--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:23:26 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/sseA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1211.83         -1215.00
2      -1211.83         -1215.59
--------------------------------------
TOTAL    -1211.83         -1215.34
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.902929    0.090933    0.340560    1.468242    0.866663   1338.20   1419.60    1.000
r(A<->C){all}   0.156191    0.016989    0.000090    0.413737    0.120180    273.26    279.10    1.000
r(A<->G){all}   0.174254    0.020816    0.000006    0.450563    0.132999    353.05    365.82    1.000
r(A<->T){all}   0.154523    0.018210    0.000010    0.417109    0.120192    143.20    198.47    1.000
r(C<->G){all}   0.173399    0.023337    0.000013    0.485969    0.129772     91.32    166.09    1.001
r(C<->T){all}   0.161640    0.020389    0.000063    0.456397    0.122087     87.97    175.45    1.000
r(G<->T){all}   0.179993    0.021434    0.000097    0.468358    0.145224    197.68    200.69    1.000
pi(A){all}      0.227447    0.000199    0.200766    0.255604    0.226878   1243.94   1372.47    1.000
pi(C){all}      0.322152    0.000250    0.289688    0.352248    0.321927   1264.47   1269.64    1.001
pi(G){all}      0.273376    0.000217    0.244180    0.302288    0.273348   1234.46   1367.73    1.000
pi(T){all}      0.177024    0.000166    0.153066    0.202545    0.176955   1239.85   1344.16    1.000
alpha{1,2}      0.419204    0.223461    0.000331    1.343187    0.252949   1159.76   1280.12    1.001
alpha{3}        0.445114    0.215608    0.000288    1.371328    0.296529   1323.68   1326.29    1.000
pinvar{all}     0.998294    0.000004    0.994496    0.999999    0.998964   1096.66   1138.65    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1166.177856
Model 2: PositiveSelection	-1166.177846
Model 0: one-ratio	-1166.177862
Model 7: beta	-1166.177822
Model 8: beta&w>1	-1166.177849


Model 0 vs 1	1.1999999969702912E-5

Model 2 vs 1	1.9999999949504854E-5

Model 8 vs 7	5.399999963628943E-5
>C1
VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG
HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS
NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV
VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR
AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER
SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV
>C2
VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG
HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS
NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV
VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR
AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER
SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV
>C3
VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG
HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS
NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV
VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR
AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER
SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV
>C4
VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG
HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS
NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV
VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR
AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER
SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV
>C5
VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG
HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS
NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV
VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR
AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER
SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV
>C6
VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG
HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS
NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV
VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR
AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER
SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=296 

C1              VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG
C2              VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG
C3              VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG
C4              VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG
C5              VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG
C6              VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG
                **************************************************

C1              HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS
C2              HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS
C3              HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS
C4              HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS
C5              HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS
C6              HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS
                **************************************************

C1              NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV
C2              NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV
C3              NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV
C4              NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV
C5              NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV
C6              NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV
                **************************************************

C1              VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR
C2              VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR
C3              VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR
C4              VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR
C5              VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR
C6              VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR
                **************************************************

C1              AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER
C2              AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER
C3              AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER
C4              AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER
C5              AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER
C6              AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER
                **************************************************

C1              SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV
C2              SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV
C3              SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV
C4              SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV
C5              SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV
C6              SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV
                **********************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  296 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  296 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8880]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [8880]--->[8880]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.495 Mb, Max= 30.847 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG
C2              VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG
C3              VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG
C4              VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG
C5              VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG
C6              VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG
                **************************************************

C1              HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS
C2              HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS
C3              HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS
C4              HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS
C5              HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS
C6              HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS
                **************************************************

C1              NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV
C2              NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV
C3              NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV
C4              NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV
C5              NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV
C6              NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV
                **************************************************

C1              VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR
C2              VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR
C3              VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR
C4              VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR
C5              VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR
C6              VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR
                **************************************************

C1              AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER
C2              AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER
C3              AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER
C4              AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER
C5              AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER
C6              AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER
                **************************************************

C1              SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV
C2              SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV
C3              SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV
C4              SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV
C5              SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV
C6              SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV
                **********************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC
C2              GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC
C3              GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC
C4              GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC
C5              GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC
C6              GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC
                **************************************************

C1              CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG
C2              CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG
C3              CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG
C4              CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG
C5              CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG
C6              CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG
                **************************************************

C1              GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA
C2              GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA
C3              GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA
C4              GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA
C5              GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA
C6              GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA
                **************************************************

C1              CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC
C2              CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC
C3              CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC
C4              CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC
C5              CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC
C6              CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC
                **************************************************

C1              GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC
C2              GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC
C3              GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC
C4              GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC
C5              GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC
C6              GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC
                **************************************************

C1              GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC
C2              GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC
C3              GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC
C4              GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC
C5              GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC
C6              GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC
                **************************************************

C1              AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC
C2              AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC
C3              AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC
C4              AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC
C5              AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC
C6              AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC
                **************************************************

C1              CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC
C2              CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC
C3              CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC
C4              CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC
C5              CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC
C6              CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC
                **************************************************

C1              GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG
C2              GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG
C3              GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG
C4              GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG
C5              GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG
C6              GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG
                **************************************************

C1              GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC
C2              GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC
C3              GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC
C4              GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC
C5              GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC
C6              GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC
                **************************************************

C1              CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA
C2              CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA
C3              CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA
C4              CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA
C5              CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA
C6              CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA
                **************************************************

C1              CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA
C2              CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA
C3              CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA
C4              CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA
C5              CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA
C6              CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA
                **************************************************

C1              GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA
C2              GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA
C3              GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA
C4              GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA
C5              GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA
C6              GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA
                **************************************************

C1              CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT
C2              CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT
C3              CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT
C4              CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT
C5              CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT
C6              CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT
                **************************************************

C1              TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA
C2              TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA
C3              TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA
C4              TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA
C5              TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA
C6              TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA
                **************************************************

C1              TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT
C2              TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT
C3              TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT
C4              TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT
C5              TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT
C6              TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT
                **************************************************

C1              GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC
C2              GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC
C3              GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC
C4              GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC
C5              GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC
C6              GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC
                **************************************************

C1              CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC
C2              CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC
C3              CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC
C4              CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC
C5              CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC
C6              CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC
                **************************************



>C1
GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC
CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG
GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA
CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC
GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC
GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC
AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC
CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC
GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG
GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC
CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA
CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA
GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA
CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT
TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA
TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT
GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC
CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC
>C2
GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC
CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG
GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA
CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC
GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC
GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC
AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC
CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC
GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG
GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC
CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA
CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA
GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA
CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT
TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA
TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT
GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC
CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC
>C3
GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC
CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG
GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA
CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC
GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC
GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC
AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC
CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC
GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG
GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC
CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA
CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA
GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA
CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT
TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA
TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT
GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC
CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC
>C4
GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC
CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG
GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA
CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC
GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC
GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC
AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC
CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC
GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG
GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC
CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA
CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA
GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA
CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT
TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA
TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT
GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC
CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC
>C5
GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC
CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG
GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA
CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC
GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC
GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC
AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC
CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC
GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG
GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC
CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA
CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA
GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA
CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT
TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA
TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT
GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC
CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC
>C6
GTGCCGCTACCCACAGATCCAAGCCCTTCCCTGTCGGCTTACGCCCACCC
CGAACGGCTAGTAACCGGTGATTGGCTGTACTTCCATCTGGGCAAACCCG
GTCTGGCTATAGTCGAATCCGACGAGAACGTACTGCTCTACGATGTCGGA
CATATTCCTGGCGCGGTGAAGGTCGACTGGCACACCGACCTCAATGACCC
GAAGGTGCGTGACTACATCACTGGCGAGCAATTCGCCGACTTGATGAACC
GCAAGGGCATCGCCCGCGACGACACCGTGGTGATCTACGGCGACAAGAGC
AACTGGTGGGCGGCCTACGCACTGTGGGTCTTTACCTTGTTCGGCCATCC
CGACGTGCGACTGCTCAACGGCGGTCGTGATCTATGGCTCGCCGAACGCC
GGGATACCAGCCTGGCCGTGCCGAATAAGACATCGACCAGCTATCCCGTG
GTAAACCGGAACGACGCACCCATCCGCGCATTCAAAGACGACGTGTTGGC
CATCCTCGGCACTCAGCCGCTGATCGACGTGCGATCCCTCGACGAGTACA
CCGGCAAATGCACCGAAATGCCCGACTCCCCCGAAGAAAGTGTGCTGCGA
GCCGGCCACATCCCCACCGCCAGGTCGATCCCGTGGGAAATGACAGTCGA
CAAAAGCGGTCGATTCCGCAGCAGCGAAGAATTGGAACGGCTCTATGACT
TCATCACCCCAAACGATAAAACCATCGTATATTGCCGCATCGGCGAGCGA
TCCAGCCACACTTGGTTCGTACTCACCCATCTGCTGGGCAAACCGGGAGT
GCGTAACTATGACGGCTCGTGGACCGAGTGGGGGAACACCGTACGAGTGC
CGATCACTGCAGGCGAAAGCCCCGGAGCCGTACCTGTC
>C1
VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG
HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS
NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV
VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR
AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER
SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV
>C2
VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG
HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS
NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV
VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR
AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER
SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV
>C3
VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG
HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS
NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV
VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR
AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER
SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV
>C4
VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG
HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS
NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV
VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR
AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER
SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV
>C5
VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG
HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS
NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV
VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR
AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER
SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV
>C6
VPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVG
HIPGAVKVDWHTDLNDPKVRDYITGEQFADLMNRKGIARDDTVVIYGDKS
NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPV
VNRNDAPIRAFKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLR
AGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDKTIVYCRIGER
SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 888 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579789323
      Setting output file names to "/data/12res/sseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 215949631
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0244374402
      Seed = 250886326
      Swapseed = 1579789323
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1987.386578 -- -24.965149
         Chain 2 -- -1987.386578 -- -24.965149
         Chain 3 -- -1987.386465 -- -24.965149
         Chain 4 -- -1987.386275 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1987.386465 -- -24.965149
         Chain 2 -- -1987.386578 -- -24.965149
         Chain 3 -- -1987.386578 -- -24.965149
         Chain 4 -- -1987.386465 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1987.387] (-1987.387) (-1987.386) (-1987.386) * [-1987.386] (-1987.387) (-1987.387) (-1987.386) 
        500 -- (-1228.562) [-1226.440] (-1232.683) (-1218.610) * [-1224.331] (-1221.475) (-1236.788) (-1231.333) -- 0:00:00
       1000 -- (-1220.128) (-1221.474) [-1222.391] (-1216.448) * (-1223.585) [-1219.229] (-1223.418) (-1224.981) -- 0:00:00
       1500 -- (-1225.755) (-1232.632) (-1226.260) [-1219.321] * [-1218.812] (-1223.797) (-1221.961) (-1230.600) -- 0:00:00
       2000 -- (-1223.355) (-1220.510) [-1224.653] (-1228.942) * [-1218.857] (-1229.827) (-1216.008) (-1228.357) -- 0:00:00
       2500 -- [-1217.910] (-1216.897) (-1224.856) (-1222.000) * [-1223.680] (-1226.485) (-1220.263) (-1222.511) -- 0:00:00
       3000 -- [-1218.573] (-1227.884) (-1217.774) (-1221.608) * (-1216.606) [-1223.052] (-1219.629) (-1222.315) -- 0:00:00
       3500 -- (-1221.315) (-1219.780) [-1220.415] (-1222.259) * (-1225.171) [-1226.738] (-1223.591) (-1221.651) -- 0:00:00
       4000 -- [-1214.923] (-1221.132) (-1224.307) (-1223.310) * [-1217.898] (-1220.934) (-1227.373) (-1219.133) -- 0:00:00
       4500 -- [-1222.378] (-1224.169) (-1220.397) (-1228.131) * (-1225.156) [-1226.241] (-1224.862) (-1222.305) -- 0:00:00
       5000 -- [-1218.671] (-1219.830) (-1221.787) (-1220.525) * (-1218.637) [-1219.384] (-1222.097) (-1229.955) -- 0:00:00

      Average standard deviation of split frequencies: 0.136639

       5500 -- (-1225.189) (-1224.353) (-1224.021) [-1218.658] * (-1219.132) [-1219.895] (-1223.003) (-1220.620) -- 0:00:00
       6000 -- (-1226.804) (-1217.374) [-1216.643] (-1223.011) * (-1223.259) [-1216.517] (-1220.937) (-1228.882) -- 0:00:00
       6500 -- [-1219.016] (-1223.382) (-1217.339) (-1221.449) * (-1220.911) [-1219.624] (-1226.595) (-1217.580) -- 0:00:00
       7000 -- (-1224.408) (-1224.722) (-1217.835) [-1217.762] * (-1221.322) (-1217.131) [-1221.367] (-1221.525) -- 0:00:00
       7500 -- (-1218.428) (-1223.077) [-1224.637] (-1217.558) * (-1227.367) (-1222.194) [-1215.086] (-1228.836) -- 0:00:00
       8000 -- (-1235.351) (-1225.260) [-1219.346] (-1216.793) * (-1225.277) (-1222.105) (-1218.019) [-1222.718] -- 0:00:00
       8500 -- (-1222.493) [-1222.346] (-1218.083) (-1220.624) * (-1219.073) [-1215.995] (-1226.144) (-1218.227) -- 0:00:00
       9000 -- (-1223.205) (-1219.911) (-1215.366) [-1219.962] * (-1221.389) [-1214.941] (-1224.186) (-1223.514) -- 0:00:00
       9500 -- [-1223.278] (-1224.970) (-1219.472) (-1221.691) * (-1229.553) (-1222.744) (-1224.377) [-1214.695] -- 0:00:00
      10000 -- (-1219.158) [-1226.740] (-1215.330) (-1226.787) * (-1221.248) (-1222.264) [-1216.841] (-1225.048) -- 0:00:00

      Average standard deviation of split frequencies: 0.084179

      10500 -- (-1226.905) (-1221.577) [-1221.584] (-1225.092) * (-1218.340) (-1217.385) [-1220.071] (-1224.957) -- 0:00:00
      11000 -- [-1219.863] (-1218.391) (-1225.410) (-1220.726) * (-1226.266) [-1219.217] (-1220.334) (-1225.950) -- 0:00:00
      11500 -- (-1227.436) [-1216.726] (-1232.434) (-1224.665) * (-1227.242) (-1220.410) (-1224.631) [-1218.205] -- 0:00:00
      12000 -- (-1223.748) [-1228.349] (-1222.054) (-1220.220) * (-1222.461) [-1219.862] (-1218.323) (-1219.997) -- 0:01:22
      12500 -- (-1221.343) (-1222.234) [-1216.405] (-1214.936) * (-1224.446) (-1227.486) (-1221.227) [-1225.373] -- 0:01:19
      13000 -- (-1220.563) (-1220.028) (-1217.589) [-1218.917] * [-1220.527] (-1221.216) (-1231.765) (-1222.819) -- 0:01:15
      13500 -- (-1215.211) [-1220.486] (-1225.733) (-1219.150) * [-1222.685] (-1216.779) (-1223.228) (-1218.160) -- 0:01:13
      14000 -- (-1222.168) (-1224.923) (-1225.574) [-1219.489] * (-1229.042) (-1225.896) [-1218.119] (-1219.500) -- 0:01:10
      14500 -- (-1222.101) (-1217.726) (-1221.639) [-1216.764] * (-1219.576) (-1220.045) [-1217.176] (-1219.160) -- 0:01:07
      15000 -- (-1220.776) (-1219.978) (-1218.661) [-1219.113] * (-1232.915) (-1228.510) [-1217.997] (-1224.254) -- 0:01:05

      Average standard deviation of split frequencies: 0.081456

      15500 -- [-1219.480] (-1235.009) (-1226.498) (-1229.005) * (-1220.825) (-1219.356) [-1226.484] (-1221.579) -- 0:01:03
      16000 -- (-1227.153) (-1226.806) [-1224.056] (-1223.450) * (-1221.238) [-1220.992] (-1218.196) (-1225.905) -- 0:01:01
      16500 -- (-1218.639) [-1220.933] (-1219.231) (-1216.474) * (-1228.736) (-1224.698) [-1217.157] (-1226.463) -- 0:00:59
      17000 -- (-1218.030) (-1220.661) [-1218.978] (-1219.904) * (-1222.227) [-1220.221] (-1218.845) (-1216.742) -- 0:00:57
      17500 -- (-1221.612) (-1220.758) [-1212.367] (-1220.421) * (-1217.735) (-1220.645) (-1223.162) [-1219.649] -- 0:00:56
      18000 -- (-1219.604) (-1221.772) (-1210.714) [-1218.518] * [-1217.394] (-1237.419) (-1222.791) (-1220.755) -- 0:00:54
      18500 -- (-1220.384) [-1227.400] (-1212.456) (-1220.889) * (-1225.349) [-1219.550] (-1226.282) (-1218.669) -- 0:00:53
      19000 -- (-1223.581) [-1221.617] (-1217.075) (-1223.502) * (-1226.240) (-1232.182) [-1222.331] (-1222.640) -- 0:00:51
      19500 -- [-1223.058] (-1223.180) (-1217.372) (-1218.174) * [-1221.477] (-1216.781) (-1222.680) (-1217.590) -- 0:00:50
      20000 -- (-1221.399) (-1221.801) [-1218.196] (-1221.072) * (-1215.257) (-1218.111) [-1220.605] (-1212.699) -- 0:00:49

      Average standard deviation of split frequencies: 0.062347

      20500 -- (-1224.850) (-1217.737) [-1210.918] (-1222.770) * (-1214.649) (-1211.073) (-1221.835) [-1212.505] -- 0:00:47
      21000 -- (-1219.559) (-1217.254) [-1211.301] (-1220.378) * (-1214.657) [-1211.431] (-1218.568) (-1214.785) -- 0:00:46
      21500 -- (-1219.225) (-1227.610) (-1212.053) [-1223.335] * (-1216.903) (-1211.186) [-1219.730] (-1213.531) -- 0:00:45
      22000 -- (-1218.034) (-1226.642) (-1217.078) [-1219.040] * (-1216.594) [-1211.886] (-1217.571) (-1212.314) -- 0:00:44
      22500 -- (-1223.498) (-1230.546) (-1213.769) [-1221.599] * (-1212.882) (-1211.474) [-1220.028] (-1211.072) -- 0:00:43
      23000 -- [-1223.914] (-1230.763) (-1212.817) (-1218.808) * [-1215.997] (-1211.036) (-1225.304) (-1210.855) -- 0:00:42
      23500 -- (-1221.693) (-1218.383) (-1212.990) [-1219.688] * (-1213.590) (-1212.433) (-1224.182) [-1211.273] -- 0:00:41
      24000 -- (-1223.583) [-1216.662] (-1214.078) (-1216.898) * (-1215.353) [-1214.912] (-1220.204) (-1210.528) -- 0:00:40
      24500 -- (-1220.407) (-1224.171) (-1218.009) [-1216.491] * (-1215.541) (-1211.467) [-1225.833] (-1214.072) -- 0:00:39
      25000 -- [-1221.657] (-1219.693) (-1212.864) (-1218.752) * [-1213.605] (-1210.807) (-1227.332) (-1210.434) -- 0:00:39

      Average standard deviation of split frequencies: 0.046838

      25500 -- (-1229.437) (-1212.951) [-1212.103] (-1218.657) * [-1213.126] (-1210.807) (-1222.388) (-1213.333) -- 0:01:16
      26000 -- (-1222.497) (-1226.582) [-1210.946] (-1218.907) * [-1213.373] (-1211.942) (-1217.855) (-1211.330) -- 0:01:14
      26500 -- (-1221.295) [-1219.810] (-1211.486) (-1220.854) * (-1213.244) [-1213.398] (-1227.449) (-1212.264) -- 0:01:13
      27000 -- (-1221.875) (-1228.116) [-1214.523] (-1221.089) * (-1213.015) (-1212.386) [-1227.727] (-1214.676) -- 0:01:12
      27500 -- [-1218.278] (-1224.122) (-1214.424) (-1225.036) * [-1213.694] (-1211.140) (-1224.135) (-1210.535) -- 0:01:10
      28000 -- [-1224.054] (-1224.607) (-1212.713) (-1227.979) * [-1213.211] (-1210.897) (-1226.526) (-1210.674) -- 0:01:09
      28500 -- [-1219.206] (-1215.179) (-1211.225) (-1232.426) * [-1213.527] (-1212.988) (-1225.248) (-1215.191) -- 0:01:08
      29000 -- (-1227.936) [-1216.917] (-1217.669) (-1224.383) * [-1212.374] (-1215.868) (-1221.961) (-1215.994) -- 0:01:06
      29500 -- (-1219.861) [-1219.866] (-1214.043) (-1223.161) * [-1210.905] (-1210.976) (-1225.473) (-1215.160) -- 0:01:05
      30000 -- (-1225.435) [-1219.140] (-1214.197) (-1227.455) * [-1210.609] (-1212.479) (-1224.716) (-1215.284) -- 0:01:04

      Average standard deviation of split frequencies: 0.041923

      30500 -- (-1225.345) (-1223.495) (-1213.170) [-1220.892] * (-1213.551) (-1211.606) [-1220.539] (-1213.821) -- 0:01:03
      31000 -- (-1220.142) [-1220.736] (-1213.630) (-1222.762) * (-1212.228) (-1211.750) [-1220.241] (-1214.394) -- 0:01:02
      31500 -- (-1224.971) [-1214.622] (-1215.882) (-1221.886) * (-1212.933) (-1211.552) [-1226.021] (-1214.963) -- 0:01:01
      32000 -- [-1222.651] (-1222.830) (-1214.023) (-1218.966) * [-1213.602] (-1213.634) (-1218.370) (-1215.323) -- 0:01:00
      32500 -- (-1223.051) (-1215.507) [-1214.350] (-1218.778) * (-1214.158) (-1211.321) [-1216.613] (-1212.529) -- 0:00:59
      33000 -- [-1219.155] (-1220.846) (-1213.178) (-1222.795) * [-1211.432] (-1211.057) (-1229.541) (-1212.131) -- 0:00:58
      33500 -- (-1214.718) (-1224.419) (-1211.022) [-1222.436] * (-1210.786) [-1211.690] (-1220.357) (-1213.504) -- 0:00:57
      34000 -- (-1212.456) (-1216.717) [-1212.064] (-1217.458) * (-1217.614) (-1211.681) [-1219.212] (-1221.409) -- 0:00:56
      34500 -- (-1212.634) (-1223.594) (-1211.358) [-1211.224] * [-1214.961] (-1216.822) (-1223.324) (-1219.443) -- 0:00:55
      35000 -- [-1211.851] (-1221.953) (-1211.811) (-1211.589) * (-1212.584) [-1212.610] (-1247.831) (-1212.071) -- 0:00:55

      Average standard deviation of split frequencies: 0.045519

      35500 -- (-1211.606) (-1219.584) (-1213.417) [-1211.751] * (-1213.985) (-1212.128) (-1214.922) [-1211.197] -- 0:00:54
      36000 -- (-1212.373) [-1217.963] (-1211.493) (-1212.068) * (-1220.579) (-1212.910) (-1213.403) [-1210.828] -- 0:00:53
      36500 -- [-1214.341] (-1232.935) (-1211.117) (-1212.470) * [-1215.262] (-1214.658) (-1211.833) (-1211.168) -- 0:00:52
      37000 -- (-1210.391) (-1222.984) (-1211.117) [-1211.342] * (-1216.699) (-1211.150) [-1212.703] (-1212.819) -- 0:00:52
      37500 -- (-1211.289) (-1219.662) [-1213.967] (-1212.004) * [-1213.711] (-1212.858) (-1211.548) (-1213.194) -- 0:00:51
      38000 -- [-1211.451] (-1220.704) (-1212.995) (-1212.619) * (-1212.416) (-1212.421) (-1211.892) [-1213.432] -- 0:00:50
      38500 -- (-1212.122) (-1222.322) [-1213.408] (-1214.078) * (-1214.019) (-1212.994) (-1214.021) [-1214.003] -- 0:01:14
      39000 -- (-1213.598) (-1228.137) [-1212.348] (-1212.688) * [-1212.417] (-1210.945) (-1215.001) (-1213.833) -- 0:01:13
      39500 -- [-1214.085] (-1220.466) (-1212.916) (-1214.105) * (-1212.054) (-1212.375) [-1211.955] (-1215.571) -- 0:01:12
      40000 -- [-1211.779] (-1227.384) (-1214.526) (-1215.224) * [-1211.702] (-1212.005) (-1211.457) (-1213.880) -- 0:01:12

      Average standard deviation of split frequencies: 0.040572

      40500 -- (-1211.590) (-1219.241) [-1211.965] (-1213.225) * (-1213.342) [-1211.651] (-1212.121) (-1211.101) -- 0:01:11
      41000 -- (-1210.736) (-1226.214) [-1212.040] (-1212.596) * [-1211.408] (-1212.458) (-1213.498) (-1214.855) -- 0:01:10
      41500 -- [-1212.711] (-1230.268) (-1215.046) (-1215.367) * (-1211.610) (-1213.533) (-1211.663) [-1211.896] -- 0:01:09
      42000 -- (-1212.319) [-1220.958] (-1211.736) (-1212.121) * (-1211.400) (-1214.528) (-1213.767) [-1214.616] -- 0:01:08
      42500 -- (-1216.867) [-1223.400] (-1212.490) (-1212.205) * [-1211.242] (-1211.143) (-1211.951) (-1215.073) -- 0:01:07
      43000 -- (-1211.623) (-1227.087) (-1214.516) [-1213.720] * (-1214.893) (-1213.160) [-1211.951] (-1213.154) -- 0:01:06
      43500 -- (-1210.344) (-1229.004) [-1213.486] (-1213.055) * (-1213.411) (-1213.014) [-1211.856] (-1214.632) -- 0:01:05
      44000 -- (-1211.919) [-1216.957] (-1212.759) (-1211.664) * (-1211.201) (-1211.775) [-1211.138] (-1212.337) -- 0:01:05
      44500 -- (-1210.696) (-1219.649) (-1214.704) [-1211.808] * [-1211.206] (-1212.067) (-1211.671) (-1211.228) -- 0:01:04
      45000 -- (-1211.226) (-1223.849) [-1213.657] (-1212.640) * (-1213.698) (-1211.377) [-1211.633] (-1213.169) -- 0:01:03

      Average standard deviation of split frequencies: 0.026734

      45500 -- [-1210.977] (-1218.934) (-1211.566) (-1221.997) * (-1212.663) (-1211.877) (-1211.495) [-1211.613] -- 0:01:02
      46000 -- (-1211.610) (-1219.259) (-1212.171) [-1217.532] * (-1212.859) [-1212.520] (-1212.949) (-1211.571) -- 0:01:02
      46500 -- (-1210.897) (-1218.733) (-1212.570) [-1212.451] * (-1212.799) (-1211.658) [-1213.020] (-1210.868) -- 0:01:01
      47000 -- (-1212.539) (-1215.821) (-1213.251) [-1213.036] * (-1215.402) (-1211.967) [-1212.531] (-1211.027) -- 0:01:00
      47500 -- [-1213.185] (-1228.756) (-1211.296) (-1211.512) * (-1214.954) (-1213.575) (-1214.182) [-1211.527] -- 0:01:00
      48000 -- (-1219.000) [-1228.520] (-1211.899) (-1212.963) * (-1211.445) (-1212.111) (-1213.535) [-1210.993] -- 0:00:59
      48500 -- (-1214.812) [-1225.276] (-1212.176) (-1211.918) * (-1213.400) [-1211.919] (-1212.272) (-1213.569) -- 0:00:58
      49000 -- (-1213.406) (-1218.690) (-1215.192) [-1213.116] * (-1214.927) [-1211.470] (-1213.885) (-1215.386) -- 0:00:58
      49500 -- (-1212.228) [-1220.877] (-1215.384) (-1212.309) * [-1212.265] (-1214.412) (-1212.006) (-1215.498) -- 0:00:57
      50000 -- (-1211.384) (-1229.922) (-1211.723) [-1213.193] * [-1211.537] (-1210.535) (-1214.737) (-1213.409) -- 0:00:57

      Average standard deviation of split frequencies: 0.034679

      50500 -- (-1212.477) (-1228.449) (-1215.054) [-1212.139] * (-1214.818) (-1216.254) [-1213.165] (-1217.049) -- 0:00:56
      51000 -- (-1212.453) (-1219.123) [-1212.266] (-1212.331) * [-1213.350] (-1215.690) (-1212.029) (-1213.031) -- 0:00:55
      51500 -- (-1211.680) (-1219.427) (-1212.954) [-1211.935] * (-1214.429) (-1211.894) [-1212.347] (-1210.798) -- 0:01:13
      52000 -- (-1214.549) [-1219.704] (-1213.420) (-1212.104) * [-1212.052] (-1213.961) (-1212.394) (-1212.149) -- 0:01:12
      52500 -- (-1212.282) (-1216.454) [-1213.339] (-1210.912) * [-1212.884] (-1214.539) (-1210.352) (-1212.191) -- 0:01:12
      53000 -- (-1211.785) (-1211.495) (-1213.884) [-1215.477] * (-1211.022) (-1217.569) (-1210.525) [-1214.095] -- 0:01:11
      53500 -- [-1210.757] (-1215.615) (-1213.374) (-1214.203) * (-1213.479) [-1211.742] (-1211.080) (-1212.625) -- 0:01:10
      54000 -- (-1212.188) (-1213.104) [-1212.643] (-1211.989) * (-1210.696) (-1210.490) (-1210.705) [-1212.477] -- 0:01:10
      54500 -- (-1214.062) (-1212.760) (-1213.062) [-1212.149] * (-1212.042) (-1210.485) [-1213.805] (-1213.899) -- 0:01:09
      55000 -- (-1211.936) [-1213.000] (-1212.037) (-1213.495) * [-1210.840] (-1210.690) (-1212.320) (-1214.134) -- 0:01:08

      Average standard deviation of split frequencies: 0.031567

      55500 -- (-1211.984) [-1212.673] (-1213.363) (-1210.497) * (-1210.572) (-1213.927) (-1215.366) [-1212.967] -- 0:01:08
      56000 -- (-1211.258) (-1214.534) [-1211.393] (-1212.663) * (-1211.468) [-1211.136] (-1210.886) (-1212.969) -- 0:01:07
      56500 -- [-1212.527] (-1212.586) (-1211.764) (-1211.900) * (-1212.982) (-1219.920) (-1212.938) [-1213.233] -- 0:01:06
      57000 -- (-1214.826) (-1213.295) [-1212.670] (-1211.900) * [-1211.402] (-1216.133) (-1212.977) (-1211.857) -- 0:01:06
      57500 -- (-1210.645) [-1211.355] (-1216.798) (-1211.229) * (-1213.523) (-1214.841) (-1213.960) [-1211.899] -- 0:01:05
      58000 -- [-1210.645] (-1213.097) (-1212.754) (-1210.952) * (-1213.104) (-1213.854) (-1212.725) [-1214.684] -- 0:01:04
      58500 -- (-1211.213) (-1215.551) (-1212.053) [-1212.164] * (-1211.158) (-1215.395) [-1210.852] (-1214.684) -- 0:01:04
      59000 -- (-1211.151) [-1216.313] (-1211.377) (-1210.447) * [-1211.132] (-1217.135) (-1211.276) (-1220.406) -- 0:01:03
      59500 -- (-1211.098) (-1214.655) (-1211.225) [-1212.633] * (-1213.944) (-1216.541) (-1211.058) [-1219.598] -- 0:01:03
      60000 -- [-1212.554] (-1214.719) (-1210.837) (-1214.006) * (-1212.234) (-1212.271) [-1211.166] (-1215.916) -- 0:01:02

      Average standard deviation of split frequencies: 0.024129

      60500 -- (-1212.143) (-1211.477) [-1211.740] (-1212.929) * (-1212.278) (-1214.391) (-1215.344) [-1213.346] -- 0:01:02
      61000 -- (-1210.742) (-1213.773) [-1213.786] (-1212.927) * (-1211.886) [-1211.450] (-1213.701) (-1212.179) -- 0:01:01
      61500 -- (-1210.547) [-1212.296] (-1212.238) (-1213.962) * [-1210.798] (-1213.307) (-1211.993) (-1213.275) -- 0:01:01
      62000 -- (-1211.793) (-1213.655) [-1210.839] (-1213.393) * (-1210.944) [-1212.598] (-1211.918) (-1212.874) -- 0:01:00
      62500 -- (-1212.898) (-1212.214) (-1212.446) [-1213.573] * (-1211.462) [-1213.760] (-1214.052) (-1216.208) -- 0:01:00
      63000 -- (-1212.922) (-1213.686) (-1217.967) [-1214.223] * (-1211.702) (-1213.861) [-1210.187] (-1214.563) -- 0:00:59
      63500 -- (-1211.926) (-1214.174) [-1211.412] (-1213.347) * [-1212.048] (-1213.012) (-1210.410) (-1212.654) -- 0:00:58
      64000 -- (-1214.257) (-1212.837) (-1211.179) [-1211.379] * (-1211.323) (-1212.853) [-1211.607] (-1210.777) -- 0:00:58
      64500 -- [-1212.485] (-1215.183) (-1212.692) (-1211.532) * (-1211.443) (-1212.411) (-1212.419) [-1210.985] -- 0:00:58
      65000 -- (-1213.963) [-1211.916] (-1213.657) (-1211.647) * (-1213.626) (-1211.561) (-1213.753) [-1213.075] -- 0:00:57

      Average standard deviation of split frequencies: 0.025356

      65500 -- (-1216.504) [-1212.718] (-1215.090) (-1214.493) * [-1214.599] (-1213.758) (-1212.063) (-1212.769) -- 0:00:57
      66000 -- (-1212.359) (-1212.886) (-1210.736) [-1211.709] * (-1214.815) [-1210.988] (-1211.702) (-1211.389) -- 0:00:56
      66500 -- (-1210.544) (-1215.080) [-1210.827] (-1212.383) * [-1212.296] (-1215.077) (-1211.790) (-1213.240) -- 0:00:56
      67000 -- (-1212.915) (-1214.574) [-1211.383] (-1211.735) * (-1211.751) (-1212.597) (-1210.970) [-1214.852] -- 0:00:55
      67500 -- [-1213.039] (-1217.220) (-1212.846) (-1217.253) * (-1213.413) (-1211.304) (-1212.042) [-1212.620] -- 0:01:09
      68000 -- [-1211.279] (-1215.936) (-1212.384) (-1215.711) * (-1214.466) (-1211.436) (-1210.285) [-1210.922] -- 0:01:08
      68500 -- (-1210.567) (-1214.460) [-1213.260] (-1216.830) * (-1212.939) [-1211.425] (-1211.497) (-1210.907) -- 0:01:07
      69000 -- (-1213.133) [-1211.097] (-1212.452) (-1214.164) * (-1211.660) (-1211.378) (-1212.333) [-1210.605] -- 0:01:07
      69500 -- (-1213.491) [-1211.340] (-1212.037) (-1211.410) * [-1211.578] (-1212.697) (-1210.303) (-1211.916) -- 0:01:06
      70000 -- (-1210.934) [-1213.510] (-1212.865) (-1213.368) * (-1212.167) (-1212.383) (-1212.747) [-1211.921] -- 0:01:06

      Average standard deviation of split frequencies: 0.024928

      70500 -- (-1210.935) [-1213.948] (-1214.362) (-1213.225) * (-1211.793) (-1213.450) [-1210.803] (-1215.462) -- 0:01:05
      71000 -- (-1212.911) (-1213.723) [-1210.798] (-1213.417) * (-1212.397) (-1212.064) (-1213.164) [-1214.511] -- 0:01:05
      71500 -- (-1211.528) (-1212.109) (-1211.954) [-1211.349] * (-1211.618) (-1211.147) [-1211.390] (-1213.377) -- 0:01:04
      72000 -- (-1213.254) (-1214.477) (-1213.143) [-1210.531] * (-1213.242) (-1214.867) (-1213.034) [-1214.223] -- 0:01:04
      72500 -- (-1211.699) (-1211.629) (-1213.706) [-1210.598] * (-1211.715) (-1213.325) [-1212.487] (-1212.026) -- 0:01:03
      73000 -- (-1214.172) [-1214.180] (-1214.860) (-1210.825) * (-1211.278) (-1212.807) (-1211.373) [-1211.573] -- 0:01:03
      73500 -- (-1211.550) [-1213.336] (-1212.454) (-1211.124) * (-1215.376) (-1211.750) [-1213.376] (-1211.711) -- 0:01:03
      74000 -- [-1212.206] (-1214.013) (-1214.106) (-1211.099) * (-1212.780) (-1212.264) (-1211.226) [-1211.194] -- 0:01:02
      74500 -- (-1212.604) (-1214.496) [-1213.091] (-1213.417) * (-1212.738) (-1215.293) [-1210.812] (-1212.191) -- 0:01:02
      75000 -- (-1210.629) (-1214.905) [-1210.627] (-1210.956) * (-1211.966) (-1210.686) (-1210.974) [-1213.835] -- 0:01:01

      Average standard deviation of split frequencies: 0.025137

      75500 -- [-1211.421] (-1213.015) (-1211.181) (-1215.935) * (-1216.724) (-1212.301) (-1211.149) [-1214.283] -- 0:01:01
      76000 -- (-1211.143) (-1213.121) [-1211.198] (-1213.399) * [-1212.327] (-1211.042) (-1210.687) (-1212.679) -- 0:01:00
      76500 -- (-1214.404) (-1215.197) [-1213.329] (-1228.194) * (-1212.142) [-1212.347] (-1210.669) (-1212.232) -- 0:01:00
      77000 -- (-1212.128) (-1216.323) [-1216.103] (-1216.859) * (-1212.610) (-1217.682) [-1210.669] (-1212.917) -- 0:00:59
      77500 -- (-1211.315) (-1213.034) [-1212.238] (-1215.584) * (-1211.957) (-1212.633) [-1211.236] (-1210.714) -- 0:00:59
      78000 -- [-1213.398] (-1215.679) (-1211.877) (-1211.836) * [-1211.037] (-1213.108) (-1211.107) (-1212.106) -- 0:00:59
      78500 -- [-1213.390] (-1212.446) (-1210.587) (-1212.086) * (-1211.043) [-1212.580] (-1211.375) (-1210.752) -- 0:00:58
      79000 -- (-1212.541) (-1215.070) (-1210.609) [-1212.390] * (-1211.554) (-1211.820) (-1212.110) [-1214.321] -- 0:00:58
      79500 -- (-1213.664) (-1210.979) [-1214.779] (-1211.527) * (-1211.073) (-1212.596) (-1216.370) [-1211.606] -- 0:00:57
      80000 -- (-1212.654) (-1211.251) [-1211.903] (-1211.200) * (-1210.987) (-1213.268) (-1210.836) [-1215.234] -- 0:00:57

      Average standard deviation of split frequencies: 0.026947

      80500 -- (-1215.770) (-1211.326) (-1214.761) [-1214.034] * (-1210.693) (-1212.635) [-1211.634] (-1212.540) -- 0:00:57
      81000 -- (-1211.683) (-1211.235) [-1213.377] (-1214.959) * (-1210.205) [-1212.641] (-1210.948) (-1213.715) -- 0:00:56
      81500 -- (-1212.156) [-1213.960] (-1213.380) (-1211.924) * (-1210.323) (-1210.317) [-1211.079] (-1211.386) -- 0:00:56
      82000 -- [-1210.307] (-1214.368) (-1216.546) (-1212.207) * (-1213.207) (-1211.204) [-1213.504] (-1213.234) -- 0:00:55
      82500 -- [-1210.614] (-1214.945) (-1212.125) (-1210.926) * (-1213.081) (-1212.133) (-1212.763) [-1211.148] -- 0:00:55
      83000 -- (-1210.327) (-1213.075) (-1211.961) [-1211.639] * (-1213.259) [-1211.638] (-1213.367) (-1214.315) -- 0:00:55
      83500 -- [-1210.771] (-1212.517) (-1211.374) (-1211.055) * [-1211.352] (-1214.081) (-1215.371) (-1222.216) -- 0:00:54
      84000 -- (-1214.037) (-1214.682) (-1212.460) [-1211.300] * (-1213.206) (-1215.960) [-1212.518] (-1212.976) -- 0:01:05
      84500 -- (-1213.102) (-1214.555) (-1211.485) [-1215.277] * (-1213.096) (-1212.072) (-1213.046) [-1213.111] -- 0:01:05
      85000 -- (-1216.214) (-1212.517) [-1210.826] (-1213.377) * (-1212.217) [-1216.026] (-1213.570) (-1213.106) -- 0:01:04

      Average standard deviation of split frequencies: 0.023296

      85500 -- (-1213.979) (-1213.785) (-1212.748) [-1217.481] * [-1211.825] (-1213.221) (-1211.778) (-1212.187) -- 0:01:04
      86000 -- (-1213.451) [-1213.344] (-1210.856) (-1214.858) * (-1213.462) (-1212.586) [-1211.057] (-1212.344) -- 0:01:03
      86500 -- (-1211.819) (-1212.794) (-1210.514) [-1214.840] * [-1210.712] (-1212.448) (-1213.184) (-1212.273) -- 0:01:03
      87000 -- (-1214.662) (-1214.440) [-1211.141] (-1215.056) * (-1211.538) (-1215.845) (-1211.420) [-1213.903] -- 0:01:02
      87500 -- (-1212.212) (-1212.902) (-1210.801) [-1212.986] * (-1211.769) [-1212.666] (-1213.599) (-1212.657) -- 0:01:02
      88000 -- (-1210.830) [-1212.380] (-1211.403) (-1213.747) * (-1210.404) (-1213.459) [-1210.839] (-1211.420) -- 0:01:02
      88500 -- [-1213.873] (-1213.797) (-1211.493) (-1211.738) * (-1210.366) (-1211.194) (-1212.038) [-1210.410] -- 0:01:01
      89000 -- [-1212.614] (-1214.038) (-1212.385) (-1213.654) * (-1213.971) (-1212.781) [-1211.670] (-1215.004) -- 0:01:01
      89500 -- (-1213.484) (-1210.623) (-1211.065) [-1212.733] * (-1213.915) (-1212.806) (-1211.368) [-1210.987] -- 0:01:01
      90000 -- (-1212.014) (-1214.719) [-1212.576] (-1212.095) * (-1212.469) (-1218.036) (-1211.434) [-1210.572] -- 0:01:00

      Average standard deviation of split frequencies: 0.021892

      90500 -- [-1219.127] (-1215.382) (-1210.979) (-1215.235) * (-1217.580) (-1219.178) [-1211.191] (-1213.920) -- 0:01:00
      91000 -- (-1214.766) (-1210.983) [-1211.107] (-1215.177) * (-1215.754) [-1213.778] (-1211.805) (-1211.449) -- 0:00:59
      91500 -- (-1210.610) (-1210.866) [-1211.095] (-1213.912) * (-1215.868) (-1211.977) [-1210.464] (-1211.823) -- 0:00:59
      92000 -- (-1217.290) (-1215.163) [-1213.080] (-1212.067) * (-1212.525) (-1212.352) [-1210.480] (-1214.363) -- 0:00:59
      92500 -- (-1213.739) (-1226.468) [-1213.538] (-1215.264) * (-1212.135) (-1214.645) (-1210.449) [-1211.405] -- 0:00:58
      93000 -- (-1212.307) (-1226.775) (-1214.248) [-1210.973] * (-1214.602) (-1211.372) (-1211.294) [-1212.421] -- 0:00:58
      93500 -- (-1211.667) (-1219.293) [-1211.915] (-1214.107) * (-1215.603) (-1212.073) [-1213.734] (-1214.742) -- 0:00:58
      94000 -- (-1213.027) (-1215.993) [-1211.489] (-1210.637) * (-1212.171) [-1212.953] (-1212.287) (-1216.029) -- 0:00:57
      94500 -- (-1211.116) [-1213.647] (-1210.726) (-1211.107) * [-1211.442] (-1212.455) (-1213.186) (-1211.825) -- 0:00:57
      95000 -- (-1210.700) (-1213.749) (-1212.882) [-1212.252] * [-1212.493] (-1215.796) (-1211.439) (-1216.030) -- 0:00:57

      Average standard deviation of split frequencies: 0.021006

      95500 -- (-1211.010) (-1215.543) [-1214.225] (-1215.835) * [-1215.100] (-1214.562) (-1212.723) (-1211.652) -- 0:00:56
      96000 -- (-1210.349) (-1214.515) (-1211.354) [-1212.841] * (-1214.153) (-1214.348) [-1211.711] (-1212.811) -- 0:00:56
      96500 -- (-1210.358) (-1215.820) [-1211.735] (-1212.325) * (-1214.369) (-1213.090) (-1210.569) [-1212.843] -- 0:00:56
      97000 -- [-1214.536] (-1214.543) (-1211.609) (-1214.756) * (-1213.517) (-1211.773) (-1211.218) [-1212.098] -- 0:00:55
      97500 -- (-1212.511) [-1213.579] (-1211.301) (-1212.004) * (-1213.176) (-1210.879) [-1210.538] (-1210.631) -- 0:00:55
      98000 -- (-1214.154) (-1212.828) [-1214.157] (-1211.201) * (-1211.667) (-1210.415) (-1214.366) [-1210.534] -- 0:00:55
      98500 -- (-1213.268) (-1210.706) (-1213.928) [-1211.434] * [-1211.261] (-1211.450) (-1214.135) (-1211.982) -- 0:01:04
      99000 -- (-1216.595) [-1210.516] (-1212.164) (-1211.081) * (-1211.657) (-1210.739) (-1211.936) [-1211.945] -- 0:01:03
      99500 -- (-1215.661) (-1214.087) (-1213.342) [-1216.942] * (-1211.710) [-1213.369] (-1211.801) (-1214.431) -- 0:01:03
      100000 -- (-1212.605) (-1212.868) [-1214.249] (-1213.137) * (-1211.016) (-1214.493) (-1214.609) [-1210.708] -- 0:01:02

      Average standard deviation of split frequencies: 0.021486

      100500 -- (-1213.541) (-1211.399) (-1211.281) [-1211.735] * (-1211.894) (-1215.937) (-1214.061) [-1211.105] -- 0:01:02
      101000 -- (-1217.480) (-1211.448) [-1211.078] (-1211.052) * (-1210.514) (-1212.680) [-1212.472] (-1212.139) -- 0:01:02
      101500 -- (-1215.271) [-1212.304] (-1212.289) (-1211.088) * (-1212.187) (-1213.645) [-1210.841] (-1211.952) -- 0:01:01
      102000 -- (-1210.456) [-1213.097] (-1212.621) (-1211.084) * [-1210.772] (-1210.969) (-1216.993) (-1213.035) -- 0:01:01
      102500 -- (-1211.005) [-1211.273] (-1212.980) (-1211.661) * [-1210.677] (-1211.429) (-1212.753) (-1211.135) -- 0:01:01
      103000 -- (-1212.313) (-1210.707) [-1213.526] (-1211.105) * (-1212.394) [-1213.536] (-1212.252) (-1212.720) -- 0:01:00
      103500 -- [-1210.873] (-1210.997) (-1216.066) (-1213.093) * (-1212.310) [-1213.329] (-1211.123) (-1212.510) -- 0:01:00
      104000 -- (-1211.927) (-1213.062) [-1213.405] (-1214.414) * (-1211.863) [-1213.338] (-1212.509) (-1213.716) -- 0:01:00
      104500 -- (-1213.120) (-1215.013) [-1213.392] (-1212.250) * [-1211.775] (-1211.548) (-1213.060) (-1212.136) -- 0:00:59
      105000 -- (-1212.600) (-1213.602) [-1212.062] (-1215.398) * (-1211.695) [-1211.893] (-1215.475) (-1212.409) -- 0:00:59

      Average standard deviation of split frequencies: 0.022938

      105500 -- (-1212.141) [-1213.108] (-1215.957) (-1210.985) * [-1212.343] (-1215.305) (-1214.201) (-1210.467) -- 0:00:59
      106000 -- (-1212.627) (-1210.786) (-1215.067) [-1212.316] * [-1214.011] (-1214.090) (-1215.336) (-1212.784) -- 0:00:59
      106500 -- [-1211.352] (-1211.047) (-1211.117) (-1216.435) * (-1215.492) (-1214.143) (-1214.999) [-1211.690] -- 0:00:58
      107000 -- (-1210.359) (-1212.509) (-1211.487) [-1210.872] * (-1212.862) [-1213.081] (-1215.981) (-1211.593) -- 0:00:58
      107500 -- (-1211.627) [-1212.021] (-1211.388) (-1211.091) * (-1214.329) (-1212.066) (-1211.276) [-1212.305] -- 0:00:58
      108000 -- (-1210.358) (-1210.840) (-1214.862) [-1212.768] * (-1213.596) (-1212.438) [-1210.795] (-1212.532) -- 0:00:57
      108500 -- (-1211.759) [-1212.797] (-1212.771) (-1212.249) * (-1213.991) (-1210.664) (-1211.089) [-1214.156] -- 0:00:57
      109000 -- [-1212.746] (-1212.809) (-1213.256) (-1212.049) * [-1210.963] (-1214.540) (-1211.258) (-1214.318) -- 0:00:57
      109500 -- (-1211.943) (-1212.351) [-1212.468] (-1213.274) * (-1212.349) (-1213.675) [-1212.252] (-1213.486) -- 0:00:56
      110000 -- (-1211.101) (-1213.568) [-1213.389] (-1213.748) * (-1213.565) (-1211.651) [-1211.882] (-1219.219) -- 0:00:56

      Average standard deviation of split frequencies: 0.022150

      110500 -- (-1211.436) (-1215.993) (-1213.974) [-1211.727] * (-1212.150) (-1212.693) (-1214.576) [-1215.335] -- 0:00:56
      111000 -- (-1210.878) (-1211.812) [-1211.963] (-1214.227) * [-1211.744] (-1211.913) (-1213.395) (-1215.406) -- 0:00:56
      111500 -- [-1211.262] (-1214.150) (-1218.121) (-1216.561) * (-1211.646) (-1210.837) (-1212.145) [-1211.930] -- 0:00:55
      112000 -- (-1210.801) [-1210.620] (-1216.402) (-1217.078) * [-1211.324] (-1212.897) (-1211.443) (-1211.603) -- 0:00:55
      112500 -- (-1211.339) (-1210.762) [-1213.617] (-1212.972) * (-1210.854) (-1210.506) [-1211.276] (-1210.884) -- 0:00:55
      113000 -- (-1211.674) [-1213.970] (-1215.809) (-1215.363) * (-1212.891) (-1210.852) [-1212.488] (-1214.955) -- 0:00:54
      113500 -- [-1212.419] (-1211.222) (-1213.702) (-1214.397) * (-1211.543) (-1212.089) [-1219.958] (-1214.010) -- 0:00:54
      114000 -- (-1214.700) (-1211.318) [-1214.512] (-1215.478) * (-1212.836) [-1211.243] (-1213.574) (-1212.883) -- 0:01:02
      114500 -- [-1214.916] (-1212.699) (-1212.652) (-1216.717) * (-1210.582) [-1210.628] (-1213.851) (-1212.761) -- 0:01:01
      115000 -- (-1212.652) [-1216.286] (-1212.150) (-1213.310) * [-1213.017] (-1211.106) (-1213.849) (-1212.109) -- 0:01:01

      Average standard deviation of split frequencies: 0.021867

      115500 -- [-1212.688] (-1213.062) (-1210.666) (-1214.371) * (-1212.394) (-1211.977) (-1214.020) [-1214.239] -- 0:01:01
      116000 -- [-1212.117] (-1214.379) (-1214.161) (-1214.039) * [-1211.426] (-1211.867) (-1211.938) (-1214.747) -- 0:01:00
      116500 -- (-1212.218) (-1211.637) [-1215.840] (-1214.654) * [-1212.501] (-1213.429) (-1213.635) (-1215.732) -- 0:01:00
      117000 -- [-1211.358] (-1211.359) (-1214.763) (-1216.830) * (-1212.898) (-1212.268) (-1212.355) [-1214.278] -- 0:01:00
      117500 -- (-1211.652) [-1213.443] (-1211.725) (-1213.167) * (-1217.748) [-1212.866] (-1211.925) (-1212.416) -- 0:01:00
      118000 -- (-1211.669) (-1211.333) [-1211.239] (-1212.756) * [-1215.601] (-1214.126) (-1211.962) (-1213.561) -- 0:00:59
      118500 -- (-1213.836) (-1214.233) (-1211.756) [-1211.927] * (-1214.619) [-1214.057] (-1212.398) (-1211.915) -- 0:00:59
      119000 -- (-1213.613) [-1216.869] (-1211.755) (-1215.841) * (-1213.342) (-1212.914) (-1213.573) [-1211.557] -- 0:00:59
      119500 -- [-1213.118] (-1213.275) (-1211.034) (-1211.325) * [-1212.288] (-1212.098) (-1213.617) (-1213.226) -- 0:00:58
      120000 -- (-1213.040) (-1213.780) (-1211.161) [-1213.564] * (-1211.793) (-1212.119) (-1214.927) [-1211.741] -- 0:00:58

      Average standard deviation of split frequencies: 0.021682

      120500 -- (-1213.314) [-1214.033] (-1211.333) (-1211.841) * (-1214.583) (-1211.739) (-1214.000) [-1212.363] -- 0:00:58
      121000 -- [-1212.968] (-1211.374) (-1211.625) (-1218.241) * (-1211.598) (-1214.366) [-1212.249] (-1211.284) -- 0:00:58
      121500 -- [-1213.282] (-1212.396) (-1212.543) (-1212.845) * [-1211.943] (-1216.400) (-1213.309) (-1212.913) -- 0:00:57
      122000 -- (-1214.748) (-1212.203) (-1212.402) [-1211.470] * [-1212.765] (-1220.811) (-1216.907) (-1212.028) -- 0:00:57
      122500 -- (-1215.807) (-1214.175) [-1211.207] (-1214.234) * (-1211.919) (-1212.969) (-1212.241) [-1210.416] -- 0:00:57
      123000 -- (-1210.901) (-1212.316) [-1211.194] (-1214.243) * [-1212.391] (-1211.457) (-1210.714) (-1210.235) -- 0:00:57
      123500 -- [-1212.605] (-1212.282) (-1213.641) (-1213.872) * [-1212.005] (-1210.586) (-1211.758) (-1213.219) -- 0:00:56
      124000 -- (-1212.859) (-1213.694) [-1211.773] (-1215.031) * (-1213.030) [-1211.577] (-1216.542) (-1212.241) -- 0:00:56
      124500 -- (-1212.023) (-1213.222) [-1213.097] (-1215.910) * (-1217.536) (-1212.264) (-1212.326) [-1211.023] -- 0:00:56
      125000 -- [-1210.809] (-1213.236) (-1212.779) (-1213.980) * (-1214.733) (-1212.102) (-1212.524) [-1211.053] -- 0:00:56

      Average standard deviation of split frequencies: 0.022635

      125500 -- (-1212.657) (-1210.493) [-1215.812] (-1211.489) * [-1211.344] (-1212.177) (-1212.617) (-1210.873) -- 0:00:55
      126000 -- [-1212.649] (-1212.541) (-1212.729) (-1215.350) * [-1210.887] (-1212.183) (-1212.008) (-1213.127) -- 0:00:55
      126500 -- (-1211.090) [-1212.562] (-1212.094) (-1212.058) * [-1210.744] (-1211.728) (-1214.344) (-1213.414) -- 0:00:55
      127000 -- (-1212.134) (-1210.798) (-1212.103) [-1214.138] * (-1213.315) [-1211.846] (-1214.003) (-1213.986) -- 0:00:54
      127500 -- [-1213.068] (-1211.058) (-1211.639) (-1211.453) * (-1211.074) (-1214.083) (-1213.354) [-1213.005] -- 0:00:54
      128000 -- (-1211.902) [-1210.589] (-1212.355) (-1210.587) * (-1211.275) (-1211.701) (-1213.265) [-1213.161] -- 0:00:54
      128500 -- (-1211.768) [-1211.164] (-1212.093) (-1211.171) * (-1212.070) (-1216.014) [-1212.504] (-1215.457) -- 0:00:54
      129000 -- (-1211.366) [-1211.759] (-1211.102) (-1212.008) * [-1210.603] (-1210.986) (-1211.897) (-1217.935) -- 0:00:54
      129500 -- (-1212.863) (-1211.042) [-1214.915] (-1211.137) * [-1211.758] (-1212.985) (-1210.986) (-1213.838) -- 0:00:53
      130000 -- (-1212.262) [-1213.223] (-1217.955) (-1210.971) * (-1214.367) [-1211.082] (-1211.341) (-1211.194) -- 0:01:00

      Average standard deviation of split frequencies: 0.023250

      130500 -- (-1211.822) (-1211.576) [-1216.927] (-1211.341) * (-1212.292) [-1211.587] (-1212.431) (-1216.327) -- 0:00:59
      131000 -- (-1214.490) [-1211.438] (-1217.157) (-1213.472) * [-1210.838] (-1213.011) (-1212.513) (-1214.741) -- 0:00:59
      131500 -- (-1211.269) (-1210.510) (-1213.731) [-1212.062] * (-1211.734) (-1213.100) (-1212.176) [-1212.870] -- 0:00:59
      132000 -- [-1210.952] (-1210.696) (-1212.346) (-1211.390) * (-1211.710) (-1217.143) [-1211.411] (-1212.012) -- 0:00:59
      132500 -- (-1212.887) (-1215.025) (-1213.439) [-1210.587] * (-1211.791) (-1213.845) [-1210.993] (-1212.837) -- 0:00:58
      133000 -- (-1210.711) (-1214.317) (-1214.267) [-1210.810] * (-1210.489) (-1213.080) (-1212.593) [-1211.811] -- 0:00:58
      133500 -- [-1212.719] (-1216.812) (-1211.220) (-1210.548) * [-1211.290] (-1212.496) (-1213.077) (-1211.155) -- 0:00:58
      134000 -- (-1211.216) (-1212.252) (-1212.078) [-1211.676] * [-1210.524] (-1212.447) (-1216.703) (-1211.684) -- 0:00:58
      134500 -- (-1212.113) (-1211.686) [-1211.295] (-1215.371) * [-1211.322] (-1211.460) (-1211.903) (-1211.088) -- 0:00:57
      135000 -- (-1213.878) (-1213.763) (-1215.799) [-1213.994] * (-1213.054) (-1215.256) [-1215.415] (-1210.776) -- 0:00:57

      Average standard deviation of split frequencies: 0.023686

      135500 -- (-1212.836) (-1212.651) (-1213.575) [-1214.388] * [-1212.400] (-1213.079) (-1211.720) (-1210.789) -- 0:00:57
      136000 -- (-1215.586) [-1217.034] (-1213.362) (-1214.299) * (-1212.457) (-1211.837) (-1212.883) [-1210.828] -- 0:00:57
      136500 -- (-1215.483) (-1222.099) [-1212.367] (-1215.605) * (-1216.845) [-1211.691] (-1213.114) (-1212.732) -- 0:00:56
      137000 -- (-1213.027) (-1212.443) [-1210.347] (-1215.515) * (-1211.818) (-1215.471) (-1213.342) [-1212.599] -- 0:00:56
      137500 -- [-1213.029] (-1212.309) (-1212.479) (-1216.090) * (-1211.361) [-1216.424] (-1211.978) (-1212.532) -- 0:00:56
      138000 -- [-1210.699] (-1210.395) (-1211.589) (-1218.144) * (-1211.132) (-1215.833) [-1212.288] (-1211.430) -- 0:00:56
      138500 -- (-1211.290) (-1210.938) (-1211.586) [-1214.568] * (-1213.508) (-1215.427) (-1211.573) [-1213.676] -- 0:00:55
      139000 -- (-1211.284) (-1210.768) [-1210.551] (-1211.287) * (-1211.599) [-1215.110] (-1212.020) (-1212.884) -- 0:00:55
      139500 -- (-1215.322) (-1214.947) (-1211.872) [-1215.377] * (-1211.619) (-1215.456) (-1211.327) [-1211.209] -- 0:00:55
      140000 -- (-1211.395) [-1211.355] (-1211.753) (-1215.555) * (-1212.039) (-1215.759) (-1213.189) [-1211.899] -- 0:00:55

      Average standard deviation of split frequencies: 0.022929

      140500 -- [-1213.588] (-1213.870) (-1211.712) (-1215.632) * [-1211.147] (-1211.631) (-1211.548) (-1213.920) -- 0:00:55
      141000 -- (-1213.544) (-1212.182) (-1214.501) [-1213.971] * [-1211.513] (-1214.448) (-1211.699) (-1212.094) -- 0:00:54
      141500 -- (-1217.649) [-1211.269] (-1211.814) (-1214.360) * (-1212.125) (-1212.335) [-1212.982] (-1212.126) -- 0:00:54
      142000 -- (-1218.961) (-1211.272) (-1212.290) [-1213.399] * (-1214.087) (-1213.172) [-1211.031] (-1211.620) -- 0:00:54
      142500 -- (-1213.080) (-1210.952) [-1214.995] (-1212.468) * [-1212.434] (-1211.510) (-1210.850) (-1212.600) -- 0:00:54
      143000 -- (-1211.978) (-1213.666) [-1211.590] (-1213.095) * (-1213.193) (-1214.079) (-1212.550) [-1212.410] -- 0:00:53
      143500 -- (-1213.825) [-1211.860] (-1214.186) (-1210.902) * (-1212.375) [-1217.798] (-1211.316) (-1213.729) -- 0:00:53
      144000 -- [-1211.628] (-1214.031) (-1213.481) (-1213.873) * (-1214.224) (-1212.355) (-1214.853) [-1211.728] -- 0:00:53
      144500 -- (-1213.591) (-1213.515) [-1211.616] (-1213.418) * [-1213.660] (-1217.405) (-1213.046) (-1212.313) -- 0:00:53
      145000 -- (-1215.958) [-1213.350] (-1214.693) (-1212.301) * [-1212.899] (-1214.575) (-1212.964) (-1212.496) -- 0:00:53

      Average standard deviation of split frequencies: 0.024377

      145500 -- [-1212.680] (-1213.818) (-1210.579) (-1211.466) * (-1210.824) (-1217.700) (-1212.915) [-1212.681] -- 0:00:58
      146000 -- (-1212.969) (-1214.073) (-1211.319) [-1211.274] * [-1211.013] (-1212.882) (-1214.968) (-1212.749) -- 0:00:58
      146500 -- (-1212.130) (-1213.544) (-1212.667) [-1211.126] * [-1212.177] (-1211.557) (-1212.238) (-1217.047) -- 0:00:58
      147000 -- (-1211.998) (-1211.446) [-1215.777] (-1214.168) * (-1211.249) (-1212.299) (-1211.366) [-1213.521] -- 0:00:58
      147500 -- (-1211.349) (-1211.571) [-1213.852] (-1212.548) * [-1210.569] (-1214.293) (-1210.493) (-1212.919) -- 0:00:57
      148000 -- (-1211.164) (-1212.414) [-1212.052] (-1213.760) * [-1210.621] (-1214.001) (-1210.494) (-1213.191) -- 0:00:57
      148500 -- [-1211.191] (-1213.917) (-1212.704) (-1216.125) * (-1212.989) (-1211.630) (-1211.372) [-1212.076] -- 0:00:57
      149000 -- [-1211.354] (-1212.177) (-1211.981) (-1213.677) * (-1212.799) (-1211.691) (-1211.626) [-1210.483] -- 0:00:57
      149500 -- (-1213.399) (-1212.720) (-1213.961) [-1211.018] * (-1214.576) (-1211.609) [-1211.624] (-1213.017) -- 0:00:56
      150000 -- (-1211.835) (-1212.509) (-1213.512) [-1211.697] * (-1217.868) [-1212.404] (-1211.616) (-1211.219) -- 0:00:56

      Average standard deviation of split frequencies: 0.022944

      150500 -- [-1211.405] (-1215.231) (-1213.235) (-1210.941) * (-1212.434) (-1212.878) [-1213.258] (-1214.225) -- 0:00:56
      151000 -- (-1214.604) (-1212.260) (-1212.284) [-1211.718] * (-1211.118) [-1211.893] (-1213.656) (-1211.983) -- 0:00:56
      151500 -- [-1212.389] (-1211.502) (-1214.901) (-1211.488) * (-1213.860) (-1212.488) [-1213.077] (-1217.402) -- 0:00:56
      152000 -- (-1215.231) (-1211.731) [-1211.422] (-1212.267) * [-1215.323] (-1215.115) (-1211.808) (-1213.282) -- 0:00:55
      152500 -- (-1211.917) (-1212.734) [-1212.608] (-1211.554) * (-1212.872) (-1213.302) (-1210.743) [-1213.868] -- 0:00:55
      153000 -- (-1211.349) (-1214.992) [-1215.748] (-1210.443) * (-1212.841) (-1216.958) (-1210.989) [-1214.090] -- 0:00:55
      153500 -- (-1211.770) (-1215.562) (-1213.405) [-1211.094] * (-1213.758) [-1210.492] (-1210.547) (-1212.524) -- 0:00:55
      154000 -- (-1211.382) (-1212.933) [-1210.241] (-1210.849) * (-1213.281) (-1210.876) (-1213.670) [-1210.783] -- 0:00:54
      154500 -- [-1211.881] (-1213.849) (-1212.830) (-1211.775) * (-1214.556) (-1214.155) [-1212.236] (-1210.946) -- 0:00:54
      155000 -- (-1212.252) [-1213.158] (-1212.798) (-1211.685) * (-1212.127) [-1213.133] (-1213.492) (-1212.926) -- 0:00:54

      Average standard deviation of split frequencies: 0.022815

      155500 -- (-1212.746) [-1212.708] (-1214.249) (-1213.192) * (-1212.598) [-1213.426] (-1213.346) (-1211.342) -- 0:00:54
      156000 -- (-1211.608) (-1212.446) (-1211.692) [-1211.142] * (-1211.494) (-1211.983) [-1212.856] (-1212.701) -- 0:00:54
      156500 -- (-1213.612) (-1219.013) [-1212.682] (-1214.247) * (-1214.580) (-1213.965) [-1214.588] (-1213.142) -- 0:00:53
      157000 -- (-1210.504) (-1212.455) [-1213.723] (-1215.559) * (-1211.111) (-1212.706) (-1214.023) [-1213.538] -- 0:00:53
      157500 -- (-1217.368) [-1212.933] (-1218.265) (-1215.052) * [-1211.843] (-1212.779) (-1212.240) (-1212.500) -- 0:00:53
      158000 -- (-1216.714) [-1211.955] (-1212.753) (-1213.076) * [-1212.955] (-1215.546) (-1213.782) (-1212.128) -- 0:00:53
      158500 -- (-1212.928) [-1212.468] (-1214.665) (-1215.678) * [-1213.362] (-1211.984) (-1213.335) (-1211.821) -- 0:00:53
      159000 -- (-1210.573) (-1213.718) [-1213.741] (-1211.940) * (-1216.845) (-1211.470) (-1211.157) [-1212.630] -- 0:00:52
      159500 -- (-1212.902) [-1213.835] (-1218.054) (-1211.272) * (-1213.200) (-1210.828) (-1213.191) [-1210.527] -- 0:00:52
      160000 -- [-1210.368] (-1217.118) (-1218.737) (-1213.679) * (-1214.095) (-1211.038) (-1210.507) [-1210.572] -- 0:00:52

      Average standard deviation of split frequencies: 0.021056

      160500 -- (-1217.714) [-1214.942] (-1214.131) (-1221.832) * (-1213.775) (-1212.186) (-1210.614) [-1214.353] -- 0:00:52
      161000 -- (-1213.059) (-1214.838) (-1211.822) [-1217.717] * (-1211.966) (-1215.310) (-1215.272) [-1211.954] -- 0:00:52
      161500 -- (-1215.976) [-1215.041] (-1212.540) (-1212.971) * (-1212.685) (-1211.451) (-1212.358) [-1215.800] -- 0:00:57
      162000 -- (-1217.092) (-1214.473) (-1212.722) [-1213.093] * (-1213.228) [-1211.212] (-1211.604) (-1210.794) -- 0:00:56
      162500 -- (-1219.866) (-1213.110) (-1213.796) [-1212.368] * (-1210.834) (-1211.212) [-1211.571] (-1211.877) -- 0:00:56
      163000 -- (-1213.880) (-1212.340) (-1212.531) [-1213.998] * (-1211.613) [-1213.684] (-1215.094) (-1210.715) -- 0:00:56
      163500 -- (-1214.822) (-1211.121) [-1212.528] (-1211.871) * (-1212.723) (-1213.852) (-1211.511) [-1212.740] -- 0:00:56
      164000 -- (-1211.128) [-1211.045] (-1210.557) (-1211.826) * (-1214.726) (-1211.238) [-1211.248] (-1212.422) -- 0:00:56
      164500 -- [-1211.391] (-1210.403) (-1210.904) (-1212.966) * (-1213.316) [-1218.518] (-1211.076) (-1212.328) -- 0:00:55
      165000 -- (-1213.879) (-1219.958) (-1211.999) [-1211.751] * (-1212.529) (-1214.651) (-1212.564) [-1211.618] -- 0:00:55

      Average standard deviation of split frequencies: 0.020925

      165500 -- (-1212.456) (-1212.399) (-1212.448) [-1212.456] * (-1211.925) [-1212.261] (-1212.092) (-1211.702) -- 0:00:55
      166000 -- [-1213.736] (-1212.097) (-1211.885) (-1212.742) * (-1212.882) (-1212.187) [-1213.017] (-1216.637) -- 0:00:55
      166500 -- (-1218.920) (-1211.963) (-1210.952) [-1212.150] * (-1212.715) [-1212.670] (-1214.790) (-1213.099) -- 0:00:55
      167000 -- (-1214.743) [-1211.497] (-1213.051) (-1214.299) * (-1213.093) (-1212.014) [-1213.812] (-1214.167) -- 0:00:54
      167500 -- (-1213.155) (-1212.037) (-1212.664) [-1212.174] * [-1213.490] (-1220.619) (-1213.787) (-1211.293) -- 0:00:54
      168000 -- (-1212.300) (-1211.933) [-1210.881] (-1211.966) * [-1211.026] (-1214.479) (-1212.089) (-1213.256) -- 0:00:54
      168500 -- (-1213.348) [-1213.742] (-1212.588) (-1211.491) * (-1212.356) (-1214.648) [-1213.085] (-1213.450) -- 0:00:54
      169000 -- (-1213.935) (-1211.571) [-1211.234] (-1213.724) * [-1212.008] (-1211.510) (-1214.713) (-1212.337) -- 0:00:54
      169500 -- (-1212.325) (-1215.052) [-1212.747] (-1212.650) * (-1215.857) (-1216.698) (-1214.584) [-1212.831] -- 0:00:53
      170000 -- (-1213.612) (-1221.064) (-1210.851) [-1210.869] * (-1212.581) (-1212.271) [-1210.185] (-1212.445) -- 0:00:53

      Average standard deviation of split frequencies: 0.021637

      170500 -- (-1214.638) [-1214.610] (-1212.267) (-1211.919) * (-1213.681) [-1215.205] (-1214.807) (-1211.659) -- 0:00:53
      171000 -- (-1212.097) (-1215.810) (-1215.289) [-1212.573] * (-1213.237) [-1213.996] (-1213.904) (-1211.234) -- 0:00:53
      171500 -- (-1212.887) (-1213.201) (-1219.733) [-1210.470] * [-1214.052] (-1211.702) (-1218.807) (-1212.563) -- 0:00:53
      172000 -- (-1215.245) [-1213.084] (-1216.271) (-1211.088) * (-1215.764) (-1211.603) [-1214.074] (-1211.845) -- 0:00:52
      172500 -- [-1211.622] (-1211.704) (-1212.720) (-1213.228) * (-1214.992) (-1211.902) (-1214.543) [-1212.957] -- 0:00:52
      173000 -- (-1213.937) (-1211.563) (-1212.767) [-1212.216] * (-1213.904) [-1212.785] (-1212.605) (-1212.269) -- 0:00:52
      173500 -- [-1210.733] (-1214.756) (-1213.805) (-1212.941) * [-1214.693] (-1211.603) (-1214.644) (-1212.568) -- 0:00:52
      174000 -- (-1214.418) (-1215.761) (-1212.201) [-1211.156] * (-1213.905) (-1211.616) [-1213.592] (-1212.560) -- 0:00:52
      174500 -- (-1214.297) (-1210.843) (-1216.123) [-1214.230] * (-1212.730) (-1214.815) [-1215.388] (-1214.099) -- 0:00:52
      175000 -- [-1212.166] (-1210.867) (-1214.893) (-1216.118) * (-1214.673) [-1212.910] (-1210.807) (-1216.293) -- 0:00:51

      Average standard deviation of split frequencies: 0.020237

      175500 -- [-1211.194] (-1212.924) (-1212.397) (-1213.186) * (-1219.785) (-1211.683) (-1213.887) [-1211.420] -- 0:00:51
      176000 -- (-1210.586) (-1213.918) (-1216.101) [-1213.201] * (-1216.883) (-1211.487) (-1210.546) [-1211.825] -- 0:00:51
      176500 -- (-1212.191) [-1213.460] (-1216.448) (-1218.608) * (-1213.123) (-1212.337) [-1214.585] (-1215.973) -- 0:00:51
      177000 -- (-1212.058) [-1212.439] (-1213.075) (-1216.081) * (-1211.527) (-1211.460) (-1211.682) [-1213.103] -- 0:00:51
      177500 -- (-1212.226) [-1210.930] (-1212.322) (-1216.143) * (-1212.469) [-1212.756] (-1211.515) (-1214.469) -- 0:00:55
      178000 -- (-1211.719) (-1214.535) [-1211.553] (-1211.535) * (-1211.771) (-1211.517) (-1214.467) [-1213.258] -- 0:00:55
      178500 -- (-1212.190) (-1210.636) [-1212.105] (-1212.468) * (-1210.627) [-1211.463] (-1218.833) (-1215.272) -- 0:00:55
      179000 -- (-1214.134) [-1211.575] (-1212.075) (-1211.077) * [-1211.197] (-1211.962) (-1212.691) (-1213.083) -- 0:00:55
      179500 -- [-1214.887] (-1214.577) (-1211.133) (-1211.193) * (-1215.280) [-1211.515] (-1213.053) (-1211.780) -- 0:00:54
      180000 -- (-1212.396) (-1214.559) (-1211.910) [-1211.407] * (-1211.431) [-1211.810] (-1210.332) (-1215.897) -- 0:00:54

      Average standard deviation of split frequencies: 0.020294

      180500 -- (-1212.907) (-1217.668) [-1211.049] (-1212.486) * (-1210.674) [-1213.210] (-1215.839) (-1211.974) -- 0:00:54
      181000 -- (-1211.157) (-1213.950) (-1211.182) [-1212.969] * (-1211.437) (-1212.075) [-1213.627] (-1217.269) -- 0:00:54
      181500 -- (-1211.017) (-1211.694) [-1210.873] (-1215.366) * (-1211.299) [-1210.709] (-1213.627) (-1211.490) -- 0:00:54
      182000 -- (-1211.288) [-1213.274] (-1210.875) (-1212.699) * (-1211.367) (-1211.225) (-1214.727) [-1210.561] -- 0:00:53
      182500 -- (-1211.721) (-1212.281) [-1211.709] (-1214.011) * (-1211.906) (-1214.078) (-1210.735) [-1210.648] -- 0:00:53
      183000 -- (-1213.091) (-1214.514) [-1211.794] (-1215.552) * (-1212.177) (-1213.509) [-1210.244] (-1212.037) -- 0:00:53
      183500 -- (-1213.561) (-1212.842) [-1210.937] (-1213.219) * (-1215.908) [-1214.659] (-1211.326) (-1210.438) -- 0:00:53
      184000 -- (-1212.319) [-1217.832] (-1210.562) (-1211.734) * (-1215.914) [-1210.746] (-1212.428) (-1212.708) -- 0:00:53
      184500 -- (-1211.199) (-1211.821) (-1211.464) [-1211.493] * [-1214.326] (-1211.675) (-1211.297) (-1211.971) -- 0:00:53
      185000 -- (-1210.606) [-1211.564] (-1211.386) (-1214.190) * (-1213.277) (-1211.648) (-1211.428) [-1212.785] -- 0:00:52

      Average standard deviation of split frequencies: 0.018445

      185500 -- (-1211.922) (-1213.218) (-1211.389) [-1211.272] * [-1213.141] (-1214.650) (-1214.641) (-1213.385) -- 0:00:52
      186000 -- (-1212.379) [-1211.754] (-1212.497) (-1214.485) * (-1212.366) (-1216.750) (-1210.874) [-1212.639] -- 0:00:52
      186500 -- (-1212.233) (-1211.422) (-1216.291) [-1213.418] * [-1210.475] (-1216.048) (-1211.275) (-1214.070) -- 0:00:52
      187000 -- (-1211.913) (-1211.022) [-1213.136] (-1215.274) * (-1211.673) (-1214.402) (-1212.871) [-1214.457] -- 0:00:52
      187500 -- (-1211.611) [-1211.725] (-1212.891) (-1215.636) * (-1212.989) [-1214.371] (-1211.103) (-1216.058) -- 0:00:52
      188000 -- (-1218.051) [-1210.896] (-1213.127) (-1213.178) * [-1216.258] (-1210.471) (-1211.351) (-1216.295) -- 0:00:51
      188500 -- (-1215.948) (-1210.648) (-1212.837) [-1210.918] * (-1213.247) [-1211.380] (-1211.150) (-1217.089) -- 0:00:51
      189000 -- (-1212.858) [-1212.186] (-1211.887) (-1211.031) * (-1216.012) [-1212.502] (-1214.790) (-1211.670) -- 0:00:51
      189500 -- (-1211.826) (-1212.948) (-1213.077) [-1211.993] * [-1214.308] (-1214.740) (-1213.269) (-1211.451) -- 0:00:51
      190000 -- (-1211.640) (-1210.901) (-1214.464) [-1211.853] * (-1213.765) (-1212.337) (-1214.987) [-1213.133] -- 0:00:51

      Average standard deviation of split frequencies: 0.017994

      190500 -- (-1211.893) (-1211.903) [-1212.519] (-1210.258) * (-1213.618) [-1214.644] (-1212.471) (-1211.916) -- 0:00:50
      191000 -- (-1215.010) [-1210.918] (-1212.815) (-1211.988) * (-1211.137) (-1221.570) [-1213.165] (-1211.127) -- 0:00:50
      191500 -- [-1212.297] (-1214.246) (-1211.059) (-1211.049) * (-1213.018) [-1214.231] (-1211.188) (-1212.946) -- 0:00:50
      192000 -- (-1212.539) (-1211.782) [-1211.358] (-1210.871) * (-1222.392) (-1210.947) [-1210.827] (-1213.971) -- 0:00:50
      192500 -- [-1212.518] (-1211.919) (-1211.122) (-1212.968) * (-1212.903) (-1214.733) [-1211.041] (-1212.235) -- 0:00:50
      193000 -- [-1213.114] (-1211.032) (-1210.471) (-1212.291) * (-1212.344) (-1211.450) [-1213.059] (-1212.035) -- 0:00:50
      193500 -- (-1212.571) (-1211.235) (-1211.360) [-1210.409] * [-1212.010] (-1211.394) (-1211.967) (-1210.414) -- 0:00:54
      194000 -- (-1213.610) [-1211.149] (-1211.730) (-1210.378) * (-1210.457) (-1211.614) [-1212.548] (-1211.215) -- 0:00:54
      194500 -- (-1215.190) (-1210.841) (-1211.198) [-1214.290] * (-1212.394) [-1212.870] (-1215.770) (-1210.619) -- 0:00:53
      195000 -- (-1214.185) (-1210.953) (-1213.787) [-1212.018] * (-1217.970) (-1212.132) (-1212.268) [-1210.679] -- 0:00:53

      Average standard deviation of split frequencies: 0.018172

      195500 -- (-1213.046) (-1211.227) (-1211.346) [-1212.020] * (-1215.914) (-1211.997) (-1215.306) [-1211.644] -- 0:00:53
      196000 -- (-1211.204) (-1210.989) (-1211.212) [-1210.661] * (-1213.814) (-1210.637) (-1213.392) [-1211.621] -- 0:00:53
      196500 -- (-1211.760) [-1211.444] (-1212.375) (-1212.202) * (-1214.905) [-1211.284] (-1213.676) (-1213.236) -- 0:00:53
      197000 -- (-1212.125) [-1211.896] (-1212.500) (-1211.143) * (-1215.022) (-1211.393) (-1211.110) [-1214.620] -- 0:00:52
      197500 -- [-1213.085] (-1214.794) (-1212.799) (-1212.035) * [-1211.541] (-1212.670) (-1216.775) (-1214.809) -- 0:00:52
      198000 -- [-1211.967] (-1214.440) (-1215.540) (-1210.605) * (-1214.926) (-1212.179) [-1211.386] (-1212.819) -- 0:00:52
      198500 -- [-1210.678] (-1212.799) (-1215.429) (-1210.605) * (-1212.659) (-1212.644) (-1211.953) [-1214.367] -- 0:00:52
      199000 -- [-1210.683] (-1213.848) (-1217.271) (-1210.621) * [-1211.158] (-1211.481) (-1211.914) (-1213.731) -- 0:00:52
      199500 -- (-1211.884) (-1212.308) (-1211.546) [-1213.046] * [-1211.605] (-1211.900) (-1212.257) (-1213.260) -- 0:00:52
      200000 -- [-1211.246] (-1211.064) (-1211.797) (-1210.338) * (-1211.432) (-1214.229) [-1211.807] (-1213.222) -- 0:00:51

      Average standard deviation of split frequencies: 0.018103

      200500 -- (-1212.516) (-1210.992) (-1212.582) [-1213.388] * (-1214.675) (-1214.497) (-1213.324) [-1215.695] -- 0:00:51
      201000 -- (-1213.746) (-1212.431) (-1213.304) [-1213.291] * (-1214.687) [-1213.550] (-1215.366) (-1213.051) -- 0:00:51
      201500 -- (-1213.242) (-1212.528) [-1212.128] (-1211.339) * (-1214.515) (-1212.577) (-1212.238) [-1210.355] -- 0:00:51
      202000 -- (-1215.877) (-1210.376) (-1211.524) [-1211.353] * (-1213.182) (-1211.381) (-1212.860) [-1212.815] -- 0:00:51
      202500 -- (-1218.760) (-1212.122) (-1212.515) [-1212.475] * [-1212.229] (-1210.863) (-1210.756) (-1212.437) -- 0:00:51
      203000 -- [-1212.755] (-1212.204) (-1211.044) (-1213.047) * (-1215.538) (-1212.699) (-1211.048) [-1212.673] -- 0:00:51
      203500 -- (-1212.170) [-1210.803] (-1211.916) (-1211.754) * (-1213.087) [-1210.626] (-1211.831) (-1214.099) -- 0:00:50
      204000 -- (-1212.655) (-1212.481) (-1210.874) [-1210.945] * [-1212.950] (-1211.890) (-1211.997) (-1213.083) -- 0:00:50
      204500 -- (-1214.538) (-1214.400) [-1210.874] (-1211.318) * (-1212.100) [-1211.457] (-1211.359) (-1213.298) -- 0:00:50
      205000 -- (-1210.937) (-1211.954) (-1210.797) [-1210.877] * (-1212.641) (-1211.270) [-1213.098] (-1215.039) -- 0:00:50

      Average standard deviation of split frequencies: 0.018187

      205500 -- (-1211.301) (-1210.881) (-1211.144) [-1210.597] * [-1213.022] (-1211.980) (-1213.416) (-1214.893) -- 0:00:50
      206000 -- (-1215.063) (-1211.793) [-1210.941] (-1211.118) * [-1212.065] (-1212.217) (-1214.098) (-1219.066) -- 0:00:50
      206500 -- (-1210.841) [-1212.165] (-1211.700) (-1211.767) * [-1212.665] (-1219.605) (-1210.401) (-1216.301) -- 0:00:49
      207000 -- [-1211.864] (-1211.893) (-1214.998) (-1211.645) * (-1210.834) (-1219.195) [-1211.666] (-1214.126) -- 0:00:49
      207500 -- (-1212.167) (-1213.874) [-1213.182] (-1211.732) * [-1211.959] (-1212.719) (-1212.538) (-1215.600) -- 0:00:49
      208000 -- (-1213.713) [-1213.604] (-1213.107) (-1210.861) * [-1211.368] (-1212.398) (-1214.403) (-1215.877) -- 0:00:49
      208500 -- (-1214.724) (-1213.807) [-1213.365] (-1211.798) * (-1211.218) [-1211.825] (-1215.999) (-1216.368) -- 0:00:49
      209000 -- (-1213.359) (-1214.448) [-1212.146] (-1210.472) * (-1213.110) (-1211.156) (-1213.006) [-1216.923] -- 0:00:49
      209500 -- (-1213.084) (-1217.223) [-1213.326] (-1211.353) * [-1213.663] (-1210.644) (-1212.226) (-1219.092) -- 0:00:49
      210000 -- (-1210.825) [-1215.964] (-1212.661) (-1211.081) * (-1212.402) [-1211.644] (-1213.743) (-1215.114) -- 0:00:52

      Average standard deviation of split frequencies: 0.018961

      210500 -- (-1211.554) (-1214.621) (-1220.547) [-1213.268] * [-1214.064] (-1212.746) (-1214.830) (-1214.495) -- 0:00:52
      211000 -- (-1211.865) (-1216.250) (-1212.252) [-1212.953] * (-1210.974) [-1212.078] (-1212.148) (-1216.464) -- 0:00:52
      211500 -- (-1210.493) (-1212.599) [-1212.539] (-1213.955) * (-1212.546) [-1211.125] (-1212.067) (-1216.415) -- 0:00:52
      212000 -- (-1211.845) [-1212.185] (-1214.311) (-1214.577) * (-1212.239) (-1216.040) [-1212.121] (-1212.792) -- 0:00:52
      212500 -- (-1210.648) (-1211.141) [-1213.250] (-1213.060) * (-1215.643) (-1211.282) (-1214.254) [-1212.764] -- 0:00:51
      213000 -- (-1213.760) (-1212.836) [-1213.487] (-1213.010) * [-1215.138] (-1211.289) (-1216.530) (-1215.889) -- 0:00:51
      213500 -- (-1214.029) [-1214.110] (-1213.308) (-1213.705) * (-1210.411) [-1215.170] (-1213.279) (-1211.888) -- 0:00:51
      214000 -- (-1211.634) [-1211.122] (-1210.527) (-1212.163) * (-1210.594) (-1218.736) (-1212.984) [-1212.406] -- 0:00:51
      214500 -- [-1212.275] (-1211.998) (-1210.434) (-1215.323) * (-1211.840) (-1214.547) [-1213.403] (-1212.587) -- 0:00:51
      215000 -- (-1214.747) (-1211.484) (-1212.798) [-1215.350] * [-1213.311] (-1212.373) (-1213.067) (-1212.630) -- 0:00:51

      Average standard deviation of split frequencies: 0.018187

      215500 -- (-1211.963) (-1214.404) [-1210.824] (-1213.415) * [-1212.579] (-1213.332) (-1212.310) (-1214.091) -- 0:00:50
      216000 -- (-1211.939) (-1214.287) (-1219.008) [-1212.800] * [-1212.004] (-1214.285) (-1213.970) (-1217.091) -- 0:00:50
      216500 -- (-1211.908) [-1211.818] (-1214.580) (-1214.857) * [-1211.744] (-1211.845) (-1215.454) (-1211.623) -- 0:00:50
      217000 -- [-1212.972] (-1212.019) (-1217.265) (-1212.157) * (-1213.967) [-1213.468] (-1211.756) (-1211.315) -- 0:00:50
      217500 -- [-1212.462] (-1211.122) (-1212.541) (-1211.646) * (-1214.394) (-1210.660) [-1211.957] (-1212.107) -- 0:00:50
      218000 -- (-1213.158) [-1215.829] (-1212.140) (-1210.839) * (-1217.596) (-1213.803) [-1211.319] (-1210.756) -- 0:00:50
      218500 -- (-1210.369) [-1211.405] (-1213.328) (-1211.897) * (-1212.010) (-1214.317) (-1211.027) [-1214.389] -- 0:00:50
      219000 -- (-1210.659) (-1215.693) [-1212.696] (-1211.543) * (-1212.436) (-1210.748) [-1212.466] (-1215.215) -- 0:00:49
      219500 -- (-1212.046) [-1214.500] (-1212.744) (-1211.415) * (-1211.557) (-1211.170) (-1215.988) [-1211.404] -- 0:00:49
      220000 -- (-1210.979) (-1215.203) (-1215.403) [-1211.916] * (-1211.212) (-1211.701) [-1211.936] (-1210.542) -- 0:00:49

      Average standard deviation of split frequencies: 0.018633

      220500 -- [-1210.951] (-1213.306) (-1213.372) (-1211.230) * (-1210.808) (-1210.809) (-1210.935) [-1212.832] -- 0:00:49
      221000 -- (-1218.597) (-1213.609) [-1213.002] (-1213.407) * [-1211.206] (-1213.545) (-1210.923) (-1213.528) -- 0:00:49
      221500 -- (-1212.606) [-1217.287] (-1212.776) (-1212.000) * (-1213.787) [-1213.909] (-1213.450) (-1212.789) -- 0:00:49
      222000 -- (-1213.978) (-1215.625) [-1213.584] (-1212.142) * (-1210.798) [-1212.276] (-1210.968) (-1213.509) -- 0:00:49
      222500 -- [-1216.538] (-1212.547) (-1212.424) (-1210.961) * (-1212.066) [-1211.731] (-1211.868) (-1213.385) -- 0:00:48
      223000 -- (-1212.488) (-1213.889) (-1211.737) [-1212.357] * [-1214.776] (-1212.714) (-1211.761) (-1211.504) -- 0:00:48
      223500 -- (-1211.189) [-1212.255] (-1213.187) (-1211.238) * [-1212.728] (-1211.771) (-1211.761) (-1212.468) -- 0:00:48
      224000 -- (-1210.837) (-1216.726) [-1211.641] (-1211.867) * (-1212.092) (-1211.667) (-1210.868) [-1215.677] -- 0:00:48
      224500 -- (-1210.721) [-1211.818] (-1213.826) (-1212.025) * [-1213.214] (-1212.135) (-1211.470) (-1211.856) -- 0:00:48
      225000 -- (-1210.670) (-1214.372) [-1214.803] (-1214.117) * (-1212.632) (-1211.461) (-1210.872) [-1211.399] -- 0:00:48

      Average standard deviation of split frequencies: 0.018773

      225500 -- [-1211.266] (-1210.766) (-1212.528) (-1211.975) * (-1213.232) [-1212.764] (-1210.865) (-1210.728) -- 0:00:48
      226000 -- (-1212.017) (-1212.175) (-1212.204) [-1211.801] * (-1212.240) [-1211.981] (-1214.686) (-1211.202) -- 0:00:51
      226500 -- (-1210.616) (-1211.750) (-1212.793) [-1212.229] * (-1213.177) [-1217.994] (-1212.748) (-1211.443) -- 0:00:51
      227000 -- [-1210.625] (-1214.973) (-1213.587) (-1212.158) * (-1213.356) [-1217.665] (-1211.744) (-1214.982) -- 0:00:51
      227500 -- [-1210.647] (-1215.818) (-1218.327) (-1211.482) * [-1213.499] (-1212.448) (-1213.126) (-1213.822) -- 0:00:50
      228000 -- (-1210.759) (-1213.704) [-1211.618] (-1210.963) * (-1211.516) [-1212.635] (-1211.380) (-1214.743) -- 0:00:50
      228500 -- (-1214.774) [-1213.349] (-1212.480) (-1211.199) * (-1213.269) (-1211.047) [-1211.143] (-1212.981) -- 0:00:50
      229000 -- (-1213.050) [-1211.311] (-1211.379) (-1213.737) * (-1213.634) [-1212.753] (-1213.934) (-1212.281) -- 0:00:50
      229500 -- (-1211.998) [-1211.231] (-1212.891) (-1212.676) * (-1213.599) (-1212.557) [-1212.131] (-1216.856) -- 0:00:50
      230000 -- [-1211.909] (-1211.434) (-1211.794) (-1212.529) * (-1215.455) (-1211.547) [-1212.530] (-1214.549) -- 0:00:50

      Average standard deviation of split frequencies: 0.019528

      230500 -- (-1212.697) [-1211.928] (-1213.646) (-1213.544) * (-1215.476) [-1211.728] (-1212.881) (-1212.539) -- 0:00:50
      231000 -- [-1212.139] (-1211.514) (-1217.887) (-1210.787) * [-1215.684] (-1212.232) (-1214.045) (-1217.553) -- 0:00:49
      231500 -- (-1215.341) (-1212.281) (-1214.119) [-1211.898] * (-1214.544) (-1212.207) [-1218.943] (-1217.230) -- 0:00:49
      232000 -- (-1213.916) (-1210.374) (-1210.566) [-1213.507] * (-1212.541) (-1211.624) [-1212.188] (-1212.468) -- 0:00:49
      232500 -- (-1213.552) (-1211.282) (-1213.601) [-1211.223] * [-1212.561] (-1211.909) (-1212.953) (-1211.363) -- 0:00:49
      233000 -- (-1213.774) (-1212.673) [-1210.364] (-1212.929) * (-1210.511) (-1212.047) [-1212.464] (-1215.494) -- 0:00:49
      233500 -- (-1210.383) (-1211.287) (-1218.203) [-1215.412] * (-1212.056) [-1211.486] (-1211.009) (-1212.915) -- 0:00:49
      234000 -- (-1211.345) (-1211.223) [-1211.820] (-1216.465) * (-1212.005) [-1212.144] (-1210.861) (-1215.715) -- 0:00:49
      234500 -- (-1211.215) (-1212.135) (-1210.693) [-1212.723] * (-1211.789) (-1213.186) (-1211.557) [-1214.527] -- 0:00:48
      235000 -- (-1212.446) (-1218.926) [-1210.764] (-1211.019) * [-1210.690] (-1216.253) (-1210.939) (-1215.833) -- 0:00:48

      Average standard deviation of split frequencies: 0.020308

      235500 -- (-1213.731) (-1213.881) [-1210.845] (-1213.652) * (-1216.428) (-1213.694) [-1211.932] (-1214.735) -- 0:00:48
      236000 -- (-1212.071) [-1211.944] (-1212.530) (-1211.610) * (-1214.415) [-1212.212] (-1213.821) (-1211.469) -- 0:00:48
      236500 -- (-1217.041) (-1211.579) (-1212.493) [-1210.463] * (-1212.689) (-1213.908) (-1214.472) [-1211.080] -- 0:00:48
      237000 -- (-1214.513) (-1212.757) [-1211.191] (-1213.208) * (-1212.534) (-1211.591) (-1214.402) [-1212.368] -- 0:00:48
      237500 -- (-1211.994) [-1212.130] (-1211.997) (-1216.312) * [-1212.872] (-1214.605) (-1211.763) (-1214.018) -- 0:00:48
      238000 -- [-1211.534] (-1218.794) (-1210.539) (-1216.305) * (-1211.837) (-1212.994) (-1213.857) [-1212.499] -- 0:00:48
      238500 -- (-1211.444) (-1215.597) [-1211.746] (-1213.904) * (-1215.159) [-1211.682] (-1215.545) (-1215.073) -- 0:00:47
      239000 -- (-1213.173) (-1211.442) (-1212.691) [-1212.093] * (-1213.779) [-1212.652] (-1212.728) (-1216.390) -- 0:00:47
      239500 -- (-1213.451) [-1211.729] (-1212.004) (-1211.684) * (-1216.256) (-1212.556) (-1213.212) [-1210.907] -- 0:00:47
      240000 -- [-1212.437] (-1214.556) (-1211.927) (-1216.996) * [-1212.799] (-1211.053) (-1214.636) (-1211.229) -- 0:00:47

      Average standard deviation of split frequencies: 0.022199

      240500 -- (-1213.554) [-1212.994] (-1212.978) (-1216.810) * (-1214.628) [-1211.415] (-1215.107) (-1210.830) -- 0:00:47
      241000 -- (-1221.080) (-1214.078) [-1214.837] (-1211.891) * (-1218.210) (-1211.268) (-1212.567) [-1212.018] -- 0:00:47
      241500 -- (-1213.505) (-1217.548) [-1211.279] (-1211.910) * (-1217.156) [-1211.240] (-1216.980) (-1210.832) -- 0:00:50
      242000 -- [-1213.548] (-1212.416) (-1212.001) (-1215.135) * [-1211.933] (-1212.615) (-1213.659) (-1210.920) -- 0:00:50
      242500 -- (-1214.070) (-1213.019) (-1211.336) [-1212.572] * [-1211.897] (-1211.992) (-1215.615) (-1211.264) -- 0:00:49
      243000 -- (-1216.244) (-1211.687) [-1211.103] (-1214.594) * (-1212.112) (-1211.949) (-1214.772) [-1212.534] -- 0:00:49
      243500 -- (-1211.613) [-1211.420] (-1210.711) (-1214.246) * (-1211.726) [-1211.814] (-1214.779) (-1211.414) -- 0:00:49
      244000 -- (-1211.985) [-1211.283] (-1214.254) (-1219.773) * (-1212.742) [-1211.323] (-1211.452) (-1214.079) -- 0:00:49
      244500 -- (-1215.675) [-1211.461] (-1213.270) (-1213.706) * (-1213.050) [-1212.382] (-1211.787) (-1213.170) -- 0:00:49
      245000 -- (-1212.419) (-1212.387) (-1213.016) [-1212.599] * (-1211.781) [-1212.202] (-1212.021) (-1214.791) -- 0:00:49

      Average standard deviation of split frequencies: 0.020973

      245500 -- (-1213.812) [-1210.763] (-1212.790) (-1213.364) * (-1212.930) [-1214.339] (-1211.823) (-1212.898) -- 0:00:49
      246000 -- [-1213.485] (-1216.537) (-1213.368) (-1214.365) * (-1214.149) [-1214.192] (-1212.642) (-1212.865) -- 0:00:49
      246500 -- (-1212.636) [-1212.806] (-1211.676) (-1212.781) * (-1213.815) [-1212.332] (-1210.516) (-1212.658) -- 0:00:48
      247000 -- (-1214.134) (-1216.277) (-1210.568) [-1213.220] * (-1212.689) (-1213.011) (-1211.598) [-1212.415] -- 0:00:48
      247500 -- (-1211.826) (-1213.906) (-1211.551) [-1213.311] * (-1213.312) [-1210.622] (-1212.561) (-1212.540) -- 0:00:48
      248000 -- (-1211.091) (-1211.839) (-1211.290) [-1214.066] * (-1211.308) [-1212.176] (-1216.439) (-1212.653) -- 0:00:48
      248500 -- (-1212.851) (-1215.324) [-1212.036] (-1211.854) * (-1212.213) (-1212.518) [-1210.937] (-1212.003) -- 0:00:48
      249000 -- [-1211.745] (-1217.726) (-1211.929) (-1215.577) * (-1213.676) (-1213.803) [-1212.801] (-1211.480) -- 0:00:48
      249500 -- (-1213.275) (-1214.158) (-1211.523) [-1214.604] * [-1211.097] (-1212.439) (-1211.788) (-1212.456) -- 0:00:48
      250000 -- (-1216.828) (-1211.389) (-1212.596) [-1212.110] * (-1210.756) (-1213.186) (-1211.545) [-1210.757] -- 0:00:48

      Average standard deviation of split frequencies: 0.020164

      250500 -- (-1213.540) [-1211.456] (-1211.980) (-1213.844) * (-1211.228) (-1213.951) (-1212.204) [-1211.090] -- 0:00:47
      251000 -- (-1210.918) [-1210.704] (-1213.421) (-1217.735) * (-1212.171) (-1210.972) (-1214.719) [-1211.185] -- 0:00:47
      251500 -- (-1212.043) [-1211.515] (-1213.192) (-1213.743) * [-1213.429] (-1211.254) (-1214.303) (-1212.511) -- 0:00:47
      252000 -- (-1212.733) (-1211.555) (-1213.191) [-1215.635] * (-1217.133) [-1212.324] (-1213.780) (-1212.632) -- 0:00:47
      252500 -- (-1213.940) (-1211.454) [-1213.307] (-1214.708) * (-1212.514) [-1212.164] (-1211.273) (-1210.643) -- 0:00:47
      253000 -- (-1211.329) [-1211.942] (-1214.229) (-1212.379) * (-1211.176) [-1212.567] (-1212.181) (-1211.787) -- 0:00:47
      253500 -- (-1212.612) (-1212.411) (-1215.098) [-1212.481] * (-1212.071) [-1212.950] (-1211.676) (-1213.625) -- 0:00:47
      254000 -- (-1210.584) [-1211.352] (-1215.172) (-1216.392) * (-1214.469) [-1216.547] (-1211.418) (-1212.960) -- 0:00:46
      254500 -- [-1210.585] (-1217.596) (-1212.307) (-1212.242) * [-1213.790] (-1214.976) (-1212.392) (-1214.595) -- 0:00:46
      255000 -- (-1215.511) (-1212.647) [-1212.337] (-1214.330) * (-1213.788) (-1211.032) [-1212.392] (-1213.113) -- 0:00:46

      Average standard deviation of split frequencies: 0.019642

      255500 -- [-1212.576] (-1211.982) (-1215.683) (-1214.002) * (-1211.089) (-1210.820) (-1210.601) [-1215.293] -- 0:00:46
      256000 -- [-1215.652] (-1213.376) (-1212.977) (-1215.235) * [-1212.508] (-1212.646) (-1210.543) (-1212.688) -- 0:00:46
      256500 -- (-1210.993) (-1211.916) [-1212.750] (-1215.545) * (-1212.469) [-1214.870] (-1212.487) (-1214.008) -- 0:00:46
      257000 -- (-1210.859) (-1212.681) (-1214.531) [-1212.772] * (-1210.766) [-1220.428] (-1211.388) (-1212.643) -- 0:00:46
      257500 -- (-1213.998) [-1212.003] (-1218.772) (-1214.305) * (-1210.768) (-1216.988) (-1211.159) [-1211.607] -- 0:00:49
      258000 -- (-1214.025) [-1213.080] (-1215.722) (-1214.068) * (-1210.420) (-1212.279) [-1212.209] (-1213.667) -- 0:00:48
      258500 -- (-1212.851) (-1212.251) [-1214.411] (-1216.649) * [-1210.759] (-1212.872) (-1212.345) (-1212.557) -- 0:00:48
      259000 -- (-1211.286) (-1212.501) (-1212.164) [-1213.378] * [-1212.747] (-1210.683) (-1212.287) (-1212.713) -- 0:00:48
      259500 -- (-1215.158) [-1211.547] (-1212.486) (-1211.430) * [-1210.783] (-1210.617) (-1213.265) (-1212.041) -- 0:00:48
      260000 -- (-1212.637) (-1212.305) (-1214.632) [-1211.039] * (-1212.558) (-1212.927) [-1211.258] (-1213.339) -- 0:00:48

      Average standard deviation of split frequencies: 0.020194

      260500 -- (-1212.461) (-1211.767) [-1213.515] (-1212.159) * (-1213.662) [-1212.418] (-1211.766) (-1217.983) -- 0:00:48
      261000 -- [-1212.417] (-1211.446) (-1211.560) (-1210.819) * [-1212.302] (-1214.288) (-1212.947) (-1212.677) -- 0:00:48
      261500 -- (-1211.468) (-1213.589) (-1213.663) [-1213.534] * (-1210.868) (-1215.432) [-1211.958] (-1213.412) -- 0:00:48
      262000 -- (-1213.461) (-1214.602) (-1211.385) [-1212.837] * (-1213.213) (-1222.083) [-1211.736] (-1215.972) -- 0:00:47
      262500 -- [-1216.557] (-1212.627) (-1214.071) (-1213.638) * [-1210.634] (-1215.217) (-1211.136) (-1212.697) -- 0:00:47
      263000 -- [-1210.957] (-1213.496) (-1213.124) (-1215.559) * [-1210.599] (-1214.626) (-1211.822) (-1211.863) -- 0:00:47
      263500 -- (-1213.511) (-1210.758) [-1212.011] (-1216.544) * (-1210.547) (-1213.999) [-1211.333] (-1212.846) -- 0:00:47
      264000 -- (-1213.101) [-1211.290] (-1213.091) (-1217.005) * (-1213.239) [-1213.187] (-1211.239) (-1212.234) -- 0:00:47
      264500 -- (-1215.539) [-1212.499] (-1216.933) (-1212.255) * [-1211.671] (-1216.362) (-1215.768) (-1212.013) -- 0:00:47
      265000 -- (-1216.477) (-1212.266) [-1213.240] (-1212.693) * (-1213.338) (-1213.525) (-1211.589) [-1212.912] -- 0:00:47

      Average standard deviation of split frequencies: 0.019297

      265500 -- [-1212.669] (-1212.950) (-1211.103) (-1213.997) * (-1211.462) (-1213.281) [-1214.107] (-1213.831) -- 0:00:47
      266000 -- (-1214.860) (-1216.020) [-1213.934] (-1213.302) * (-1212.735) [-1212.462] (-1214.111) (-1213.420) -- 0:00:46
      266500 -- (-1211.852) (-1213.734) [-1211.265] (-1212.590) * (-1211.976) (-1211.989) [-1212.529] (-1210.398) -- 0:00:46
      267000 -- (-1214.561) (-1215.803) (-1211.861) [-1212.846] * (-1211.481) [-1210.828] (-1213.306) (-1210.829) -- 0:00:46
      267500 -- (-1214.162) (-1218.413) [-1210.606] (-1213.789) * [-1210.905] (-1210.829) (-1213.348) (-1212.589) -- 0:00:46
      268000 -- (-1212.601) (-1215.278) (-1211.049) [-1211.562] * (-1210.759) [-1212.374] (-1213.266) (-1215.683) -- 0:00:46
      268500 -- (-1212.992) (-1210.750) (-1211.049) [-1215.670] * (-1210.749) (-1211.775) [-1214.610] (-1211.160) -- 0:00:46
      269000 -- (-1211.593) (-1210.794) [-1211.446] (-1211.919) * (-1213.043) (-1216.325) (-1213.338) [-1212.114] -- 0:00:46
      269500 -- (-1211.919) [-1211.058] (-1211.073) (-1210.451) * (-1214.095) (-1214.931) (-1211.861) [-1210.878] -- 0:00:46
      270000 -- [-1214.572] (-1212.217) (-1210.629) (-1211.887) * [-1213.973] (-1214.873) (-1211.956) (-1210.511) -- 0:00:45

      Average standard deviation of split frequencies: 0.018094

      270500 -- (-1210.938) (-1215.163) (-1214.864) [-1213.286] * [-1212.922] (-1221.071) (-1211.085) (-1211.053) -- 0:00:45
      271000 -- (-1210.954) (-1211.624) [-1212.811] (-1213.448) * (-1212.245) (-1215.823) (-1215.590) [-1211.656] -- 0:00:45
      271500 -- [-1211.997] (-1211.530) (-1212.588) (-1214.677) * (-1210.634) [-1215.134] (-1213.533) (-1215.554) -- 0:00:45
      272000 -- (-1214.163) [-1212.596] (-1212.397) (-1215.416) * (-1211.587) (-1215.549) [-1214.063] (-1210.529) -- 0:00:45
      272500 -- (-1213.628) (-1213.221) [-1215.371] (-1213.394) * (-1212.316) (-1213.501) (-1212.331) [-1211.618] -- 0:00:45
      273000 -- (-1212.524) [-1211.076] (-1211.920) (-1213.935) * (-1212.348) (-1213.293) (-1213.391) [-1211.071] -- 0:00:45
      273500 -- (-1213.072) [-1210.983] (-1212.943) (-1216.880) * [-1212.222] (-1217.607) (-1213.770) (-1211.283) -- 0:00:47
      274000 -- (-1213.454) [-1210.974] (-1214.675) (-1215.007) * (-1212.883) (-1215.487) [-1212.156] (-1211.779) -- 0:00:47
      274500 -- [-1212.345] (-1213.966) (-1211.469) (-1214.155) * (-1213.363) (-1212.391) [-1211.426] (-1212.556) -- 0:00:47
      275000 -- (-1212.249) (-1215.638) [-1213.087] (-1211.866) * (-1211.679) [-1213.125] (-1219.885) (-1213.336) -- 0:00:47

      Average standard deviation of split frequencies: 0.019073

      275500 -- (-1211.116) (-1214.612) [-1214.065] (-1211.447) * (-1211.836) (-1212.787) [-1212.020] (-1212.130) -- 0:00:47
      276000 -- [-1211.071] (-1211.373) (-1217.403) (-1211.466) * [-1210.453] (-1212.771) (-1210.891) (-1216.545) -- 0:00:47
      276500 -- (-1211.248) (-1211.750) [-1213.020] (-1212.502) * (-1210.392) (-1213.255) (-1210.926) [-1211.697] -- 0:00:47
      277000 -- (-1211.567) (-1211.546) (-1212.342) [-1216.730] * (-1215.029) (-1213.045) [-1211.812] (-1211.581) -- 0:00:46
      277500 -- [-1211.567] (-1212.627) (-1213.248) (-1212.111) * [-1212.191] (-1212.087) (-1214.160) (-1211.733) -- 0:00:46
      278000 -- (-1210.976) [-1210.585] (-1212.088) (-1212.131) * (-1210.546) (-1211.774) [-1214.906] (-1211.966) -- 0:00:46
      278500 -- [-1210.939] (-1212.141) (-1210.722) (-1212.216) * [-1211.330] (-1212.350) (-1211.630) (-1211.700) -- 0:00:46
      279000 -- (-1215.204) [-1212.760] (-1212.078) (-1219.542) * (-1211.434) [-1210.747] (-1211.846) (-1212.977) -- 0:00:46
      279500 -- [-1211.970] (-1212.952) (-1212.787) (-1216.290) * [-1211.188] (-1215.678) (-1214.212) (-1214.448) -- 0:00:46
      280000 -- (-1212.602) [-1213.086] (-1212.891) (-1214.589) * [-1210.908] (-1214.298) (-1213.214) (-1211.748) -- 0:00:46

      Average standard deviation of split frequencies: 0.017916

      280500 -- (-1218.075) (-1212.751) (-1211.311) [-1212.558] * (-1212.070) (-1213.214) [-1213.142] (-1214.210) -- 0:00:46
      281000 -- (-1213.350) (-1218.213) [-1212.922] (-1212.889) * [-1211.953] (-1213.334) (-1214.657) (-1212.190) -- 0:00:46
      281500 -- (-1213.238) (-1216.125) (-1211.284) [-1211.990] * (-1211.670) [-1210.680] (-1217.245) (-1213.980) -- 0:00:45
      282000 -- (-1214.856) (-1211.417) (-1211.703) [-1212.538] * [-1210.938] (-1214.516) (-1212.165) (-1213.186) -- 0:00:45
      282500 -- [-1213.253] (-1215.487) (-1212.981) (-1212.285) * (-1213.458) (-1215.488) (-1216.402) [-1211.623] -- 0:00:45
      283000 -- (-1215.677) (-1218.017) (-1214.625) [-1213.773] * [-1212.418] (-1214.445) (-1212.105) (-1214.199) -- 0:00:45
      283500 -- [-1211.456] (-1216.944) (-1212.633) (-1214.302) * [-1212.027] (-1213.123) (-1212.604) (-1213.042) -- 0:00:45
      284000 -- [-1210.714] (-1213.981) (-1211.612) (-1217.614) * (-1215.559) (-1213.738) (-1211.294) [-1212.383] -- 0:00:45
      284500 -- (-1212.526) (-1213.247) [-1212.317] (-1211.034) * (-1217.602) (-1214.680) [-1210.580] (-1212.195) -- 0:00:45
      285000 -- (-1212.128) (-1213.161) (-1213.900) [-1212.686] * (-1221.949) [-1212.582] (-1215.422) (-1211.389) -- 0:00:45

      Average standard deviation of split frequencies: 0.016049

      285500 -- [-1210.379] (-1211.953) (-1213.189) (-1215.623) * (-1213.223) [-1213.217] (-1212.270) (-1212.011) -- 0:00:45
      286000 -- (-1210.610) [-1212.089] (-1213.159) (-1214.258) * (-1213.662) [-1210.580] (-1211.927) (-1210.439) -- 0:00:44
      286500 -- (-1210.987) (-1213.325) [-1213.264] (-1212.892) * [-1214.093] (-1215.782) (-1215.926) (-1211.349) -- 0:00:44
      287000 -- [-1211.215] (-1213.716) (-1212.730) (-1212.715) * (-1212.250) (-1215.764) (-1214.928) [-1212.281] -- 0:00:44
      287500 -- (-1215.511) (-1215.271) (-1212.942) [-1211.960] * [-1212.407] (-1216.133) (-1211.312) (-1212.442) -- 0:00:44
      288000 -- (-1212.355) (-1217.315) (-1212.277) [-1212.862] * (-1215.235) (-1212.931) (-1211.129) [-1211.345] -- 0:00:44
      288500 -- (-1212.012) (-1216.149) (-1211.958) [-1215.604] * (-1212.520) [-1214.583] (-1214.008) (-1210.645) -- 0:00:44
      289000 -- (-1212.344) (-1215.029) [-1210.571] (-1214.037) * (-1215.122) (-1213.749) [-1215.093] (-1212.756) -- 0:00:44
      289500 -- (-1211.774) [-1212.006] (-1211.398) (-1211.519) * (-1214.759) [-1212.582] (-1213.757) (-1212.843) -- 0:00:44
      290000 -- (-1214.999) (-1210.981) [-1213.861] (-1212.253) * [-1213.981] (-1215.106) (-1216.127) (-1212.649) -- 0:00:46

      Average standard deviation of split frequencies: 0.016218

      290500 -- (-1211.042) [-1212.050] (-1211.349) (-1212.075) * (-1211.387) (-1213.941) (-1215.255) [-1212.029] -- 0:00:46
      291000 -- [-1212.331] (-1212.570) (-1211.619) (-1211.394) * (-1211.834) (-1213.703) [-1214.824] (-1212.946) -- 0:00:46
      291500 -- (-1211.679) (-1213.628) [-1211.085] (-1213.279) * (-1211.673) (-1214.670) (-1217.040) [-1212.601] -- 0:00:46
      292000 -- [-1213.109] (-1215.464) (-1211.436) (-1211.784) * (-1213.057) (-1217.157) [-1214.438] (-1211.773) -- 0:00:46
      292500 -- [-1212.713] (-1215.875) (-1210.695) (-1215.640) * [-1212.950] (-1225.154) (-1211.396) (-1213.707) -- 0:00:45
      293000 -- (-1214.385) [-1211.810] (-1210.746) (-1213.427) * (-1214.919) (-1221.572) [-1214.699] (-1210.741) -- 0:00:45
      293500 -- (-1213.686) (-1211.128) (-1211.512) [-1211.199] * [-1211.977] (-1222.819) (-1214.555) (-1212.257) -- 0:00:45
      294000 -- (-1213.424) [-1211.594] (-1215.043) (-1211.926) * [-1210.976] (-1210.970) (-1217.694) (-1211.000) -- 0:00:45
      294500 -- (-1213.598) [-1214.090] (-1218.822) (-1213.929) * [-1213.076] (-1214.316) (-1214.538) (-1211.629) -- 0:00:45
      295000 -- (-1212.277) (-1213.422) [-1211.031] (-1216.301) * (-1211.933) (-1212.273) [-1215.138] (-1212.159) -- 0:00:45

      Average standard deviation of split frequencies: 0.014970

      295500 -- (-1213.335) [-1215.537] (-1212.440) (-1213.804) * (-1211.055) (-1217.569) [-1211.229] (-1211.914) -- 0:00:45
      296000 -- (-1211.935) (-1213.562) [-1212.966] (-1217.136) * (-1210.965) (-1213.564) (-1213.944) [-1214.230] -- 0:00:45
      296500 -- (-1211.153) (-1214.775) [-1213.731] (-1214.027) * (-1211.411) [-1211.688] (-1214.173) (-1213.691) -- 0:00:45
      297000 -- [-1212.677] (-1220.613) (-1214.481) (-1213.290) * (-1211.414) (-1212.094) [-1213.431] (-1214.117) -- 0:00:44
      297500 -- (-1214.271) (-1217.535) [-1211.446] (-1210.886) * (-1211.329) [-1212.566] (-1211.628) (-1210.753) -- 0:00:44
      298000 -- (-1214.864) (-1211.468) (-1211.113) [-1211.022] * (-1213.275) (-1210.765) [-1211.838] (-1211.791) -- 0:00:44
      298500 -- [-1212.269] (-1211.720) (-1211.184) (-1211.727) * (-1221.064) [-1210.877] (-1211.653) (-1212.827) -- 0:00:44
      299000 -- [-1211.982] (-1210.977) (-1213.514) (-1218.110) * (-1216.887) [-1211.038] (-1211.620) (-1214.633) -- 0:00:44
      299500 -- (-1211.430) (-1211.689) [-1211.986] (-1213.742) * [-1214.407] (-1210.717) (-1211.775) (-1220.394) -- 0:00:44
      300000 -- (-1211.927) [-1216.607] (-1211.662) (-1212.570) * (-1218.581) [-1211.043] (-1214.210) (-1213.983) -- 0:00:44

      Average standard deviation of split frequencies: 0.015018

      300500 -- [-1212.722] (-1212.114) (-1211.091) (-1212.777) * (-1213.189) [-1211.939] (-1215.835) (-1215.094) -- 0:00:44
      301000 -- [-1212.316] (-1212.646) (-1216.116) (-1212.569) * (-1214.236) [-1216.611] (-1215.338) (-1211.567) -- 0:00:44
      301500 -- (-1211.403) (-1213.021) (-1211.412) [-1211.419] * (-1213.118) (-1215.003) (-1215.316) [-1214.064] -- 0:00:44
      302000 -- (-1213.127) [-1211.163] (-1215.735) (-1211.636) * (-1218.190) [-1211.210] (-1211.065) (-1216.416) -- 0:00:43
      302500 -- (-1213.127) (-1212.148) (-1213.333) [-1211.641] * (-1214.876) (-1211.422) [-1211.515] (-1213.834) -- 0:00:43
      303000 -- (-1216.619) (-1211.246) [-1211.063] (-1211.633) * (-1212.296) (-1211.254) [-1212.191] (-1212.981) -- 0:00:43
      303500 -- (-1212.118) (-1212.350) (-1211.589) [-1212.069] * [-1212.855] (-1211.134) (-1213.057) (-1214.430) -- 0:00:43
      304000 -- (-1213.296) [-1212.362] (-1211.606) (-1212.674) * (-1213.268) (-1214.966) (-1214.493) [-1212.924] -- 0:00:43
      304500 -- [-1212.844] (-1212.661) (-1213.122) (-1211.986) * [-1214.346] (-1211.347) (-1213.451) (-1213.057) -- 0:00:43
      305000 -- [-1212.940] (-1210.944) (-1212.035) (-1213.026) * [-1211.424] (-1211.618) (-1211.217) (-1211.801) -- 0:00:43

      Average standard deviation of split frequencies: 0.015945

      305500 -- (-1214.037) (-1210.954) (-1214.003) [-1210.311] * [-1211.467] (-1211.539) (-1213.625) (-1216.076) -- 0:00:43
      306000 -- (-1214.784) (-1216.026) (-1211.818) [-1212.230] * [-1211.807] (-1214.390) (-1215.420) (-1212.440) -- 0:00:45
      306500 -- (-1214.959) (-1214.648) (-1212.825) [-1212.249] * (-1213.724) (-1218.787) (-1213.087) [-1211.661] -- 0:00:45
      307000 -- [-1213.115] (-1215.256) (-1212.705) (-1213.648) * (-1211.529) (-1216.284) (-1217.382) [-1211.116] -- 0:00:45
      307500 -- [-1212.655] (-1211.866) (-1212.519) (-1211.643) * [-1211.404] (-1214.333) (-1211.667) (-1211.004) -- 0:00:45
      308000 -- (-1214.341) [-1212.243] (-1212.673) (-1214.369) * [-1211.843] (-1215.828) (-1215.382) (-1210.296) -- 0:00:44
      308500 -- [-1212.076] (-1213.537) (-1212.118) (-1210.688) * (-1210.511) [-1211.588] (-1214.859) (-1211.213) -- 0:00:44
      309000 -- (-1212.682) (-1215.011) [-1212.901] (-1213.973) * [-1211.463] (-1212.374) (-1216.737) (-1212.418) -- 0:00:44
      309500 -- [-1210.487] (-1213.837) (-1219.694) (-1211.186) * (-1211.283) [-1212.133] (-1217.134) (-1211.383) -- 0:00:44
      310000 -- (-1214.037) (-1215.923) [-1211.896] (-1212.503) * (-1210.932) (-1211.610) [-1212.888] (-1213.769) -- 0:00:44

      Average standard deviation of split frequencies: 0.015326

      310500 -- [-1214.107] (-1213.466) (-1213.140) (-1210.717) * (-1212.019) [-1212.231] (-1217.660) (-1213.777) -- 0:00:44
      311000 -- (-1214.278) (-1216.465) [-1212.541] (-1210.717) * [-1214.464] (-1213.391) (-1212.861) (-1214.580) -- 0:00:44
      311500 -- [-1212.887] (-1211.317) (-1213.006) (-1211.065) * [-1211.457] (-1212.859) (-1213.134) (-1212.044) -- 0:00:44
      312000 -- [-1211.636] (-1217.660) (-1213.391) (-1210.753) * (-1212.993) (-1214.801) (-1211.974) [-1215.154] -- 0:00:44
      312500 -- [-1211.506] (-1213.429) (-1211.748) (-1212.946) * (-1214.133) [-1210.448] (-1212.621) (-1215.332) -- 0:00:44
      313000 -- (-1212.347) [-1213.976] (-1212.218) (-1210.689) * [-1210.310] (-1211.700) (-1213.526) (-1214.217) -- 0:00:43
      313500 -- (-1211.268) [-1211.425] (-1212.754) (-1211.803) * (-1215.013) (-1210.806) (-1212.982) [-1212.403] -- 0:00:43
      314000 -- (-1213.646) (-1211.642) (-1213.102) [-1211.059] * (-1210.681) [-1211.864] (-1211.062) (-1213.354) -- 0:00:43
      314500 -- (-1215.190) [-1211.512] (-1212.876) (-1211.155) * (-1212.741) (-1212.701) (-1213.180) [-1211.334] -- 0:00:43
      315000 -- (-1212.574) (-1210.508) [-1212.324] (-1213.505) * (-1214.728) [-1214.443] (-1215.580) (-1213.680) -- 0:00:43

      Average standard deviation of split frequencies: 0.015664

      315500 -- (-1212.113) (-1214.608) [-1211.044] (-1214.107) * (-1212.727) [-1211.509] (-1211.772) (-1211.269) -- 0:00:43
      316000 -- (-1214.911) [-1213.219] (-1212.706) (-1211.592) * (-1215.797) (-1211.018) (-1213.948) [-1210.657] -- 0:00:43
      316500 -- (-1212.080) [-1211.993] (-1212.803) (-1213.482) * (-1214.215) [-1211.117] (-1211.300) (-1210.999) -- 0:00:43
      317000 -- (-1212.054) (-1212.333) (-1214.644) [-1214.858] * [-1213.214] (-1213.299) (-1211.907) (-1210.348) -- 0:00:43
      317500 -- [-1213.072] (-1211.486) (-1212.939) (-1215.136) * (-1212.103) [-1214.110] (-1214.259) (-1211.859) -- 0:00:42
      318000 -- (-1212.917) (-1212.168) [-1213.437] (-1215.843) * [-1213.881] (-1211.207) (-1212.565) (-1213.446) -- 0:00:42
      318500 -- (-1213.566) (-1211.053) (-1214.177) [-1213.235] * (-1211.039) (-1211.082) (-1213.470) [-1211.548] -- 0:00:42
      319000 -- (-1216.223) [-1210.833] (-1215.735) (-1219.298) * (-1210.571) (-1214.955) [-1216.629] (-1214.403) -- 0:00:42
      319500 -- [-1218.222] (-1211.633) (-1214.900) (-1217.619) * [-1212.275] (-1221.211) (-1213.682) (-1212.982) -- 0:00:42
      320000 -- [-1212.090] (-1211.418) (-1214.508) (-1215.091) * (-1212.728) (-1218.549) [-1215.536] (-1210.781) -- 0:00:42

      Average standard deviation of split frequencies: 0.014314

      320500 -- (-1214.272) [-1211.457] (-1216.790) (-1211.341) * [-1210.289] (-1214.357) (-1216.076) (-1213.179) -- 0:00:42
      321000 -- (-1216.177) [-1211.030] (-1213.129) (-1212.429) * (-1211.112) (-1213.933) [-1214.674] (-1212.253) -- 0:00:42
      321500 -- [-1211.035] (-1211.812) (-1212.158) (-1213.860) * (-1213.419) (-1213.397) [-1212.844] (-1211.566) -- 0:00:44
      322000 -- (-1213.089) (-1216.166) [-1215.999] (-1211.082) * (-1214.703) [-1213.233] (-1213.056) (-1210.559) -- 0:00:44
      322500 -- (-1211.563) [-1211.123] (-1212.997) (-1214.171) * (-1210.942) [-1213.819] (-1212.705) (-1211.157) -- 0:00:44
      323000 -- (-1213.487) (-1211.125) [-1213.530] (-1211.788) * [-1214.578] (-1214.666) (-1211.682) (-1216.222) -- 0:00:44
      323500 -- (-1211.176) [-1212.992] (-1211.004) (-1211.064) * (-1216.870) [-1213.244] (-1212.311) (-1211.063) -- 0:00:43
      324000 -- [-1211.802] (-1212.796) (-1214.381) (-1211.064) * (-1220.991) (-1211.771) [-1210.541] (-1211.363) -- 0:00:43
      324500 -- (-1211.214) (-1211.102) (-1222.086) [-1211.146] * (-1212.568) (-1211.099) (-1212.920) [-1211.727] -- 0:00:43
      325000 -- [-1213.126] (-1210.610) (-1217.949) (-1212.096) * [-1213.043] (-1217.524) (-1213.052) (-1211.192) -- 0:00:43

      Average standard deviation of split frequencies: 0.014156

      325500 -- (-1210.482) [-1210.388] (-1211.861) (-1212.700) * (-1210.966) (-1215.391) (-1212.872) [-1210.789] -- 0:00:43
      326000 -- (-1211.342) [-1211.616] (-1212.005) (-1215.417) * [-1210.753] (-1212.927) (-1213.440) (-1211.026) -- 0:00:43
      326500 -- (-1212.560) (-1213.095) (-1214.690) [-1213.975] * (-1210.702) (-1216.090) [-1214.429] (-1211.126) -- 0:00:43
      327000 -- (-1212.999) [-1213.498] (-1211.210) (-1211.777) * (-1211.009) (-1214.484) (-1212.468) [-1210.916] -- 0:00:43
      327500 -- (-1211.302) (-1212.770) [-1213.441] (-1212.361) * (-1211.778) (-1212.450) [-1210.736] (-1213.290) -- 0:00:43
      328000 -- (-1210.762) (-1211.411) [-1213.561] (-1210.723) * [-1211.150] (-1211.618) (-1212.339) (-1213.178) -- 0:00:43
      328500 -- (-1213.964) [-1213.113] (-1215.951) (-1214.902) * [-1211.007] (-1211.529) (-1212.478) (-1210.811) -- 0:00:42
      329000 -- (-1213.381) [-1210.981] (-1216.429) (-1211.054) * (-1211.278) [-1211.354] (-1211.765) (-1212.559) -- 0:00:42
      329500 -- (-1212.389) [-1212.714] (-1219.140) (-1212.188) * [-1210.903] (-1212.085) (-1212.835) (-1212.584) -- 0:00:42
      330000 -- (-1212.611) [-1212.013] (-1216.051) (-1212.188) * (-1212.534) [-1212.374] (-1213.422) (-1214.142) -- 0:00:42

      Average standard deviation of split frequencies: 0.014631

      330500 -- (-1212.926) (-1213.173) [-1215.463] (-1210.787) * [-1211.110] (-1214.069) (-1210.990) (-1213.643) -- 0:00:42
      331000 -- (-1212.929) [-1212.852] (-1214.763) (-1217.333) * (-1211.978) (-1211.273) [-1210.551] (-1214.672) -- 0:00:42
      331500 -- (-1212.655) (-1212.574) [-1211.660] (-1210.878) * (-1212.742) (-1212.467) (-1212.255) [-1217.075] -- 0:00:42
      332000 -- (-1213.052) (-1218.905) [-1212.109] (-1210.322) * [-1210.735] (-1212.861) (-1213.641) (-1214.120) -- 0:00:42
      332500 -- (-1214.011) (-1210.298) [-1211.923] (-1214.954) * (-1213.672) [-1211.721] (-1212.639) (-1213.258) -- 0:00:42
      333000 -- [-1214.117] (-1214.519) (-1212.114) (-1211.571) * (-1213.366) (-1213.458) [-1213.750] (-1213.732) -- 0:00:42
      333500 -- (-1213.314) [-1211.727] (-1212.212) (-1213.960) * [-1211.360] (-1213.402) (-1212.103) (-1210.996) -- 0:00:41
      334000 -- (-1211.038) (-1216.002) (-1210.274) [-1214.384] * [-1213.938] (-1214.693) (-1211.432) (-1210.996) -- 0:00:41
      334500 -- (-1211.932) (-1213.740) (-1212.661) [-1214.440] * (-1217.507) [-1213.381] (-1211.190) (-1211.276) -- 0:00:41
      335000 -- [-1211.917] (-1215.014) (-1214.555) (-1214.590) * (-1212.720) (-1212.078) [-1211.211] (-1213.457) -- 0:00:41

      Average standard deviation of split frequencies: 0.013882

      335500 -- (-1211.783) (-1214.414) [-1213.344] (-1216.199) * (-1213.787) [-1211.612] (-1212.026) (-1215.191) -- 0:00:41
      336000 -- (-1211.894) (-1215.184) [-1213.193] (-1211.536) * (-1213.372) (-1212.357) (-1216.678) [-1212.156] -- 0:00:41
      336500 -- (-1210.992) (-1213.391) (-1211.908) [-1212.210] * (-1215.231) (-1211.509) [-1217.778] (-1211.459) -- 0:00:41
      337000 -- (-1210.720) [-1213.800] (-1214.573) (-1213.348) * (-1214.512) (-1212.531) (-1211.837) [-1214.594] -- 0:00:41
      337500 -- (-1215.566) [-1215.872] (-1215.301) (-1210.991) * (-1211.294) [-1213.329] (-1214.895) (-1211.687) -- 0:00:41
      338000 -- (-1220.223) (-1213.732) [-1214.849] (-1213.539) * (-1212.419) (-1212.440) (-1215.032) [-1212.360] -- 0:00:43
      338500 -- (-1214.816) [-1211.097] (-1210.663) (-1213.771) * (-1210.970) (-1212.440) (-1214.381) [-1211.517] -- 0:00:42
      339000 -- (-1212.492) [-1211.005] (-1213.532) (-1214.487) * [-1210.737] (-1212.936) (-1214.278) (-1213.263) -- 0:00:42
      339500 -- (-1211.411) (-1211.857) (-1212.594) [-1214.833] * (-1210.940) (-1212.692) [-1214.474] (-1213.567) -- 0:00:42
      340000 -- (-1214.651) (-1211.857) (-1210.698) [-1211.975] * (-1212.341) (-1216.388) [-1213.571] (-1214.728) -- 0:00:42

      Average standard deviation of split frequencies: 0.013983

      340500 -- (-1214.059) [-1213.141] (-1210.698) (-1211.790) * [-1212.341] (-1210.924) (-1210.614) (-1214.365) -- 0:00:42
      341000 -- [-1214.968] (-1213.956) (-1210.251) (-1210.251) * (-1211.764) (-1211.814) [-1212.531] (-1217.698) -- 0:00:42
      341500 -- (-1213.674) (-1211.865) (-1210.178) [-1213.430] * [-1212.387] (-1211.095) (-1211.681) (-1216.071) -- 0:00:42
      342000 -- (-1212.516) [-1211.589] (-1214.806) (-1212.471) * (-1212.382) (-1211.539) (-1213.235) [-1215.191] -- 0:00:42
      342500 -- (-1216.696) (-1211.588) [-1214.432] (-1215.255) * [-1213.486] (-1215.210) (-1211.288) (-1213.308) -- 0:00:42
      343000 -- [-1216.671] (-1210.555) (-1214.636) (-1215.755) * (-1211.129) [-1212.015] (-1212.605) (-1215.045) -- 0:00:42
      343500 -- (-1216.488) (-1210.558) (-1211.453) [-1211.710] * (-1213.694) (-1213.143) (-1211.620) [-1212.119] -- 0:00:42
      344000 -- (-1214.791) (-1211.364) [-1211.251] (-1211.502) * (-1211.213) [-1214.554] (-1211.416) (-1214.919) -- 0:00:41
      344500 -- (-1217.510) (-1211.713) (-1211.227) [-1211.520] * (-1213.289) (-1214.729) [-1210.848] (-1211.511) -- 0:00:41
      345000 -- (-1213.768) [-1213.615] (-1217.953) (-1213.722) * (-1213.066) (-1211.309) [-1211.419] (-1211.348) -- 0:00:41

      Average standard deviation of split frequencies: 0.013338

      345500 -- (-1211.313) (-1212.894) [-1213.684] (-1210.944) * [-1210.688] (-1213.269) (-1216.569) (-1212.749) -- 0:00:41
      346000 -- (-1213.390) (-1213.673) [-1211.031] (-1212.821) * (-1212.140) (-1212.928) (-1212.160) [-1214.474] -- 0:00:41
      346500 -- (-1213.322) [-1213.391] (-1211.063) (-1217.833) * (-1210.922) (-1212.855) [-1212.393] (-1213.038) -- 0:00:41
      347000 -- [-1212.251] (-1219.848) (-1211.571) (-1213.938) * (-1213.678) (-1212.584) [-1212.429] (-1214.671) -- 0:00:41
      347500 -- (-1210.982) [-1212.274] (-1214.155) (-1213.212) * (-1213.946) (-1211.725) (-1212.479) [-1213.958] -- 0:00:41
      348000 -- (-1212.051) (-1211.019) (-1212.733) [-1215.289] * [-1214.160] (-1211.846) (-1214.385) (-1213.517) -- 0:00:41
      348500 -- (-1213.759) [-1213.366] (-1210.893) (-1216.593) * (-1211.489) [-1211.478] (-1212.192) (-1211.156) -- 0:00:41
      349000 -- (-1216.014) (-1215.293) (-1214.366) [-1213.452] * (-1211.760) [-1212.483] (-1211.803) (-1211.340) -- 0:00:41
      349500 -- (-1216.806) (-1217.813) [-1216.091] (-1212.975) * (-1211.794) (-1210.653) (-1213.065) [-1211.069] -- 0:00:40
      350000 -- (-1211.399) (-1211.958) [-1211.445] (-1212.620) * (-1211.831) (-1210.653) [-1212.043] (-1211.107) -- 0:00:40

      Average standard deviation of split frequencies: 0.012472

      350500 -- (-1211.719) [-1211.415] (-1211.319) (-1215.808) * [-1211.136] (-1211.173) (-1211.664) (-1215.240) -- 0:00:40
      351000 -- (-1210.611) [-1211.464] (-1215.051) (-1211.281) * (-1212.343) (-1215.411) [-1214.611] (-1214.941) -- 0:00:40
      351500 -- (-1213.090) (-1210.396) [-1215.735] (-1215.184) * [-1213.061] (-1212.809) (-1217.112) (-1212.216) -- 0:00:40
      352000 -- (-1214.631) (-1211.907) (-1211.326) [-1213.154] * [-1211.781] (-1212.013) (-1214.915) (-1211.576) -- 0:00:40
      352500 -- (-1213.742) (-1214.262) [-1211.254] (-1217.707) * [-1212.140] (-1216.048) (-1215.559) (-1211.439) -- 0:00:40
      353000 -- (-1212.055) (-1213.824) [-1211.697] (-1217.666) * [-1211.433] (-1216.264) (-1215.165) (-1211.401) -- 0:00:40
      353500 -- (-1213.640) [-1213.018] (-1211.250) (-1213.563) * (-1211.418) [-1212.818] (-1214.493) (-1212.840) -- 0:00:40
      354000 -- [-1210.809] (-1216.681) (-1219.677) (-1214.197) * [-1212.610] (-1212.000) (-1214.391) (-1211.425) -- 0:00:41
      354500 -- (-1216.153) (-1213.613) [-1214.713] (-1214.922) * (-1214.196) [-1211.775] (-1213.432) (-1212.160) -- 0:00:41
      355000 -- [-1214.762] (-1216.659) (-1213.015) (-1214.833) * [-1212.736] (-1211.806) (-1214.338) (-1210.977) -- 0:00:41

      Average standard deviation of split frequencies: 0.012229

      355500 -- (-1214.728) (-1218.224) [-1212.073] (-1211.854) * (-1215.983) (-1210.788) [-1211.472] (-1212.714) -- 0:00:41
      356000 -- (-1212.049) (-1212.485) (-1213.690) [-1212.470] * (-1213.048) (-1210.956) [-1213.366] (-1212.199) -- 0:00:41
      356500 -- (-1218.383) [-1213.342] (-1211.139) (-1212.395) * (-1214.470) [-1210.567] (-1211.775) (-1213.231) -- 0:00:41
      357000 -- [-1213.109] (-1212.662) (-1213.104) (-1211.153) * (-1214.836) (-1212.507) [-1211.750] (-1214.082) -- 0:00:41
      357500 -- (-1210.472) (-1211.796) (-1214.606) [-1212.994] * [-1217.116] (-1212.629) (-1212.375) (-1212.266) -- 0:00:41
      358000 -- (-1215.048) [-1211.531] (-1212.788) (-1213.912) * [-1210.810] (-1213.788) (-1212.259) (-1211.892) -- 0:00:41
      358500 -- (-1213.074) (-1211.915) [-1210.349] (-1212.268) * (-1214.178) (-1211.288) [-1212.008] (-1210.493) -- 0:00:41
      359000 -- (-1212.404) (-1212.980) (-1211.466) [-1212.435] * [-1212.383] (-1212.505) (-1211.794) (-1210.496) -- 0:00:41
      359500 -- (-1212.288) (-1211.101) [-1212.756] (-1219.555) * (-1211.284) (-1212.886) [-1210.734] (-1211.371) -- 0:00:40
      360000 -- (-1215.566) [-1211.637] (-1211.051) (-1217.636) * (-1212.734) (-1212.934) [-1212.528] (-1211.363) -- 0:00:40

      Average standard deviation of split frequencies: 0.012225

      360500 -- [-1210.856] (-1211.554) (-1211.697) (-1213.178) * (-1216.577) (-1213.827) [-1213.778] (-1217.159) -- 0:00:40
      361000 -- (-1214.014) (-1211.364) [-1212.106] (-1211.807) * (-1216.561) (-1212.461) (-1214.761) [-1214.388] -- 0:00:40
      361500 -- [-1211.440] (-1216.931) (-1212.160) (-1212.502) * (-1210.916) [-1213.731] (-1214.658) (-1213.083) -- 0:00:40
      362000 -- [-1212.189] (-1211.549) (-1217.163) (-1212.992) * (-1210.447) [-1212.356] (-1212.830) (-1213.170) -- 0:00:40
      362500 -- [-1211.550] (-1213.345) (-1218.485) (-1213.656) * [-1210.514] (-1216.323) (-1213.316) (-1211.063) -- 0:00:40
      363000 -- [-1212.531] (-1212.621) (-1215.602) (-1211.975) * (-1210.973) [-1211.427] (-1211.211) (-1211.464) -- 0:00:40
      363500 -- (-1211.030) (-1212.326) (-1213.529) [-1211.960] * (-1211.164) [-1211.605] (-1213.446) (-1211.090) -- 0:00:40
      364000 -- (-1210.965) (-1211.585) (-1213.249) [-1212.612] * [-1210.926] (-1214.053) (-1213.008) (-1214.402) -- 0:00:40
      364500 -- (-1211.706) (-1211.092) [-1212.598] (-1214.074) * [-1212.351] (-1211.697) (-1215.883) (-1212.276) -- 0:00:40
      365000 -- (-1213.186) (-1215.496) [-1212.260] (-1212.177) * (-1210.807) [-1214.941] (-1216.629) (-1210.929) -- 0:00:40

      Average standard deviation of split frequencies: 0.012379

      365500 -- (-1214.444) [-1212.452] (-1214.497) (-1210.979) * (-1216.671) [-1212.561] (-1214.072) (-1213.092) -- 0:00:39
      366000 -- (-1215.533) [-1212.335] (-1211.449) (-1210.330) * [-1213.202] (-1212.945) (-1212.256) (-1211.268) -- 0:00:39
      366500 -- (-1210.528) [-1216.399] (-1212.027) (-1210.792) * (-1210.799) [-1211.813] (-1211.361) (-1211.374) -- 0:00:39
      367000 -- (-1214.018) (-1214.266) (-1212.244) [-1210.618] * (-1211.251) [-1217.188] (-1210.452) (-1211.300) -- 0:00:39
      367500 -- (-1214.673) [-1211.622] (-1213.426) (-1211.158) * (-1211.312) [-1216.205] (-1212.385) (-1211.590) -- 0:00:39
      368000 -- (-1214.408) (-1211.074) [-1212.412] (-1211.362) * (-1214.233) [-1216.338] (-1211.964) (-1211.907) -- 0:00:39
      368500 -- (-1211.972) (-1212.352) [-1211.589] (-1211.836) * (-1213.269) (-1211.778) (-1212.000) [-1211.231] -- 0:00:39
      369000 -- (-1212.459) (-1211.253) [-1213.149] (-1215.834) * (-1210.706) (-1216.612) [-1211.839] (-1212.272) -- 0:00:39
      369500 -- [-1212.702] (-1213.566) (-1214.819) (-1210.291) * [-1210.499] (-1213.246) (-1214.762) (-1212.081) -- 0:00:39
      370000 -- [-1211.081] (-1212.843) (-1222.801) (-1214.099) * [-1211.216] (-1213.453) (-1212.257) (-1214.419) -- 0:00:40

      Average standard deviation of split frequencies: 0.012793

      370500 -- (-1211.296) (-1212.846) [-1210.406] (-1211.598) * (-1210.172) [-1215.359] (-1211.196) (-1212.508) -- 0:00:40
      371000 -- (-1212.325) (-1212.293) (-1210.126) [-1211.349] * [-1212.242] (-1214.015) (-1210.714) (-1214.336) -- 0:00:40
      371500 -- (-1211.521) (-1213.164) (-1210.538) [-1215.886] * [-1211.546] (-1213.068) (-1211.324) (-1215.878) -- 0:00:40
      372000 -- (-1211.258) (-1213.347) [-1211.401] (-1211.642) * (-1212.509) [-1214.023] (-1210.637) (-1212.981) -- 0:00:40
      372500 -- [-1211.054] (-1214.820) (-1212.084) (-1210.601) * (-1211.976) (-1212.180) [-1212.706] (-1211.499) -- 0:00:40
      373000 -- (-1211.964) (-1212.878) [-1212.465] (-1213.041) * (-1211.746) (-1212.536) [-1211.874] (-1215.780) -- 0:00:40
      373500 -- (-1213.370) [-1213.066] (-1212.477) (-1211.149) * (-1211.221) [-1212.591] (-1211.312) (-1218.280) -- 0:00:40
      374000 -- (-1212.791) [-1210.819] (-1213.002) (-1216.184) * [-1211.441] (-1212.057) (-1215.378) (-1215.985) -- 0:00:40
      374500 -- (-1211.527) (-1214.683) [-1212.520] (-1212.756) * (-1212.154) (-1212.880) [-1212.264] (-1215.492) -- 0:00:40
      375000 -- (-1210.790) (-1211.888) (-1212.762) [-1211.626] * (-1211.788) [-1211.412] (-1213.001) (-1211.111) -- 0:00:40

      Average standard deviation of split frequencies: 0.013652

      375500 -- [-1214.689] (-1211.740) (-1211.017) (-1212.049) * [-1210.981] (-1212.570) (-1211.114) (-1211.311) -- 0:00:39
      376000 -- [-1212.866] (-1212.524) (-1211.741) (-1212.690) * (-1211.283) (-1213.053) [-1211.379] (-1212.203) -- 0:00:39
      376500 -- (-1211.184) (-1212.314) [-1210.887] (-1215.902) * (-1213.781) [-1212.338] (-1216.123) (-1211.806) -- 0:00:39
      377000 -- [-1210.566] (-1214.958) (-1211.364) (-1213.263) * [-1212.961] (-1211.808) (-1213.015) (-1210.340) -- 0:00:39
      377500 -- (-1212.330) (-1212.943) (-1211.543) [-1212.567] * (-1211.005) [-1210.546] (-1216.656) (-1214.215) -- 0:00:39
      378000 -- (-1211.410) (-1213.523) (-1211.981) [-1212.200] * (-1218.033) [-1214.167] (-1214.025) (-1211.070) -- 0:00:39
      378500 -- (-1212.843) (-1213.848) [-1210.796] (-1212.218) * (-1213.761) (-1218.453) (-1210.251) [-1213.600] -- 0:00:39
      379000 -- [-1213.639] (-1216.307) (-1210.357) (-1213.967) * (-1215.228) [-1212.168] (-1212.766) (-1213.778) -- 0:00:39
      379500 -- (-1214.402) (-1214.479) [-1213.025] (-1213.781) * (-1215.562) [-1214.751] (-1210.852) (-1214.097) -- 0:00:39
      380000 -- [-1211.115] (-1213.700) (-1212.004) (-1214.642) * [-1214.678] (-1214.459) (-1211.723) (-1215.651) -- 0:00:39

      Average standard deviation of split frequencies: 0.013897

      380500 -- (-1210.663) [-1211.009] (-1211.277) (-1211.786) * (-1211.612) [-1214.376] (-1212.922) (-1211.579) -- 0:00:39
      381000 -- (-1210.308) (-1211.935) [-1210.843] (-1210.941) * [-1218.435] (-1215.005) (-1217.264) (-1212.698) -- 0:00:38
      381500 -- [-1210.742] (-1213.087) (-1210.884) (-1212.770) * [-1212.918] (-1211.560) (-1212.714) (-1213.536) -- 0:00:38
      382000 -- (-1211.072) (-1210.782) [-1211.774] (-1213.080) * (-1210.881) (-1213.777) [-1211.386] (-1210.787) -- 0:00:38
      382500 -- [-1211.547] (-1216.926) (-1213.571) (-1213.280) * (-1212.601) (-1213.224) (-1211.341) [-1211.354] -- 0:00:38
      383000 -- [-1211.268] (-1212.709) (-1213.764) (-1213.262) * (-1215.194) [-1212.600] (-1216.665) (-1211.460) -- 0:00:38
      383500 -- (-1215.531) (-1217.815) (-1211.797) [-1211.900] * [-1214.056] (-1211.936) (-1215.089) (-1214.306) -- 0:00:38
      384000 -- (-1212.087) (-1213.910) (-1217.228) [-1220.868] * (-1216.807) (-1211.297) (-1212.656) [-1214.267] -- 0:00:38
      384500 -- [-1210.893] (-1212.056) (-1212.849) (-1210.904) * (-1212.066) (-1212.125) (-1215.591) [-1210.507] -- 0:00:38
      385000 -- (-1214.359) (-1213.016) (-1215.355) [-1214.680] * (-1212.546) [-1212.249] (-1216.091) (-1211.201) -- 0:00:38

      Average standard deviation of split frequencies: 0.013773

      385500 -- [-1213.237] (-1212.971) (-1213.199) (-1216.075) * [-1211.349] (-1213.256) (-1211.880) (-1211.203) -- 0:00:38
      386000 -- (-1214.649) (-1220.507) [-1211.934] (-1213.257) * (-1217.356) (-1213.043) [-1212.865] (-1211.481) -- 0:00:39
      386500 -- (-1214.068) [-1213.660] (-1212.205) (-1211.854) * (-1211.690) (-1213.972) [-1211.071] (-1213.378) -- 0:00:39
      387000 -- (-1213.901) [-1213.320] (-1211.123) (-1215.369) * (-1212.206) (-1212.715) [-1211.088] (-1213.812) -- 0:00:39
      387500 -- (-1213.820) (-1214.261) (-1211.389) [-1213.668] * (-1216.586) (-1211.276) [-1213.923] (-1215.167) -- 0:00:39
      388000 -- (-1215.985) [-1213.912] (-1214.988) (-1215.438) * (-1211.485) (-1211.084) (-1211.009) [-1211.112] -- 0:00:39
      388500 -- (-1216.168) (-1212.082) [-1212.659] (-1217.485) * (-1210.816) (-1214.784) [-1213.779] (-1211.312) -- 0:00:39
      389000 -- (-1213.239) (-1210.547) [-1213.284] (-1213.905) * (-1210.810) [-1214.388] (-1212.218) (-1211.915) -- 0:00:39
      389500 -- (-1211.707) (-1214.943) [-1218.000] (-1215.192) * [-1210.812] (-1210.826) (-1212.743) (-1211.870) -- 0:00:39
      390000 -- (-1211.696) (-1210.947) [-1212.187] (-1215.318) * (-1211.267) [-1212.886] (-1211.995) (-1214.402) -- 0:00:39

      Average standard deviation of split frequencies: 0.013340

      390500 -- (-1211.716) [-1211.625] (-1213.937) (-1211.874) * (-1211.333) (-1213.344) (-1211.061) [-1212.419] -- 0:00:39
      391000 -- (-1211.576) (-1215.115) (-1212.546) [-1212.290] * [-1218.490] (-1211.382) (-1212.296) (-1213.926) -- 0:00:38
      391500 -- (-1211.824) [-1212.671] (-1211.440) (-1213.929) * (-1212.234) (-1212.715) (-1211.211) [-1211.412] -- 0:00:38
      392000 -- (-1214.157) (-1214.406) [-1210.780] (-1213.340) * (-1212.722) (-1215.325) [-1211.258] (-1211.329) -- 0:00:38
      392500 -- [-1215.401] (-1213.316) (-1213.489) (-1211.854) * (-1212.802) [-1217.294] (-1214.059) (-1211.588) -- 0:00:38
      393000 -- (-1214.777) (-1213.651) (-1212.528) [-1212.655] * [-1211.989] (-1212.239) (-1212.822) (-1210.837) -- 0:00:38
      393500 -- (-1215.900) [-1212.033] (-1212.160) (-1212.217) * (-1212.666) (-1216.630) [-1212.021] (-1210.525) -- 0:00:38
      394000 -- (-1215.391) (-1212.327) [-1211.184] (-1211.519) * [-1215.517] (-1214.130) (-1212.243) (-1210.954) -- 0:00:38
      394500 -- (-1212.471) (-1212.766) (-1211.077) [-1215.711] * (-1217.595) [-1210.560] (-1212.870) (-1210.311) -- 0:00:38
      395000 -- (-1213.611) (-1213.008) (-1210.881) [-1216.496] * (-1212.201) (-1211.630) (-1213.207) [-1211.156] -- 0:00:38

      Average standard deviation of split frequencies: 0.013345

      395500 -- (-1212.154) (-1212.712) [-1212.226] (-1216.153) * (-1212.013) (-1213.012) [-1211.763] (-1213.021) -- 0:00:38
      396000 -- (-1218.877) [-1213.811] (-1211.407) (-1211.341) * (-1213.482) (-1215.648) [-1215.248] (-1211.993) -- 0:00:38
      396500 -- (-1217.486) (-1218.570) (-1211.753) [-1211.974] * [-1215.702] (-1216.017) (-1213.861) (-1214.337) -- 0:00:38
      397000 -- [-1213.721] (-1212.866) (-1211.982) (-1210.966) * (-1212.204) (-1214.174) (-1213.644) [-1212.549] -- 0:00:37
      397500 -- (-1212.606) (-1215.071) (-1212.883) [-1210.939] * (-1212.987) (-1212.224) (-1212.477) [-1211.108] -- 0:00:37
      398000 -- (-1211.624) (-1214.335) [-1212.038] (-1210.350) * (-1213.302) [-1212.353] (-1211.126) (-1213.373) -- 0:00:37
      398500 -- (-1213.863) (-1210.928) (-1211.838) [-1211.102] * (-1214.145) (-1212.221) [-1215.413] (-1210.943) -- 0:00:37
      399000 -- (-1213.661) (-1211.620) [-1211.557] (-1212.188) * (-1211.490) (-1214.167) [-1215.786] (-1212.300) -- 0:00:37
      399500 -- (-1213.895) (-1211.242) [-1211.601] (-1213.292) * (-1210.993) [-1210.930] (-1215.414) (-1212.756) -- 0:00:37
      400000 -- (-1217.822) (-1214.354) [-1212.369] (-1213.988) * (-1210.245) (-1212.510) (-1215.475) [-1213.182] -- 0:00:37

      Average standard deviation of split frequencies: 0.013465

      400500 -- (-1217.817) (-1213.643) [-1212.372] (-1210.686) * (-1211.055) (-1214.706) (-1210.439) [-1215.803] -- 0:00:37
      401000 -- (-1216.872) [-1212.527] (-1212.284) (-1210.690) * (-1210.701) (-1212.535) [-1210.457] (-1213.817) -- 0:00:37
      401500 -- (-1212.332) (-1212.885) (-1214.284) [-1210.740] * (-1211.039) (-1211.861) (-1214.869) [-1212.858] -- 0:00:37
      402000 -- (-1213.704) [-1212.481] (-1211.566) (-1210.581) * [-1210.601] (-1212.681) (-1214.854) (-1215.589) -- 0:00:38
      402500 -- (-1214.197) (-1212.240) (-1211.469) [-1212.595] * (-1212.198) (-1213.865) [-1210.740] (-1213.204) -- 0:00:38
      403000 -- [-1212.177] (-1212.830) (-1212.857) (-1211.663) * (-1212.259) [-1211.174] (-1211.916) (-1211.951) -- 0:00:38
      403500 -- (-1211.378) [-1212.087] (-1212.111) (-1212.490) * (-1215.407) (-1215.293) (-1211.347) [-1211.086] -- 0:00:38
      404000 -- (-1210.689) (-1213.121) [-1214.862] (-1214.526) * (-1211.927) (-1214.818) [-1211.380] (-1214.755) -- 0:00:38
      404500 -- (-1211.574) (-1211.983) (-1215.124) [-1215.251] * (-1211.830) (-1214.363) [-1213.967] (-1211.889) -- 0:00:38
      405000 -- (-1210.802) (-1215.538) [-1211.362] (-1215.073) * (-1217.033) [-1217.062] (-1214.710) (-1213.113) -- 0:00:38

      Average standard deviation of split frequencies: 0.012837

      405500 -- [-1211.243] (-1217.063) (-1210.419) (-1211.994) * (-1211.668) (-1217.627) [-1211.716] (-1214.663) -- 0:00:38
      406000 -- (-1211.057) [-1216.655] (-1213.646) (-1215.653) * [-1213.142] (-1215.996) (-1213.618) (-1211.292) -- 0:00:38
      406500 -- (-1211.188) [-1214.258] (-1212.521) (-1212.910) * (-1213.647) [-1211.852] (-1213.023) (-1211.041) -- 0:00:37
      407000 -- [-1211.250] (-1212.697) (-1211.491) (-1211.634) * (-1214.636) (-1211.965) (-1212.417) [-1211.275] -- 0:00:37
      407500 -- [-1213.356] (-1214.174) (-1211.219) (-1213.284) * (-1211.889) (-1214.040) [-1211.584] (-1211.717) -- 0:00:37
      408000 -- (-1212.997) (-1216.690) (-1211.232) [-1211.931] * (-1211.468) (-1211.889) [-1212.938] (-1212.913) -- 0:00:37
      408500 -- (-1210.575) [-1215.182] (-1213.610) (-1215.740) * [-1211.449] (-1213.408) (-1214.057) (-1215.870) -- 0:00:37
      409000 -- (-1210.336) (-1216.983) [-1212.214] (-1214.614) * [-1211.739] (-1212.327) (-1212.580) (-1211.377) -- 0:00:37
      409500 -- (-1210.275) (-1212.671) [-1216.478] (-1211.437) * [-1210.995] (-1212.618) (-1213.132) (-1213.094) -- 0:00:37
      410000 -- [-1211.014] (-1212.412) (-1211.415) (-1211.699) * [-1210.544] (-1213.328) (-1213.370) (-1213.339) -- 0:00:37

      Average standard deviation of split frequencies: 0.012117

      410500 -- (-1213.468) (-1211.808) [-1211.010] (-1210.550) * (-1213.088) (-1214.297) (-1213.336) [-1214.497] -- 0:00:37
      411000 -- [-1214.563] (-1212.850) (-1212.200) (-1212.964) * (-1212.982) (-1215.168) (-1214.418) [-1212.764] -- 0:00:37
      411500 -- (-1212.633) (-1212.717) (-1212.600) [-1210.858] * [-1211.809] (-1213.422) (-1212.753) (-1210.488) -- 0:00:37
      412000 -- (-1213.262) (-1210.811) [-1212.063] (-1212.836) * (-1215.131) (-1214.078) (-1211.311) [-1212.650] -- 0:00:37
      412500 -- (-1211.076) [-1211.011] (-1210.577) (-1214.634) * (-1217.183) (-1211.944) [-1211.329] (-1213.519) -- 0:00:37
      413000 -- (-1212.320) [-1211.246] (-1216.594) (-1212.460) * (-1212.461) (-1213.881) [-1213.127] (-1212.860) -- 0:00:36
      413500 -- [-1214.568] (-1211.452) (-1214.895) (-1210.836) * (-1214.871) (-1213.417) [-1210.753] (-1213.418) -- 0:00:36
      414000 -- (-1212.567) [-1211.663] (-1211.165) (-1211.519) * [-1211.690] (-1211.349) (-1210.669) (-1219.801) -- 0:00:36
      414500 -- [-1211.852] (-1213.843) (-1211.093) (-1213.614) * (-1211.492) [-1211.351] (-1213.239) (-1214.874) -- 0:00:36
      415000 -- [-1210.143] (-1212.030) (-1212.430) (-1211.991) * (-1212.733) [-1212.524] (-1213.504) (-1213.925) -- 0:00:36

      Average standard deviation of split frequencies: 0.011835

      415500 -- (-1210.130) [-1212.051] (-1216.922) (-1216.464) * [-1211.194] (-1211.088) (-1213.999) (-1212.747) -- 0:00:36
      416000 -- [-1211.329] (-1216.847) (-1214.881) (-1216.019) * (-1211.144) (-1217.916) (-1212.577) [-1212.083] -- 0:00:36
      416500 -- [-1214.486] (-1211.983) (-1213.996) (-1212.822) * (-1211.252) (-1215.141) (-1212.006) [-1212.476] -- 0:00:36
      417000 -- (-1212.002) (-1213.580) (-1212.982) [-1210.708] * (-1211.995) (-1213.965) (-1212.476) [-1211.209] -- 0:00:36
      417500 -- (-1211.859) (-1217.240) (-1213.507) [-1212.787] * (-1213.992) [-1213.181] (-1211.882) (-1213.411) -- 0:00:36
      418000 -- (-1213.168) (-1212.809) (-1210.541) [-1213.652] * (-1212.854) (-1211.745) [-1212.275] (-1212.791) -- 0:00:36
      418500 -- (-1213.428) (-1213.221) [-1211.448] (-1214.012) * (-1211.198) [-1211.971] (-1212.102) (-1212.483) -- 0:00:37
      419000 -- (-1211.449) (-1210.463) (-1211.339) [-1214.337] * (-1212.317) (-1212.515) (-1215.066) [-1213.364] -- 0:00:37
      419500 -- [-1211.922] (-1214.874) (-1214.875) (-1214.157) * (-1211.074) [-1211.365] (-1212.552) (-1213.233) -- 0:00:37
      420000 -- [-1211.944] (-1213.336) (-1213.536) (-1213.830) * (-1211.924) (-1216.873) [-1211.342] (-1212.926) -- 0:00:37

      Average standard deviation of split frequencies: 0.012015

      420500 -- (-1212.613) (-1211.617) (-1211.983) [-1211.190] * (-1211.924) [-1213.388] (-1211.765) (-1212.472) -- 0:00:37
      421000 -- (-1211.805) (-1211.412) (-1213.363) [-1211.190] * (-1214.356) (-1215.132) (-1215.314) [-1213.276] -- 0:00:37
      421500 -- (-1212.037) [-1210.797] (-1211.201) (-1211.313) * (-1213.531) (-1211.290) (-1211.655) [-1211.710] -- 0:00:37
      422000 -- [-1211.725] (-1215.025) (-1211.114) (-1214.285) * [-1212.189] (-1213.819) (-1211.358) (-1211.880) -- 0:00:36
      422500 -- (-1212.810) (-1212.241) [-1213.431] (-1214.757) * (-1214.437) (-1213.276) (-1213.738) [-1213.582] -- 0:00:36
      423000 -- (-1212.184) [-1211.481] (-1212.498) (-1214.424) * (-1213.857) [-1210.820] (-1211.896) (-1211.592) -- 0:00:36
      423500 -- (-1215.323) (-1211.009) (-1214.752) [-1210.952] * (-1211.591) [-1211.729] (-1212.419) (-1213.790) -- 0:00:36
      424000 -- (-1214.297) (-1211.164) (-1212.448) [-1212.729] * (-1211.002) (-1211.719) [-1211.270] (-1214.881) -- 0:00:36
      424500 -- [-1213.743] (-1211.613) (-1212.968) (-1212.621) * (-1211.208) [-1211.520] (-1212.018) (-1216.019) -- 0:00:36
      425000 -- (-1213.679) (-1214.249) (-1213.240) [-1214.580] * (-1211.329) [-1212.117] (-1211.755) (-1213.659) -- 0:00:36

      Average standard deviation of split frequencies: 0.011312

      425500 -- (-1212.476) (-1216.852) [-1211.876] (-1213.552) * (-1211.052) (-1212.361) (-1211.264) [-1212.297] -- 0:00:36
      426000 -- (-1213.867) (-1216.511) [-1210.609] (-1212.032) * (-1211.795) (-1213.352) [-1210.507] (-1213.099) -- 0:00:36
      426500 -- (-1213.114) [-1212.099] (-1211.180) (-1212.584) * (-1210.587) (-1212.264) [-1211.161] (-1216.839) -- 0:00:36
      427000 -- (-1213.040) (-1210.487) (-1210.645) [-1211.587] * (-1210.530) [-1211.386] (-1213.553) (-1213.208) -- 0:00:36
      427500 -- (-1213.524) (-1211.750) (-1211.620) [-1211.069] * (-1211.953) [-1215.114] (-1212.390) (-1215.939) -- 0:00:36
      428000 -- (-1213.122) (-1212.991) [-1212.624] (-1212.587) * (-1213.801) (-1210.795) (-1211.348) [-1215.079] -- 0:00:36
      428500 -- (-1212.576) [-1211.193] (-1214.799) (-1213.855) * (-1218.520) (-1211.387) (-1211.931) [-1213.036] -- 0:00:36
      429000 -- [-1213.764] (-1216.290) (-1216.123) (-1213.892) * [-1214.124] (-1213.270) (-1211.906) (-1212.127) -- 0:00:35
      429500 -- (-1213.703) (-1214.365) [-1211.141] (-1210.799) * [-1216.064] (-1214.426) (-1211.751) (-1213.483) -- 0:00:35
      430000 -- (-1212.309) [-1214.438] (-1211.400) (-1214.659) * [-1217.634] (-1215.945) (-1212.320) (-1211.877) -- 0:00:35

      Average standard deviation of split frequencies: 0.010885

      430500 -- [-1211.210] (-1211.627) (-1213.419) (-1212.019) * (-1213.340) (-1211.647) [-1212.452] (-1212.870) -- 0:00:35
      431000 -- (-1212.523) (-1213.897) (-1215.142) [-1211.869] * (-1211.758) (-1210.568) (-1210.566) [-1210.869] -- 0:00:35
      431500 -- (-1211.540) (-1214.932) (-1218.090) [-1214.329] * (-1213.495) (-1210.581) (-1212.485) [-1212.947] -- 0:00:35
      432000 -- (-1214.642) [-1211.789] (-1218.567) (-1211.414) * (-1216.707) (-1210.867) (-1211.688) [-1210.443] -- 0:00:35
      432500 -- [-1213.539] (-1212.172) (-1213.014) (-1212.463) * (-1215.529) (-1211.619) (-1216.192) [-1210.718] -- 0:00:35
      433000 -- (-1210.464) (-1214.558) [-1214.742] (-1211.059) * (-1214.125) [-1214.842] (-1213.847) (-1211.847) -- 0:00:35
      433500 -- (-1211.258) [-1212.114] (-1215.604) (-1212.108) * [-1210.876] (-1212.232) (-1214.050) (-1212.588) -- 0:00:35
      434000 -- (-1214.676) (-1213.409) [-1212.072] (-1211.766) * (-1212.225) [-1211.703] (-1210.832) (-1215.574) -- 0:00:35
      434500 -- (-1212.913) (-1211.934) [-1213.150] (-1211.300) * (-1213.348) (-1213.318) [-1212.154] (-1217.788) -- 0:00:36
      435000 -- (-1216.173) (-1214.827) (-1215.364) [-1210.650] * (-1212.691) (-1211.205) [-1214.175] (-1211.921) -- 0:00:36

      Average standard deviation of split frequencies: 0.010692

      435500 -- (-1215.563) [-1211.979] (-1213.708) (-1212.387) * (-1215.958) (-1217.233) [-1213.916] (-1212.559) -- 0:00:36
      436000 -- (-1214.245) (-1211.026) [-1214.896] (-1216.526) * [-1212.001] (-1214.189) (-1212.678) (-1212.418) -- 0:00:36
      436500 -- (-1213.648) [-1213.022] (-1211.660) (-1211.382) * [-1214.169] (-1212.977) (-1212.665) (-1211.698) -- 0:00:36
      437000 -- [-1214.929] (-1215.938) (-1211.452) (-1212.669) * (-1213.545) [-1212.173] (-1213.168) (-1217.279) -- 0:00:36
      437500 -- (-1210.516) [-1215.881] (-1213.487) (-1211.669) * (-1213.401) [-1211.153] (-1212.701) (-1214.519) -- 0:00:36
      438000 -- (-1214.838) [-1215.216] (-1214.635) (-1213.694) * [-1211.109] (-1215.673) (-1214.465) (-1211.775) -- 0:00:35
      438500 -- (-1213.456) (-1212.566) (-1211.934) [-1213.330] * [-1212.329] (-1210.886) (-1214.117) (-1211.146) -- 0:00:35
      439000 -- [-1211.050] (-1212.399) (-1212.864) (-1211.408) * (-1211.179) (-1214.375) [-1215.754] (-1213.858) -- 0:00:35
      439500 -- (-1212.106) [-1211.235] (-1218.974) (-1212.537) * (-1211.651) (-1213.592) [-1210.896] (-1213.930) -- 0:00:35
      440000 -- (-1211.062) [-1212.638] (-1211.041) (-1210.942) * (-1212.085) (-1213.707) [-1212.331] (-1211.999) -- 0:00:35

      Average standard deviation of split frequencies: 0.009806

      440500 -- [-1212.680] (-1212.166) (-1211.165) (-1211.336) * [-1211.228] (-1213.191) (-1212.998) (-1212.000) -- 0:00:35
      441000 -- (-1212.708) (-1218.053) [-1212.064] (-1212.858) * [-1211.566] (-1214.061) (-1212.766) (-1214.155) -- 0:00:35
      441500 -- (-1212.966) [-1211.690] (-1215.287) (-1212.656) * (-1212.603) (-1212.498) (-1212.811) [-1210.762] -- 0:00:35
      442000 -- (-1211.668) [-1211.393] (-1211.170) (-1213.468) * (-1218.723) (-1211.816) (-1212.215) [-1211.957] -- 0:00:35
      442500 -- [-1213.126] (-1212.482) (-1211.709) (-1215.788) * (-1214.045) [-1212.529] (-1211.356) (-1211.810) -- 0:00:35
      443000 -- [-1210.734] (-1211.881) (-1211.877) (-1212.755) * (-1215.141) (-1211.367) [-1213.360] (-1214.040) -- 0:00:35
      443500 -- [-1211.019] (-1212.501) (-1212.868) (-1212.554) * [-1211.093] (-1212.344) (-1212.661) (-1212.527) -- 0:00:35
      444000 -- (-1210.937) (-1212.502) [-1214.521] (-1212.174) * (-1213.779) (-1212.860) [-1212.973] (-1213.330) -- 0:00:35
      444500 -- (-1214.962) (-1210.145) [-1211.815] (-1215.355) * [-1212.683] (-1212.989) (-1217.767) (-1210.708) -- 0:00:34
      445000 -- (-1215.613) (-1211.950) (-1216.892) [-1211.654] * [-1213.952] (-1211.303) (-1212.591) (-1212.319) -- 0:00:34

      Average standard deviation of split frequencies: 0.009571

      445500 -- [-1213.923] (-1214.543) (-1219.104) (-1211.361) * (-1211.837) (-1210.810) [-1211.787] (-1212.228) -- 0:00:34
      446000 -- [-1211.998] (-1216.969) (-1213.852) (-1213.201) * (-1212.208) [-1210.327] (-1211.827) (-1217.893) -- 0:00:34
      446500 -- (-1210.369) [-1211.654] (-1212.915) (-1211.439) * (-1213.662) [-1211.392] (-1212.755) (-1211.698) -- 0:00:34
      447000 -- (-1211.689) (-1212.991) (-1211.715) [-1213.372] * (-1212.134) [-1214.104] (-1212.478) (-1211.665) -- 0:00:34
      447500 -- (-1212.646) [-1210.942] (-1214.858) (-1211.916) * (-1211.981) [-1210.420] (-1213.636) (-1211.256) -- 0:00:34
      448000 -- (-1216.472) (-1213.274) (-1213.192) [-1213.116] * [-1211.669] (-1211.181) (-1212.604) (-1211.908) -- 0:00:34
      448500 -- (-1211.955) [-1211.419] (-1211.381) (-1213.609) * (-1211.265) [-1212.300] (-1211.262) (-1210.288) -- 0:00:34
      449000 -- (-1210.442) (-1215.278) [-1211.834] (-1212.498) * (-1210.787) [-1217.412] (-1211.726) (-1212.657) -- 0:00:34
      449500 -- (-1210.956) [-1213.326] (-1211.006) (-1213.725) * (-1213.406) (-1211.511) [-1211.655] (-1213.503) -- 0:00:34
      450000 -- (-1212.399) [-1212.731] (-1214.198) (-1211.960) * (-1211.513) (-1212.278) [-1212.047] (-1211.207) -- 0:00:34

      Average standard deviation of split frequencies: 0.009705

      450500 -- [-1214.277] (-1212.174) (-1213.989) (-1213.152) * (-1211.581) [-1212.401] (-1212.657) (-1211.356) -- 0:00:35
      451000 -- (-1213.039) (-1215.859) [-1212.977] (-1212.369) * [-1212.264] (-1211.859) (-1212.477) (-1213.374) -- 0:00:35
      451500 -- (-1213.823) (-1211.356) (-1211.501) [-1213.288] * [-1211.984] (-1212.555) (-1211.227) (-1212.623) -- 0:00:35
      452000 -- (-1211.190) (-1214.411) [-1211.613] (-1211.943) * [-1211.683] (-1214.690) (-1211.721) (-1212.642) -- 0:00:35
      452500 -- (-1211.245) (-1210.360) [-1211.438] (-1214.039) * (-1211.467) [-1211.683] (-1214.902) (-1211.072) -- 0:00:35
      453000 -- (-1217.491) [-1211.391] (-1213.898) (-1210.668) * (-1213.007) (-1213.237) [-1218.967] (-1214.394) -- 0:00:35
      453500 -- (-1211.382) (-1211.501) (-1214.164) [-1210.674] * (-1216.581) (-1215.248) (-1213.723) [-1211.009] -- 0:00:34
      454000 -- [-1215.735] (-1210.891) (-1216.139) (-1211.099) * (-1213.110) (-1213.659) (-1214.798) [-1210.997] -- 0:00:34
      454500 -- (-1210.973) [-1215.202] (-1213.928) (-1216.128) * [-1211.632] (-1213.743) (-1213.722) (-1210.747) -- 0:00:34
      455000 -- (-1211.064) (-1211.749) (-1211.771) [-1211.078] * [-1211.620] (-1214.333) (-1212.321) (-1212.283) -- 0:00:34

      Average standard deviation of split frequencies: 0.009074

      455500 -- (-1211.400) [-1213.530] (-1212.119) (-1210.307) * (-1212.865) [-1213.526] (-1216.432) (-1212.302) -- 0:00:34
      456000 -- [-1211.457] (-1211.255) (-1211.078) (-1211.095) * (-1211.416) (-1212.689) [-1212.184] (-1213.148) -- 0:00:34
      456500 -- (-1212.550) [-1210.667] (-1213.726) (-1211.601) * (-1215.457) (-1211.326) [-1211.140] (-1212.542) -- 0:00:34
      457000 -- (-1214.368) (-1211.324) [-1213.475] (-1211.471) * (-1214.843) (-1212.677) [-1211.698] (-1212.436) -- 0:00:34
      457500 -- (-1211.918) (-1214.660) [-1213.593] (-1212.320) * [-1211.559] (-1214.479) (-1213.248) (-1213.930) -- 0:00:34
      458000 -- (-1215.376) (-1213.926) (-1213.990) [-1211.706] * (-1213.532) (-1213.025) [-1211.983] (-1212.586) -- 0:00:34
      458500 -- [-1214.005] (-1213.276) (-1212.143) (-1211.815) * (-1210.998) (-1211.991) [-1210.954] (-1212.511) -- 0:00:34
      459000 -- [-1213.283] (-1213.410) (-1213.024) (-1211.155) * (-1211.329) [-1212.832] (-1212.818) (-1211.697) -- 0:00:34
      459500 -- (-1211.731) (-1212.850) [-1212.052] (-1212.718) * [-1212.033] (-1210.800) (-1214.061) (-1212.623) -- 0:00:34
      460000 -- [-1211.553] (-1211.234) (-1210.896) (-1213.547) * (-1214.221) (-1211.997) (-1213.900) [-1217.163] -- 0:00:34

      Average standard deviation of split frequencies: 0.008926

      460500 -- (-1211.615) (-1212.604) (-1211.935) [-1214.015] * (-1212.513) [-1211.598] (-1211.302) (-1210.639) -- 0:00:33
      461000 -- (-1211.568) (-1213.019) [-1212.920] (-1211.180) * [-1216.325] (-1219.739) (-1210.350) (-1210.775) -- 0:00:33
      461500 -- [-1211.341] (-1211.121) (-1212.589) (-1211.603) * (-1212.040) [-1213.512] (-1210.405) (-1211.681) -- 0:00:33
      462000 -- (-1213.419) (-1214.964) (-1214.363) [-1211.332] * (-1214.196) (-1213.066) (-1210.658) [-1212.925] -- 0:00:33
      462500 -- (-1210.847) (-1211.648) [-1212.836] (-1211.869) * (-1211.007) (-1211.371) (-1216.656) [-1212.681] -- 0:00:33
      463000 -- [-1211.858] (-1210.998) (-1214.337) (-1210.733) * (-1214.495) [-1211.707] (-1213.698) (-1212.242) -- 0:00:33
      463500 -- (-1211.843) (-1210.678) (-1213.282) [-1213.038] * (-1215.457) [-1215.019] (-1214.093) (-1214.046) -- 0:00:33
      464000 -- (-1210.960) (-1212.702) (-1216.478) [-1211.624] * [-1216.318] (-1216.671) (-1211.354) (-1213.863) -- 0:00:33
      464500 -- [-1211.463] (-1212.492) (-1210.575) (-1211.156) * (-1213.037) (-1214.487) (-1211.354) [-1214.259] -- 0:00:33
      465000 -- (-1212.373) (-1211.987) (-1211.517) [-1214.313] * [-1211.620] (-1213.658) (-1211.951) (-1212.049) -- 0:00:33

      Average standard deviation of split frequencies: 0.008678

      465500 -- (-1215.067) (-1214.871) [-1211.948] (-1213.666) * [-1211.501] (-1216.486) (-1212.710) (-1212.532) -- 0:00:33
      466000 -- (-1217.706) (-1214.850) (-1211.365) [-1212.289] * [-1210.713] (-1212.816) (-1215.027) (-1214.632) -- 0:00:33
      466500 -- (-1211.563) [-1214.255] (-1212.149) (-1213.064) * (-1212.145) (-1213.165) [-1212.453] (-1212.788) -- 0:00:33
      467000 -- [-1212.614] (-1211.396) (-1214.285) (-1211.679) * (-1213.338) (-1214.587) [-1212.669] (-1215.564) -- 0:00:34
      467500 -- [-1214.423] (-1212.843) (-1212.101) (-1212.232) * (-1213.992) (-1212.672) (-1217.872) [-1213.752] -- 0:00:34
      468000 -- (-1211.878) (-1211.186) (-1215.220) [-1214.335] * (-1212.870) (-1214.633) (-1210.884) [-1212.099] -- 0:00:34
      468500 -- (-1212.665) (-1214.370) [-1211.364] (-1211.073) * (-1211.934) (-1214.622) [-1210.993] (-1212.900) -- 0:00:34
      469000 -- (-1212.451) [-1212.428] (-1211.152) (-1211.666) * (-1212.543) [-1212.271] (-1212.699) (-1211.861) -- 0:00:33
      469500 -- (-1212.510) (-1213.380) (-1211.546) [-1214.173] * (-1214.391) [-1213.441] (-1215.104) (-1212.887) -- 0:00:33
      470000 -- (-1212.059) [-1215.573] (-1213.165) (-1214.707) * (-1213.700) (-1220.510) [-1214.736] (-1211.953) -- 0:00:33

      Average standard deviation of split frequencies: 0.008680

      470500 -- (-1211.164) [-1210.509] (-1214.731) (-1217.802) * (-1214.861) (-1215.165) (-1216.041) [-1213.848] -- 0:00:33
      471000 -- (-1211.168) (-1214.436) (-1210.708) [-1215.052] * (-1212.718) [-1212.181] (-1214.493) (-1212.764) -- 0:00:33
      471500 -- (-1217.497) (-1216.166) [-1212.666] (-1211.318) * (-1212.912) [-1211.471] (-1212.053) (-1211.726) -- 0:00:33
      472000 -- (-1212.742) (-1212.875) (-1212.170) [-1210.901] * [-1212.710] (-1211.756) (-1213.125) (-1213.198) -- 0:00:33
      472500 -- (-1214.278) (-1213.661) (-1211.337) [-1210.675] * (-1212.414) [-1212.809] (-1213.019) (-1212.273) -- 0:00:33
      473000 -- [-1214.066] (-1213.709) (-1215.079) (-1211.971) * (-1213.739) (-1211.612) [-1214.950] (-1211.354) -- 0:00:33
      473500 -- (-1212.131) [-1212.335] (-1212.546) (-1212.817) * (-1212.028) [-1211.629] (-1211.163) (-1211.458) -- 0:00:33
      474000 -- (-1211.764) (-1210.946) (-1211.111) [-1212.344] * (-1215.114) (-1214.053) (-1213.962) [-1213.274] -- 0:00:33
      474500 -- (-1216.055) (-1211.241) [-1212.375] (-1212.683) * (-1212.347) [-1210.996] (-1212.448) (-1213.608) -- 0:00:33
      475000 -- [-1210.844] (-1211.436) (-1217.857) (-1212.347) * (-1212.967) (-1216.469) [-1214.267] (-1215.743) -- 0:00:33

      Average standard deviation of split frequencies: 0.008098

      475500 -- (-1216.617) (-1211.929) (-1212.811) [-1211.165] * [-1210.690] (-1213.182) (-1212.833) (-1213.023) -- 0:00:33
      476000 -- (-1216.521) (-1210.784) [-1213.964] (-1211.009) * (-1212.748) (-1214.730) (-1211.478) [-1213.719] -- 0:00:33
      476500 -- [-1213.163] (-1211.481) (-1214.428) (-1211.710) * (-1211.334) [-1212.278] (-1211.541) (-1210.977) -- 0:00:32
      477000 -- (-1215.686) (-1212.844) (-1212.963) [-1215.847] * (-1218.519) (-1212.872) (-1212.294) [-1210.336] -- 0:00:32
      477500 -- (-1211.701) (-1211.210) (-1212.916) [-1211.924] * (-1214.394) (-1211.256) (-1212.883) [-1210.763] -- 0:00:32
      478000 -- (-1211.844) [-1212.009] (-1215.213) (-1214.590) * (-1214.986) (-1213.368) [-1211.933] (-1211.907) -- 0:00:32
      478500 -- (-1211.344) (-1216.689) [-1213.551] (-1211.984) * (-1215.744) [-1212.149] (-1211.519) (-1210.859) -- 0:00:32
      479000 -- (-1214.362) (-1216.287) [-1211.319] (-1211.478) * [-1214.389] (-1211.602) (-1211.827) (-1210.571) -- 0:00:32
      479500 -- (-1214.804) (-1213.996) (-1211.346) [-1212.516] * (-1214.211) (-1214.226) [-1215.754] (-1211.958) -- 0:00:32
      480000 -- [-1210.687] (-1211.435) (-1212.216) (-1211.316) * (-1216.606) (-1214.330) (-1211.690) [-1211.515] -- 0:00:32

      Average standard deviation of split frequencies: 0.007846

      480500 -- (-1211.587) (-1212.433) (-1211.814) [-1210.688] * (-1216.372) (-1215.065) [-1210.550] (-1216.803) -- 0:00:32
      481000 -- (-1210.424) (-1214.538) [-1213.929] (-1212.456) * (-1211.129) (-1213.166) (-1212.057) [-1215.073] -- 0:00:32
      481500 -- [-1212.987] (-1215.133) (-1214.028) (-1210.743) * [-1211.460] (-1210.992) (-1213.555) (-1213.938) -- 0:00:32
      482000 -- [-1211.837] (-1212.979) (-1215.238) (-1212.500) * (-1214.606) (-1212.193) (-1214.549) [-1214.613] -- 0:00:32
      482500 -- (-1213.903) (-1213.368) [-1214.202] (-1211.937) * (-1212.673) [-1212.646] (-1215.914) (-1211.566) -- 0:00:32
      483000 -- (-1214.384) (-1212.143) (-1212.296) [-1212.941] * (-1213.437) (-1210.717) [-1213.080] (-1211.456) -- 0:00:33
      483500 -- (-1213.627) (-1210.905) (-1212.757) [-1212.181] * (-1213.253) (-1211.374) [-1213.005] (-1211.624) -- 0:00:33
      484000 -- (-1212.025) (-1212.303) (-1213.252) [-1213.264] * (-1212.660) (-1212.278) (-1212.976) [-1212.485] -- 0:00:33
      484500 -- [-1214.110] (-1214.963) (-1212.479) (-1213.260) * [-1212.164] (-1214.017) (-1212.172) (-1213.142) -- 0:00:32
      485000 -- (-1212.638) [-1211.732] (-1211.143) (-1212.905) * (-1211.513) [-1213.769] (-1211.537) (-1215.390) -- 0:00:32

      Average standard deviation of split frequencies: 0.008844

      485500 -- (-1213.397) (-1216.284) (-1211.637) [-1212.509] * [-1210.478] (-1213.287) (-1211.536) (-1215.907) -- 0:00:32
      486000 -- (-1212.838) (-1214.103) (-1212.824) [-1211.320] * (-1211.722) (-1212.984) [-1210.703] (-1212.847) -- 0:00:32
      486500 -- [-1213.359] (-1214.087) (-1210.789) (-1211.014) * (-1212.629) (-1211.113) (-1210.731) [-1212.643] -- 0:00:32
      487000 -- (-1211.655) (-1210.987) [-1210.523] (-1215.221) * (-1213.267) [-1212.411] (-1212.448) (-1215.489) -- 0:00:32
      487500 -- (-1211.759) (-1210.988) [-1212.146] (-1212.473) * (-1211.624) [-1211.804] (-1211.239) (-1215.013) -- 0:00:32
      488000 -- (-1210.731) (-1210.784) [-1210.673] (-1212.139) * [-1212.981] (-1211.208) (-1213.548) (-1211.322) -- 0:00:32
      488500 -- [-1210.683] (-1213.841) (-1210.869) (-1210.619) * (-1212.677) (-1211.723) [-1210.811] (-1211.204) -- 0:00:32
      489000 -- (-1211.880) (-1212.436) [-1210.883] (-1210.226) * [-1214.172] (-1211.929) (-1210.578) (-1212.707) -- 0:00:32
      489500 -- [-1211.127] (-1213.020) (-1211.366) (-1214.947) * (-1213.769) [-1216.131] (-1217.487) (-1215.120) -- 0:00:32
      490000 -- (-1211.463) (-1217.072) (-1213.714) [-1211.048] * (-1215.638) (-1212.430) [-1212.974] (-1216.378) -- 0:00:32

      Average standard deviation of split frequencies: 0.009664

      490500 -- (-1211.153) [-1214.391] (-1214.273) (-1211.665) * (-1212.206) [-1213.232] (-1212.950) (-1216.294) -- 0:00:32
      491000 -- (-1212.748) (-1213.162) [-1212.003] (-1210.883) * (-1212.086) (-1214.577) [-1216.617] (-1216.278) -- 0:00:32
      491500 -- (-1214.012) (-1212.914) (-1213.265) [-1211.212] * (-1214.214) (-1210.968) (-1212.406) [-1212.437] -- 0:00:32
      492000 -- (-1210.893) (-1215.149) [-1210.811] (-1211.260) * (-1212.835) (-1212.230) (-1214.713) [-1210.428] -- 0:00:32
      492500 -- (-1211.778) [-1213.600] (-1210.812) (-1211.509) * [-1212.394] (-1215.549) (-1213.130) (-1210.749) -- 0:00:31
      493000 -- (-1211.903) (-1212.567) [-1212.706] (-1211.930) * (-1210.828) [-1211.715] (-1214.366) (-1212.097) -- 0:00:31
      493500 -- (-1211.661) (-1211.344) [-1211.414] (-1211.908) * [-1211.775] (-1211.711) (-1214.455) (-1211.698) -- 0:00:31
      494000 -- (-1210.662) [-1211.293] (-1210.632) (-1212.195) * (-1212.335) [-1212.785] (-1212.692) (-1212.086) -- 0:00:31
      494500 -- (-1210.899) [-1211.161] (-1217.100) (-1212.658) * [-1211.419] (-1212.622) (-1215.150) (-1211.664) -- 0:00:31
      495000 -- (-1211.662) (-1212.437) (-1212.044) [-1217.385] * (-1214.477) (-1213.599) (-1214.460) [-1212.618] -- 0:00:31

      Average standard deviation of split frequencies: 0.009169

      495500 -- (-1213.086) [-1210.373] (-1210.862) (-1214.628) * (-1214.030) (-1212.757) (-1216.691) [-1213.878] -- 0:00:31
      496000 -- (-1213.093) [-1211.127] (-1213.236) (-1215.639) * (-1214.122) [-1212.019] (-1217.107) (-1213.952) -- 0:00:31
      496500 -- (-1211.664) (-1210.623) [-1213.974] (-1216.330) * (-1217.862) (-1216.062) (-1211.039) [-1211.171] -- 0:00:31
      497000 -- (-1212.056) [-1210.674] (-1211.331) (-1211.264) * (-1215.064) [-1214.308] (-1211.207) (-1211.582) -- 0:00:31
      497500 -- (-1213.239) (-1212.633) [-1211.317] (-1212.504) * (-1215.660) [-1210.773] (-1213.776) (-1211.909) -- 0:00:31
      498000 -- (-1213.477) (-1213.715) (-1212.566) [-1211.777] * (-1213.858) [-1212.969] (-1213.533) (-1212.398) -- 0:00:31
      498500 -- (-1213.482) (-1214.703) [-1214.445] (-1210.931) * (-1212.340) (-1211.423) (-1212.137) [-1211.718] -- 0:00:31
      499000 -- (-1216.290) (-1211.427) [-1215.723] (-1211.837) * (-1211.399) [-1210.746] (-1216.181) (-1213.947) -- 0:00:31
      499500 -- (-1215.805) (-1211.511) (-1214.833) [-1213.073] * (-1211.087) (-1211.305) (-1217.174) [-1212.075] -- 0:00:32
      500000 -- (-1216.432) (-1213.315) [-1210.654] (-1212.319) * (-1210.903) (-1211.025) (-1216.850) [-1211.270] -- 0:00:32

      Average standard deviation of split frequencies: 0.008892

      500500 -- (-1216.408) (-1211.960) [-1210.633] (-1213.773) * (-1210.894) [-1213.376] (-1214.310) (-1214.402) -- 0:00:31
      501000 -- (-1212.824) (-1212.624) (-1214.474) [-1211.257] * [-1211.662] (-1218.947) (-1214.032) (-1211.793) -- 0:00:31
      501500 -- (-1211.279) (-1214.443) (-1215.777) [-1212.826] * [-1211.008] (-1218.494) (-1214.646) (-1211.500) -- 0:00:31
      502000 -- (-1211.171) (-1212.869) [-1213.280] (-1213.302) * (-1216.843) [-1212.405] (-1211.636) (-1214.632) -- 0:00:31
      502500 -- (-1217.146) [-1211.193] (-1213.781) (-1211.706) * (-1215.520) (-1211.444) (-1217.535) [-1213.069] -- 0:00:31
      503000 -- [-1213.468] (-1211.337) (-1216.086) (-1213.676) * [-1212.317] (-1211.408) (-1213.377) (-1211.899) -- 0:00:31
      503500 -- (-1211.610) (-1211.278) (-1214.316) [-1212.586] * (-1210.617) [-1211.968] (-1210.974) (-1214.611) -- 0:00:31
      504000 -- (-1213.074) (-1211.780) [-1210.929] (-1213.616) * (-1212.399) [-1213.543] (-1211.402) (-1211.761) -- 0:00:31
      504500 -- (-1212.982) (-1210.834) (-1213.125) [-1212.244] * (-1219.361) [-1214.351] (-1213.585) (-1211.202) -- 0:00:31
      505000 -- (-1211.499) (-1211.265) [-1213.661] (-1211.813) * (-1212.530) [-1212.194] (-1211.432) (-1215.524) -- 0:00:31

      Average standard deviation of split frequencies: 0.008333

      505500 -- (-1211.275) [-1211.514] (-1212.281) (-1211.274) * (-1211.437) (-1214.032) [-1212.579] (-1211.793) -- 0:00:31
      506000 -- (-1210.307) [-1211.595] (-1213.644) (-1210.488) * (-1212.016) (-1211.483) [-1212.599] (-1211.400) -- 0:00:31
      506500 -- (-1213.301) [-1211.049] (-1216.467) (-1211.126) * (-1213.156) (-1212.034) (-1218.523) [-1212.445] -- 0:00:31
      507000 -- (-1214.125) (-1213.054) (-1214.117) [-1212.626] * (-1212.046) (-1212.411) [-1215.553] (-1216.044) -- 0:00:31
      507500 -- (-1213.540) [-1212.817] (-1210.991) (-1211.035) * [-1213.095] (-1214.235) (-1213.055) (-1211.201) -- 0:00:31
      508000 -- (-1211.416) (-1214.537) (-1210.791) [-1213.297] * (-1211.588) (-1211.268) (-1213.218) [-1212.136] -- 0:00:30
      508500 -- (-1214.721) (-1217.477) (-1211.648) [-1211.973] * (-1212.232) (-1212.032) [-1212.291] (-1213.328) -- 0:00:30
      509000 -- (-1210.672) (-1216.123) [-1212.335] (-1215.339) * (-1212.316) (-1211.483) [-1212.055] (-1213.347) -- 0:00:30
      509500 -- (-1213.562) (-1215.796) [-1217.298] (-1214.981) * (-1212.092) (-1215.206) [-1211.913] (-1213.363) -- 0:00:30
      510000 -- [-1213.084] (-1211.310) (-1218.821) (-1213.357) * [-1211.242] (-1214.768) (-1211.344) (-1212.973) -- 0:00:30

      Average standard deviation of split frequencies: 0.007494

      510500 -- [-1211.500] (-1213.329) (-1214.994) (-1212.155) * (-1213.241) [-1213.503] (-1212.063) (-1211.848) -- 0:00:30
      511000 -- (-1213.626) (-1211.490) (-1214.690) [-1212.476] * (-1211.683) (-1217.021) (-1212.895) [-1211.459] -- 0:00:30
      511500 -- (-1215.610) (-1211.483) (-1212.867) [-1211.929] * (-1211.730) (-1214.126) [-1211.080] (-1213.961) -- 0:00:30
      512000 -- (-1212.438) [-1210.401] (-1212.262) (-1212.030) * (-1211.670) (-1215.239) [-1211.261] (-1211.635) -- 0:00:30
      512500 -- [-1212.525] (-1212.988) (-1211.439) (-1213.127) * (-1214.366) (-1213.981) (-1210.588) [-1210.691] -- 0:00:30
      513000 -- (-1214.247) [-1211.598] (-1211.380) (-1213.021) * (-1211.334) (-1213.829) (-1214.302) [-1212.406] -- 0:00:30
      513500 -- (-1214.464) [-1213.556] (-1212.789) (-1213.009) * (-1211.116) (-1217.343) (-1212.318) [-1214.988] -- 0:00:30
      514000 -- (-1213.975) (-1212.625) [-1211.832] (-1213.600) * [-1213.282] (-1218.165) (-1215.175) (-1212.007) -- 0:00:30
      514500 -- (-1210.721) [-1211.570] (-1216.199) (-1214.075) * (-1212.581) (-1217.278) [-1212.125] (-1213.004) -- 0:00:30
      515000 -- (-1211.223) (-1211.827) [-1215.254] (-1213.274) * (-1214.030) (-1215.998) (-1212.880) [-1211.668] -- 0:00:31

      Average standard deviation of split frequencies: 0.007362

      515500 -- (-1212.201) (-1211.700) [-1216.744] (-1212.993) * (-1212.007) (-1212.280) [-1212.033] (-1212.430) -- 0:00:31
      516000 -- (-1212.306) (-1214.377) [-1215.442] (-1213.296) * [-1213.269] (-1212.046) (-1212.589) (-1212.479) -- 0:00:30
      516500 -- (-1213.845) (-1216.609) [-1211.862] (-1215.836) * [-1212.961] (-1211.198) (-1213.074) (-1212.339) -- 0:00:30
      517000 -- (-1214.710) (-1212.800) [-1213.090] (-1214.440) * (-1213.355) (-1211.735) (-1211.133) [-1211.571] -- 0:00:30
      517500 -- (-1215.977) [-1210.559] (-1211.756) (-1217.593) * (-1214.931) (-1211.252) (-1211.745) [-1212.329] -- 0:00:30
      518000 -- (-1211.332) (-1216.301) (-1212.978) [-1212.637] * (-1212.293) [-1210.607] (-1211.724) (-1211.492) -- 0:00:30
      518500 -- (-1211.027) (-1212.030) (-1214.322) [-1214.207] * (-1212.717) [-1211.076] (-1211.896) (-1213.241) -- 0:00:30
      519000 -- [-1214.111] (-1211.320) (-1215.058) (-1212.397) * [-1214.853] (-1211.354) (-1211.594) (-1210.449) -- 0:00:30
      519500 -- (-1213.841) (-1210.546) (-1216.208) [-1213.333] * (-1212.972) (-1213.148) [-1211.310] (-1212.546) -- 0:00:30
      520000 -- (-1216.912) (-1211.490) [-1214.608] (-1210.782) * (-1212.605) (-1211.060) [-1211.470] (-1214.123) -- 0:00:30

      Average standard deviation of split frequencies: 0.007509

      520500 -- (-1212.890) (-1210.702) [-1213.730] (-1212.006) * (-1212.115) (-1214.915) [-1214.762] (-1216.864) -- 0:00:30
      521000 -- (-1212.138) (-1213.896) [-1213.299] (-1216.977) * (-1212.858) [-1214.380] (-1216.169) (-1216.323) -- 0:00:30
      521500 -- (-1210.785) (-1212.966) [-1211.762] (-1214.724) * (-1212.306) (-1211.297) [-1213.550] (-1214.729) -- 0:00:30
      522000 -- (-1210.729) (-1213.736) (-1216.742) [-1215.101] * [-1213.900] (-1212.761) (-1213.086) (-1210.825) -- 0:00:30
      522500 -- [-1212.573] (-1211.676) (-1213.488) (-1212.148) * (-1213.086) (-1213.825) (-1212.683) [-1212.049] -- 0:00:30
      523000 -- (-1213.222) (-1210.547) (-1213.094) [-1211.355] * (-1212.659) (-1214.771) (-1220.316) [-1211.587] -- 0:00:30
      523500 -- (-1213.793) (-1212.735) [-1211.100] (-1213.262) * [-1213.009] (-1211.216) (-1213.495) (-1212.099) -- 0:00:30
      524000 -- (-1215.006) (-1212.458) [-1214.040] (-1212.310) * (-1214.931) (-1217.202) (-1215.062) [-1213.161] -- 0:00:29
      524500 -- (-1212.169) (-1211.420) [-1218.652] (-1212.417) * (-1213.902) (-1213.098) (-1212.215) [-1210.707] -- 0:00:29
      525000 -- (-1210.910) [-1212.086] (-1212.615) (-1212.899) * (-1210.896) (-1216.581) (-1211.328) [-1211.532] -- 0:00:29

      Average standard deviation of split frequencies: 0.007170

      525500 -- [-1210.706] (-1210.668) (-1212.576) (-1215.399) * [-1211.965] (-1212.046) (-1211.837) (-1215.136) -- 0:00:29
      526000 -- (-1212.624) (-1211.355) (-1213.742) [-1211.523] * (-1212.798) (-1213.700) (-1210.885) [-1212.740] -- 0:00:29
      526500 -- (-1214.381) (-1211.566) [-1215.042] (-1211.699) * (-1218.945) (-1211.401) [-1210.885] (-1215.505) -- 0:00:29
      527000 -- (-1211.384) (-1211.077) (-1212.817) [-1211.041] * (-1217.461) (-1211.586) (-1210.883) [-1215.546] -- 0:00:29
      527500 -- (-1211.503) (-1216.519) [-1213.641] (-1210.360) * (-1215.575) (-1210.788) (-1213.796) [-1216.976] -- 0:00:29
      528000 -- (-1211.470) [-1211.594] (-1212.739) (-1210.360) * (-1214.579) (-1213.373) [-1212.883] (-1212.570) -- 0:00:29
      528500 -- (-1214.461) [-1211.915] (-1210.891) (-1210.687) * [-1210.991] (-1212.283) (-1216.134) (-1213.489) -- 0:00:29
      529000 -- (-1214.016) [-1212.150] (-1211.327) (-1213.916) * (-1211.305) [-1212.138] (-1212.260) (-1215.853) -- 0:00:29
      529500 -- (-1211.528) (-1211.477) (-1210.624) [-1213.709] * (-1212.507) (-1211.701) [-