A3216_RS00745 position 1: T:0.14865 C:0.25000 A:0.23986 G:0.36149 position 2: T:0.26351 C:0.23649 A:0.28378 G:0.21622 position 3: T:0.11824 C:0.47973 A:0.15878 G:0.24324 Average T:0.17680 C:0.32207 A:0.22748 G:0.27365 #4: NZ_LYPH01000001_1_WP_010907892_1_136_A8144_RS00690 position 1: T:0.14865 C:0.25000 A:0.23986 G:0.36149 position 2: T:0.26351 C:0.23649 A:0.28378 G:0.21622 position 3: T:0.11824 C:0.47973 A:0.15878 G:0.24324 Average T:0.17680 C:0.32207 A:0.22748 G:0.27365 #5: NZ_CP029543_1_WP_010907892_1_782_DIJ64_RS03980 position 1: T:0.14865 C:0.25000 A:0.23986 G:0.36149 position 2: T:0.26351 C:0.23649 A:0.28378 G:0.21622 position 3: T:0.11824 C:0.47973 A:0.15878 G:0.24324 Average T:0.17680 C:0.32207 A:0.22748 G:0.27365 #6: NZ_AP014567_1_WP_010907892_1_794_JK2ML_RS04040 position 1: T:0.14865 C:0.25000 A:0.23986 G:0.36149 position 2: T:0.26351 C:0.23649 A:0.28378 G:0.21622 position 3: T:0.11824 C:0.47973 A:0.15878 G:0.24324 Average T:0.17680 C:0.32207 A:0.22748 G:0.27365 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 24 | Cys C TGT 0 TTC 42 | TCC 30 | TAC 42 | TGC 12 Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0 TTG 24 | TCG 24 | TAG 0 | Trp W TGG 60 ------------------------------------------------------------------------------ Leu L CTT 0 | Pro P CCT 18 | His H CAT 24 | Arg R CGT 18 CTC 48 | CCC 60 | CAC 24 | CGC 36 CTA 18 | CCA 12 | Gln Q CAA 6 | CGA 36 CTG 72 | CCG 42 | CAG 6 | CGG 24 ------------------------------------------------------------------------------ Ile I ATT 6 | Thr T ACT 24 | Asn N AAT 12 | Ser S AGT 6 ATC 72 | ACC 84 | AAC 54 | AGC 54 ATA 6 | ACA 18 | Lys K AAA 36 | Arg R AGA 0 Met M ATG 18 | ACG 0 | AAG 30 | AGG 6 ------------------------------------------------------------------------------ Val V GTT 0 | Ala A GCT 12 | Asp D GAT 36 | Gly G GGT 24 GTC 36 | GCC 60 | GAC 114 | GGC 84 GTA 42 | GCA 24 | Glu E GAA 66 | GGA 18 GTG 78 | GCG 12 | GAG 30 | GGG 6 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.14865 C:0.25000 A:0.23986 G:0.36149 position 2: T:0.26351 C:0.23649 A:0.28378 G:0.21622 position 3: T:0.11824 C:0.47973 A:0.15878 G:0.24324 Average T:0.17680 C:0.32207 A:0.22748 G:0.27365 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1166.177862 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299963 1.300004 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907892_1_762_MLBR_RS03600: 0.000004, NC_002677_1_NP_301568_1_440_sseA: 0.000004, NZ_LVXE01000001_1_WP_010907892_1_147_A3216_RS00745: 0.000004, NZ_LYPH01000001_1_WP_010907892_1_136_A8144_RS00690: 0.000004, NZ_CP029543_1_WP_010907892_1_782_DIJ64_RS03980: 0.000004, NZ_AP014567_1_WP_010907892_1_794_JK2ML_RS04040: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.29996 omega (dN/dS) = 1.30000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 730.3 157.7 1.3000 0.0000 0.0000 0.0 0.0 7..2 0.000 730.3 157.7 1.3000 0.0000 0.0000 0.0 0.0 7..3 0.000 730.3 157.7 1.3000 0.0000 0.0000 0.0 0.0 7..4 0.000 730.3 157.7 1.3000 0.0000 0.0000 0.0 0.0 7..5 0.000 730.3 157.7 1.3000 0.0000 0.0000 0.0 0.0 7..6 0.000 730.3 157.7 1.3000 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:01 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1166.177856 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.014306 0.000001 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907892_1_762_MLBR_RS03600: 0.000004, NC_002677_1_NP_301568_1_440_sseA: 0.000004, NZ_LVXE01000001_1_WP_010907892_1_147_A3216_RS00745: 0.000004, NZ_LYPH01000001_1_WP_010907892_1_136_A8144_RS00690: 0.000004, NZ_CP029543_1_WP_010907892_1_782_DIJ64_RS03980: 0.000004, NZ_AP014567_1_WP_010907892_1_794_JK2ML_RS04040: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=2) p: 0.01431 0.98569 w: 0.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 738.0 150.0 0.9857 0.0000 0.0000 0.0 0.0 7..2 0.000 738.0 150.0 0.9857 0.0000 0.0000 0.0 0.0 7..3 0.000 738.0 150.0 0.9857 0.0000 0.0000 0.0 0.0 7..4 0.000 738.0 150.0 0.9857 0.0000 0.0000 0.0 0.0 7..5 0.000 738.0 150.0 0.9857 0.0000 0.0000 0.0 0.0 7..6 0.000 738.0 150.0 0.9857 0.0000 0.0000 0.0 0.0 Time used: 0:02 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1166.177846 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.779039 0.095867 0.000001 1.895536 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907892_1_762_MLBR_RS03600: 0.000004, NC_002677_1_NP_301568_1_440_sseA: 0.000004, NZ_LVXE01000001_1_WP_010907892_1_147_A3216_RS00745: 0.000004, NZ_LYPH01000001_1_WP_010907892_1_136_A8144_RS00690: 0.000004, NZ_CP029543_1_WP_010907892_1_782_DIJ64_RS03980: 0.000004, NZ_AP014567_1_WP_010907892_1_794_JK2ML_RS04040: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 0.77904 0.09587 0.12509 w: 0.00000 1.00000 1.89554 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 738.0 150.0 0.3330 0.0000 0.0000 0.0 0.0 7..2 0.000 738.0 150.0 0.3330 0.0000 0.0000 0.0 0.0 7..3 0.000 738.0 150.0 0.3330 0.0000 0.0000 0.0 0.0 7..4 0.000 738.0 150.0 0.3330 0.0000 0.0000 0.0 0.0 7..5 0.000 738.0 150.0 0.3330 0.0000 0.0000 0.0 0.0 7..6 0.000 738.0 150.0 0.3330 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907892_1_762_MLBR_RS03600) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907892_1_762_MLBR_RS03600) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:04 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1166.177822 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.072036 1.620321 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907892_1_762_MLBR_RS03600: 0.000004, NC_002677_1_NP_301568_1_440_sseA: 0.000004, NZ_LVXE01000001_1_WP_010907892_1_147_A3216_RS00745: 0.000004, NZ_LYPH01000001_1_WP_010907892_1_136_A8144_RS00690: 0.000004, NZ_CP029543_1_WP_010907892_1_782_DIJ64_RS03980: 0.000004, NZ_AP014567_1_WP_010907892_1_794_JK2ML_RS04040: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.07204 q = 1.62032 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00001 0.00012 0.00127 0.00927 0.05406 0.29244 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 738.0 150.0 0.0357 0.0000 0.0000 0.0 0.0 7..2 0.000 738.0 150.0 0.0357 0.0000 0.0000 0.0 0.0 7..3 0.000 738.0 150.0 0.0357 0.0000 0.0000 0.0 0.0 7..4 0.000 738.0 150.0 0.0357 0.0000 0.0000 0.0 0.0 7..5 0.000 738.0 150.0 0.0357 0.0000 0.0000 0.0 0.0 7..6 0.000 738.0 150.0 0.0357 0.0000 0.0000 0.0 0.0 Time used: 0:06 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1166.177849 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 1.194291 1.476273 1.120918 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907892_1_762_MLBR_RS03600: 0.000004, NC_002677_1_NP_301568_1_440_sseA: 0.000004, NZ_LVXE01000001_1_WP_010907892_1_147_A3216_RS00745: 0.000004, NZ_LYPH01000001_1_WP_010907892_1_136_A8144_RS00690: 0.000004, NZ_CP029543_1_WP_010907892_1_782_DIJ64_RS03980: 0.000004, NZ_AP014567_1_WP_010907892_1_794_JK2ML_RS04040: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.99999 p = 1.19429 q = 1.47627 (p1 = 0.00001) w = 1.12092 MLEs of dN/dS (w) for site classes (K=11) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001 w: 0.05707 0.14618 0.22882 0.30977 0.39109 0.47435 0.56123 0.65418 0.75783 0.88626 1.12092 (note that p[10] is zero) dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 738.0 150.0 0.4467 0.0000 0.0000 0.0 0.0 7..2 0.000 738.0 150.0 0.4467 0.0000 0.0000 0.0 0.0 7..3 0.000 738.0 150.0 0.4467 0.0000 0.0000 0.0 0.0 7..4 0.000 738.0 150.0 0.4467 0.0000 0.0000 0.0 0.0 7..5 0.000 738.0 150.0 0.4467 0.0000 0.0000 0.0 0.0 7..6 0.000 738.0 150.0 0.4467 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907892_1_762_MLBR_RS03600) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.097 0.098 0.099 0.099 0.100 0.100 0.101 0.101 0.102 0.103 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098 Time used: 0:19
Model 1: NearlyNeutral -1166.177856 Model 2: PositiveSelection -1166.177846 Model 0: one-ratio -1166.177862 Model 7: beta -1166.177822 Model 8: beta&w>1 -1166.177849 Model 0 vs 1 1.1999999969702912E-5 Model 2 vs 1 1.9999999949504854E-5 Model 8 vs 7 5.399999963628943E-5