>C1
VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
>C2
VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
>C3
VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
>C4
VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
>C5
VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=291
C1 VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
C2 VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
C3 VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
C4 VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
C5 VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
**************************************************
C1 TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
C2 TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
C3 TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
C4 TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
C5 TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
**************************************************
C1 WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
C2 WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
C3 WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
C4 WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
C5 WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
**************************************************
C1 LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
C2 LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
C3 LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
C4 LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
C5 LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
**************************************************
C1 VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
C2 VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
C3 VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
C4 VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
C5 VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
**************************************************
C1 QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
C2 QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
C3 QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
C4 QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
C5 QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
*****************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5820]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5820]--->[5820]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.436 Mb, Max= 30.730 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
C2 VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
C3 VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
C4 VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
C5 VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
**************************************************
C1 TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
C2 TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
C3 TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
C4 TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
C5 TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
**************************************************
C1 WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
C2 WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
C3 WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
C4 WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
C5 WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
**************************************************
C1 LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
C2 LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
C3 LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
C4 LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
C5 LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
**************************************************
C1 VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
C2 VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
C3 VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
C4 VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
C5 VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
**************************************************
C1 QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
C2 QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
C3 QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
C4 QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
C5 QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
*****************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGACAGTACCTGACAACGATCCCGAGCAGCTGCGCTGCGTAGCCGAATC
C2 GTGACAGTACCTGACAACGATCCCGAGCAGCTGCGCTGCGTAGCCGAATC
C3 GTGACAGTACCTGACAACGATCCCGAGCAGCTGCGCTGCGTAGCCGAATC
C4 GTGACAGTACCTGACAACGATCCCGAGCAGCTGCGCTGCGTAGCCGAATC
C5 GTGACAGTACCTGACAACGATCCCGAGCAGCTGCGCTGCGTAGCCGAATC
**************************************************
C1 ACTGGCCACTGAGGCCGCCGCGTTCGTGCGATGTCGCCGAGCTGAGGTGT
C2 ACTGGCCACTGAGGCCGCCGCGTTCGTGCGATGTCGCCGAGCTGAGGTGT
C3 ACTGGCCACTGAGGCCGCCGCGTTCGTGCGATGTCGCCGAGCTGAGGTGT
C4 ACTGGCCACTGAGGCCGCCGCGTTCGTGCGATGTCGCCGAGCTGAGGTGT
C5 ACTGGCCACTGAGGCCGCCGCGTTCGTGCGATGTCGCCGAGCTGAGGTGT
**************************************************
C1 TTGGTACTGACCTGGGCGCCGCAGGCGGCGGCGCGGTACGGGCGAAGAGT
C2 TTGGTACTGACCTGGGCGCCGCAGGCGGCGGCGCGGTACGGGCGAAGAGT
C3 TTGGTACTGACCTGGGCGCCGCAGGCGGCGGCGCGGTACGGGCGAAGAGT
C4 TTGGTACTGACCTGGGCGCCGCAGGCGGCGGCGCGGTACGGGCGAAGAGT
C5 TTGGTACTGACCTGGGCGCCGCAGGCGGCGGCGCGGTACGGGCGAAGAGT
**************************************************
C1 ACCCCGACCGATCCGGTGACTGTCGTTGACACCGAGACAGAACGCTTGTT
C2 ACCCCGACCGATCCGGTGACTGTCGTTGACACCGAGACAGAACGCTTGTT
C3 ACCCCGACCGATCCGGTGACTGTCGTTGACACCGAGACAGAACGCTTGTT
C4 ACCCCGACCGATCCGGTGACTGTCGTTGACACCGAGACAGAACGCTTGTT
C5 ACCCCGACCGATCCGGTGACTGTCGTTGACACCGAGACAGAACGCTTGTT
**************************************************
C1 GCGTGATCGGCTCGCTCAACTACGGCCCGGTGACTCGATCCTTGGGGAGG
C2 GCGTGATCGGCTCGCTCAACTACGGCCCGGTGACTCGATCCTTGGGGAGG
C3 GCGTGATCGGCTCGCTCAACTACGGCCCGGTGACTCGATCCTTGGGGAGG
C4 GCGTGATCGGCTCGCTCAACTACGGCCCGGTGACTCGATCCTTGGGGAGG
C5 GCGTGATCGGCTCGCTCAACTACGGCCCGGTGACTCGATCCTTGGGGAGG
**************************************************
C1 AGGGGGGTGGGCCCGCCGATCTGACCGCCACGCCTGCAGACACGGTAACC
C2 AGGGGGGTGGGCCCGCCGATCTGACCGCCACGCCTGCAGACACGGTAACC
C3 AGGGGGGTGGGCCCGCCGATCTGACCGCCACGCCTGCAGACACGGTAACC
C4 AGGGGGGTGGGCCCGCCGATCTGACCGCCACGCCTGCAGACACGGTAACC
C5 AGGGGGGTGGGCCCGCCGATCTGACCGCCACGCCTGCAGACACGGTAACC
**************************************************
C1 TGGGTGCTTGACCCCATCGATGGCACGGTGAACTTTGTCTACGGCATCCC
C2 TGGGTGCTTGACCCCATCGATGGCACGGTGAACTTTGTCTACGGCATCCC
C3 TGGGTGCTTGACCCCATCGATGGCACGGTGAACTTTGTCTACGGCATCCC
C4 TGGGTGCTTGACCCCATCGATGGCACGGTGAACTTTGTCTACGGCATCCC
C5 TGGGTGCTTGACCCCATCGATGGCACGGTGAACTTTGTCTACGGCATCCC
**************************************************
C1 GGCTTACGCGGTGTCGGTCGCAGCTCAGGTTGATGGCGTGTCAGTGGCCG
C2 GGCTTACGCGGTGTCGGTCGCAGCTCAGGTTGATGGCGTGTCAGTGGCCG
C3 GGCTTACGCGGTGTCGGTCGCAGCTCAGGTTGATGGCGTGTCAGTGGCCG
C4 GGCTTACGCGGTGTCGGTCGCAGCTCAGGTTGATGGCGTGTCAGTGGCCG
C5 GGCTTACGCGGTGTCGGTCGCAGCTCAGGTTGATGGCGTGTCAGTGGCCG
**************************************************
C1 GCGCGGTTGCTGAAGTTGTTGCCGGTCGGGTGCACTCGGCGGCGAGCGGC
C2 GCGCGGTTGCTGAAGTTGTTGCCGGTCGGGTGCACTCGGCGGCGAGCGGC
C3 GCGCGGTTGCTGAAGTTGTTGCCGGTCGGGTGCACTCGGCGGCGAGCGGC
C4 GCGCGGTTGCTGAAGTTGTTGCCGGTCGGGTGCACTCGGCGGCGAGCGGC
C5 GCGCGGTTGCTGAAGTTGTTGCCGGTCGGGTGCACTCGGCGGCGAGCGGC
**************************************************
C1 CTCGGCGCGCATGTCACCGACGAGTATGGTGTACAGGTACTGAGATGCAG
C2 CTCGGCGCGCATGTCACCGACGAGTATGGTGTACAGGTACTGAGATGCAG
C3 CTCGGCGCGCATGTCACCGACGAGTATGGTGTACAGGTACTGAGATGCAG
C4 CTCGGCGCGCATGTCACCGACGAGTATGGTGTACAGGTACTGAGATGCAG
C5 CTCGGCGCGCATGTCACCGACGAGTATGGTGTACAGGTACTGAGATGCAG
**************************************************
C1 CGCAGTCGATGACTTGTCGATGGCGCTGCTAGGTACTGGCTTTGCCTATT
C2 CGCAGTCGATGACTTGTCGATGGCGCTGCTAGGTACTGGCTTTGCCTATT
C3 CGCAGTCGATGACTTGTCGATGGCGCTGCTAGGTACTGGCTTTGCCTATT
C4 CGCAGTCGATGACTTGTCGATGGCGCTGCTAGGTACTGGCTTTGCCTATT
C5 CGCAGTCGATGACTTGTCGATGGCGCTGCTAGGTACTGGCTTTGCCTATT
**************************************************
C1 CGGTAGTGCGCCGCGCCGCCCAGGCGGCGCTGTTGGCCCAGATGCTGCCG
C2 CGGTAGTGCGCCGCGCCGCCCAGGCGGCGCTGTTGGCCCAGATGCTGCCG
C3 CGGTAGTGCGCCGCGCCGCCCAGGCGGCGCTGTTGGCCCAGATGCTGCCG
C4 CGGTAGTGCGCCGCGCCGCCCAGGCGGCGCTGTTGGCCCAGATGCTGCCG
C5 CGGTAGTGCGCCGCGCCGCCCAGGCGGCGCTGTTGGCCCAGATGCTGCCG
**************************************************
C1 GTGGTACGTGATGTACGTCGCATCGGTTCGGCCGCGTTAGACCTTTGCAT
C2 GTGGTACGTGATGTACGTCGCATCGGTTCGGCCGCGTTAGACCTTTGCAT
C3 GTGGTACGTGATGTACGTCGCATCGGTTCGGCCGCGTTAGACCTTTGCAT
C4 GTGGTACGTGATGTACGTCGCATCGGTTCGGCCGCGTTAGACCTTTGCAT
C5 GTGGTACGTGATGTACGTCGCATCGGTTCGGCCGCGTTAGACCTTTGCAT
**************************************************
C1 GGTTGCGGCGGGCCAGTTGGATGCTTATTACGAGCATGAGGTGCAGGTGT
C2 GGTTGCGGCGGGCCAGTTGGATGCTTATTACGAGCATGAGGTGCAGGTGT
C3 GGTTGCGGCGGGCCAGTTGGATGCTTATTACGAGCATGAGGTGCAGGTGT
C4 GGTTGCGGCGGGCCAGTTGGATGCTTATTACGAGCATGAGGTGCAGGTGT
C5 GGTTGCGGCGGGCCAGTTGGATGCTTATTACGAGCATGAGGTGCAGGTGT
**************************************************
C1 GGGATTGCGCGGCTGGCGCGTTGATCGCGGCGGAAGCGGGGGCCTGTGTG
C2 GGGATTGCGCGGCTGGCGCGTTGATCGCGGCGGAAGCGGGGGCCTGTGTG
C3 GGGATTGCGCGGCTGGCGCGTTGATCGCGGCGGAAGCGGGGGCCTGTGTG
C4 GGGATTGCGCGGCTGGCGCGTTGATCGCGGCGGAAGCGGGGGCCTGTGTG
C5 GGGATTGCGCGGCTGGCGCGTTGATCGCGGCGGAAGCGGGGGCCTGTGTG
**************************************************
C1 CAGTTGCCTAAGCGGAACGGGCCCGTGGGCGGTGCCGGATTGGTGGTAGC
C2 CAGTTGCCTAAGCGGAACGGGCCCGTGGGCGGTGCCGGATTGGTGGTAGC
C3 CAGTTGCCTAAGCGGAACGGGCCCGTGGGCGGTGCCGGATTGGTGGTAGC
C4 CAGTTGCCTAAGCGGAACGGGCCCGTGGGCGGTGCCGGATTGGTGGTAGC
C5 CAGTTGCCTAAGCGGAACGGGCCCGTGGGCGGTGCCGGATTGGTGGTAGC
**************************************************
C1 TGCCGCGCCTGGAATCGCCGACGCATTGTTGGCTGCCTTGCAGCGATTCA
C2 TGCCGCGCCTGGAATCGCCGACGCATTGTTGGCTGCCTTGCAGCGATTCA
C3 TGCCGCGCCTGGAATCGCCGACGCATTGTTGGCTGCCTTGCAGCGATTCA
C4 TGCCGCGCCTGGAATCGCCGACGCATTGTTGGCTGCCTTGCAGCGATTCA
C5 TGCCGCGCCTGGAATCGCCGACGCATTGTTGGCTGCCTTGCAGCGATTCA
**************************************************
C1 ACGGCCTGGCGCCGATCCTGGAC
C2 ACGGCCTGGCGCCGATCCTGGAC
C3 ACGGCCTGGCGCCGATCCTGGAC
C4 ACGGCCTGGCGCCGATCCTGGAC
C5 ACGGCCTGGCGCCGATCCTGGAC
***********************
>C1
GTGACAGTACCTGACAACGATCCCGAGCAGCTGCGCTGCGTAGCCGAATC
ACTGGCCACTGAGGCCGCCGCGTTCGTGCGATGTCGCCGAGCTGAGGTGT
TTGGTACTGACCTGGGCGCCGCAGGCGGCGGCGCGGTACGGGCGAAGAGT
ACCCCGACCGATCCGGTGACTGTCGTTGACACCGAGACAGAACGCTTGTT
GCGTGATCGGCTCGCTCAACTACGGCCCGGTGACTCGATCCTTGGGGAGG
AGGGGGGTGGGCCCGCCGATCTGACCGCCACGCCTGCAGACACGGTAACC
TGGGTGCTTGACCCCATCGATGGCACGGTGAACTTTGTCTACGGCATCCC
GGCTTACGCGGTGTCGGTCGCAGCTCAGGTTGATGGCGTGTCAGTGGCCG
GCGCGGTTGCTGAAGTTGTTGCCGGTCGGGTGCACTCGGCGGCGAGCGGC
CTCGGCGCGCATGTCACCGACGAGTATGGTGTACAGGTACTGAGATGCAG
CGCAGTCGATGACTTGTCGATGGCGCTGCTAGGTACTGGCTTTGCCTATT
CGGTAGTGCGCCGCGCCGCCCAGGCGGCGCTGTTGGCCCAGATGCTGCCG
GTGGTACGTGATGTACGTCGCATCGGTTCGGCCGCGTTAGACCTTTGCAT
GGTTGCGGCGGGCCAGTTGGATGCTTATTACGAGCATGAGGTGCAGGTGT
GGGATTGCGCGGCTGGCGCGTTGATCGCGGCGGAAGCGGGGGCCTGTGTG
CAGTTGCCTAAGCGGAACGGGCCCGTGGGCGGTGCCGGATTGGTGGTAGC
TGCCGCGCCTGGAATCGCCGACGCATTGTTGGCTGCCTTGCAGCGATTCA
ACGGCCTGGCGCCGATCCTGGAC
>C2
GTGACAGTACCTGACAACGATCCCGAGCAGCTGCGCTGCGTAGCCGAATC
ACTGGCCACTGAGGCCGCCGCGTTCGTGCGATGTCGCCGAGCTGAGGTGT
TTGGTACTGACCTGGGCGCCGCAGGCGGCGGCGCGGTACGGGCGAAGAGT
ACCCCGACCGATCCGGTGACTGTCGTTGACACCGAGACAGAACGCTTGTT
GCGTGATCGGCTCGCTCAACTACGGCCCGGTGACTCGATCCTTGGGGAGG
AGGGGGGTGGGCCCGCCGATCTGACCGCCACGCCTGCAGACACGGTAACC
TGGGTGCTTGACCCCATCGATGGCACGGTGAACTTTGTCTACGGCATCCC
GGCTTACGCGGTGTCGGTCGCAGCTCAGGTTGATGGCGTGTCAGTGGCCG
GCGCGGTTGCTGAAGTTGTTGCCGGTCGGGTGCACTCGGCGGCGAGCGGC
CTCGGCGCGCATGTCACCGACGAGTATGGTGTACAGGTACTGAGATGCAG
CGCAGTCGATGACTTGTCGATGGCGCTGCTAGGTACTGGCTTTGCCTATT
CGGTAGTGCGCCGCGCCGCCCAGGCGGCGCTGTTGGCCCAGATGCTGCCG
GTGGTACGTGATGTACGTCGCATCGGTTCGGCCGCGTTAGACCTTTGCAT
GGTTGCGGCGGGCCAGTTGGATGCTTATTACGAGCATGAGGTGCAGGTGT
GGGATTGCGCGGCTGGCGCGTTGATCGCGGCGGAAGCGGGGGCCTGTGTG
CAGTTGCCTAAGCGGAACGGGCCCGTGGGCGGTGCCGGATTGGTGGTAGC
TGCCGCGCCTGGAATCGCCGACGCATTGTTGGCTGCCTTGCAGCGATTCA
ACGGCCTGGCGCCGATCCTGGAC
>C3
GTGACAGTACCTGACAACGATCCCGAGCAGCTGCGCTGCGTAGCCGAATC
ACTGGCCACTGAGGCCGCCGCGTTCGTGCGATGTCGCCGAGCTGAGGTGT
TTGGTACTGACCTGGGCGCCGCAGGCGGCGGCGCGGTACGGGCGAAGAGT
ACCCCGACCGATCCGGTGACTGTCGTTGACACCGAGACAGAACGCTTGTT
GCGTGATCGGCTCGCTCAACTACGGCCCGGTGACTCGATCCTTGGGGAGG
AGGGGGGTGGGCCCGCCGATCTGACCGCCACGCCTGCAGACACGGTAACC
TGGGTGCTTGACCCCATCGATGGCACGGTGAACTTTGTCTACGGCATCCC
GGCTTACGCGGTGTCGGTCGCAGCTCAGGTTGATGGCGTGTCAGTGGCCG
GCGCGGTTGCTGAAGTTGTTGCCGGTCGGGTGCACTCGGCGGCGAGCGGC
CTCGGCGCGCATGTCACCGACGAGTATGGTGTACAGGTACTGAGATGCAG
CGCAGTCGATGACTTGTCGATGGCGCTGCTAGGTACTGGCTTTGCCTATT
CGGTAGTGCGCCGCGCCGCCCAGGCGGCGCTGTTGGCCCAGATGCTGCCG
GTGGTACGTGATGTACGTCGCATCGGTTCGGCCGCGTTAGACCTTTGCAT
GGTTGCGGCGGGCCAGTTGGATGCTTATTACGAGCATGAGGTGCAGGTGT
GGGATTGCGCGGCTGGCGCGTTGATCGCGGCGGAAGCGGGGGCCTGTGTG
CAGTTGCCTAAGCGGAACGGGCCCGTGGGCGGTGCCGGATTGGTGGTAGC
TGCCGCGCCTGGAATCGCCGACGCATTGTTGGCTGCCTTGCAGCGATTCA
ACGGCCTGGCGCCGATCCTGGAC
>C4
GTGACAGTACCTGACAACGATCCCGAGCAGCTGCGCTGCGTAGCCGAATC
ACTGGCCACTGAGGCCGCCGCGTTCGTGCGATGTCGCCGAGCTGAGGTGT
TTGGTACTGACCTGGGCGCCGCAGGCGGCGGCGCGGTACGGGCGAAGAGT
ACCCCGACCGATCCGGTGACTGTCGTTGACACCGAGACAGAACGCTTGTT
GCGTGATCGGCTCGCTCAACTACGGCCCGGTGACTCGATCCTTGGGGAGG
AGGGGGGTGGGCCCGCCGATCTGACCGCCACGCCTGCAGACACGGTAACC
TGGGTGCTTGACCCCATCGATGGCACGGTGAACTTTGTCTACGGCATCCC
GGCTTACGCGGTGTCGGTCGCAGCTCAGGTTGATGGCGTGTCAGTGGCCG
GCGCGGTTGCTGAAGTTGTTGCCGGTCGGGTGCACTCGGCGGCGAGCGGC
CTCGGCGCGCATGTCACCGACGAGTATGGTGTACAGGTACTGAGATGCAG
CGCAGTCGATGACTTGTCGATGGCGCTGCTAGGTACTGGCTTTGCCTATT
CGGTAGTGCGCCGCGCCGCCCAGGCGGCGCTGTTGGCCCAGATGCTGCCG
GTGGTACGTGATGTACGTCGCATCGGTTCGGCCGCGTTAGACCTTTGCAT
GGTTGCGGCGGGCCAGTTGGATGCTTATTACGAGCATGAGGTGCAGGTGT
GGGATTGCGCGGCTGGCGCGTTGATCGCGGCGGAAGCGGGGGCCTGTGTG
CAGTTGCCTAAGCGGAACGGGCCCGTGGGCGGTGCCGGATTGGTGGTAGC
TGCCGCGCCTGGAATCGCCGACGCATTGTTGGCTGCCTTGCAGCGATTCA
ACGGCCTGGCGCCGATCCTGGAC
>C5
GTGACAGTACCTGACAACGATCCCGAGCAGCTGCGCTGCGTAGCCGAATC
ACTGGCCACTGAGGCCGCCGCGTTCGTGCGATGTCGCCGAGCTGAGGTGT
TTGGTACTGACCTGGGCGCCGCAGGCGGCGGCGCGGTACGGGCGAAGAGT
ACCCCGACCGATCCGGTGACTGTCGTTGACACCGAGACAGAACGCTTGTT
GCGTGATCGGCTCGCTCAACTACGGCCCGGTGACTCGATCCTTGGGGAGG
AGGGGGGTGGGCCCGCCGATCTGACCGCCACGCCTGCAGACACGGTAACC
TGGGTGCTTGACCCCATCGATGGCACGGTGAACTTTGTCTACGGCATCCC
GGCTTACGCGGTGTCGGTCGCAGCTCAGGTTGATGGCGTGTCAGTGGCCG
GCGCGGTTGCTGAAGTTGTTGCCGGTCGGGTGCACTCGGCGGCGAGCGGC
CTCGGCGCGCATGTCACCGACGAGTATGGTGTACAGGTACTGAGATGCAG
CGCAGTCGATGACTTGTCGATGGCGCTGCTAGGTACTGGCTTTGCCTATT
CGGTAGTGCGCCGCGCCGCCCAGGCGGCGCTGTTGGCCCAGATGCTGCCG
GTGGTACGTGATGTACGTCGCATCGGTTCGGCCGCGTTAGACCTTTGCAT
GGTTGCGGCGGGCCAGTTGGATGCTTATTACGAGCATGAGGTGCAGGTGT
GGGATTGCGCGGCTGGCGCGTTGATCGCGGCGGAAGCGGGGGCCTGTGTG
CAGTTGCCTAAGCGGAACGGGCCCGTGGGCGGTGCCGGATTGGTGGTAGC
TGCCGCGCCTGGAATCGCCGACGCATTGTTGGCTGCCTTGCAGCGATTCA
ACGGCCTGGCGCCGATCCTGGAC
>C1
VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
>C2
VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
>C3
VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
>C4
VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
>C5
VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 873 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579789508
Setting output file names to "/data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1753337395
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0612821072
Seed = 331407421
Swapseed = 1579789508
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1793.140691 -- -25.624409
Chain 2 -- -1793.140691 -- -25.624409
Chain 3 -- -1793.140691 -- -25.624409
Chain 4 -- -1793.140691 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1793.140755 -- -25.624409
Chain 2 -- -1793.140691 -- -25.624409
Chain 3 -- -1793.140691 -- -25.624409
Chain 4 -- -1793.140691 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1793.141] (-1793.141) (-1793.141) (-1793.141) * [-1793.141] (-1793.141) (-1793.141) (-1793.141)
500 -- [-1173.570] (-1203.293) (-1186.161) (-1206.001) * (-1174.068) [-1170.942] (-1204.492) (-1175.866) -- 0:00:00
1000 -- [-1171.794] (-1197.118) (-1178.705) (-1190.514) * [-1168.678] (-1175.292) (-1180.285) (-1170.326) -- 0:00:00
1500 -- (-1168.974) (-1175.758) [-1171.569] (-1169.158) * [-1169.411] (-1170.351) (-1166.095) (-1170.808) -- 0:00:00
2000 -- (-1172.101) [-1176.562] (-1172.982) (-1171.764) * (-1171.466) [-1166.812] (-1172.459) (-1175.980) -- 0:00:00
2500 -- (-1168.202) [-1167.021] (-1172.499) (-1167.024) * (-1173.762) [-1166.383] (-1164.338) (-1166.391) -- 0:00:00
3000 -- (-1164.642) (-1165.096) [-1170.527] (-1172.060) * (-1175.651) (-1174.983) (-1168.970) [-1171.035] -- 0:00:00
3500 -- (-1171.537) [-1173.192] (-1176.291) (-1172.397) * (-1171.681) [-1170.564] (-1163.724) (-1171.510) -- 0:00:00
4000 -- (-1174.837) [-1164.762] (-1178.095) (-1169.381) * (-1171.808) (-1171.155) [-1167.587] (-1168.913) -- 0:00:00
4500 -- (-1168.780) (-1170.525) (-1170.388) [-1170.003] * (-1180.469) [-1167.590] (-1167.306) (-1168.409) -- 0:00:00
5000 -- (-1175.751) (-1168.218) (-1168.337) [-1170.485] * (-1165.919) (-1172.303) [-1165.369] (-1172.904) -- 0:03:19
Average standard deviation of split frequencies: 0.104757
5500 -- (-1176.807) (-1170.564) [-1167.052] (-1174.402) * [-1164.785] (-1181.020) (-1170.729) (-1175.763) -- 0:03:00
6000 -- (-1169.170) (-1173.781) (-1172.553) [-1170.269] * (-1172.034) [-1164.074] (-1167.573) (-1176.617) -- 0:02:45
6500 -- [-1172.142] (-1168.930) (-1172.850) (-1170.705) * (-1169.597) [-1170.027] (-1175.612) (-1174.549) -- 0:02:32
7000 -- (-1178.090) (-1170.001) (-1168.276) [-1168.418] * (-1166.767) (-1172.027) (-1173.217) [-1167.857] -- 0:02:21
7500 -- (-1173.363) (-1167.292) (-1172.847) [-1170.293] * (-1168.598) (-1169.957) (-1169.222) [-1173.077] -- 0:02:12
8000 -- (-1169.418) (-1174.113) (-1174.777) [-1167.882] * (-1173.663) (-1171.745) (-1165.755) [-1163.939] -- 0:02:04
8500 -- (-1170.850) (-1169.034) (-1170.081) [-1167.064] * [-1171.689] (-1168.746) (-1161.072) (-1164.998) -- 0:01:56
9000 -- (-1172.606) (-1169.222) (-1169.846) [-1164.683] * (-1172.457) (-1168.483) (-1162.464) [-1165.781] -- 0:01:50
9500 -- [-1167.864] (-1167.981) (-1170.587) (-1172.242) * (-1171.993) [-1168.485] (-1163.003) (-1172.862) -- 0:01:44
10000 -- [-1169.948] (-1170.108) (-1164.224) (-1174.615) * [-1167.113] (-1174.294) (-1165.158) (-1181.864) -- 0:01:39
Average standard deviation of split frequencies: 0.063836
10500 -- (-1174.629) (-1171.983) (-1169.919) [-1176.363] * [-1169.612] (-1170.533) (-1163.389) (-1172.952) -- 0:01:34
11000 -- [-1169.769] (-1170.907) (-1174.190) (-1165.287) * [-1169.016] (-1168.500) (-1162.524) (-1169.602) -- 0:01:29
11500 -- (-1167.868) (-1165.798) (-1170.453) [-1170.283] * (-1171.851) (-1169.628) [-1162.706] (-1171.029) -- 0:01:25
12000 -- (-1173.139) [-1167.261] (-1166.376) (-1169.821) * (-1171.328) (-1168.769) [-1161.602] (-1168.810) -- 0:01:22
12500 -- (-1171.278) (-1176.034) (-1174.515) [-1172.775] * [-1170.811] (-1170.760) (-1161.739) (-1167.137) -- 0:01:19
13000 -- [-1166.876] (-1181.014) (-1165.839) (-1170.173) * (-1167.375) [-1170.759] (-1161.847) (-1168.940) -- 0:01:15
13500 -- (-1168.174) [-1169.945] (-1175.556) (-1169.369) * (-1168.164) (-1165.995) [-1161.490] (-1170.056) -- 0:01:13
14000 -- (-1173.396) (-1177.062) (-1168.566) [-1167.489] * (-1168.963) (-1170.557) [-1160.991] (-1172.113) -- 0:01:10
14500 -- (-1185.279) (-1166.752) [-1170.758] (-1173.686) * (-1171.784) (-1169.646) [-1163.016] (-1175.732) -- 0:01:07
15000 -- (-1179.014) (-1168.920) [-1167.962] (-1173.124) * (-1168.537) [-1169.436] (-1165.366) (-1173.128) -- 0:01:05
Average standard deviation of split frequencies: 0.064818
15500 -- (-1170.026) (-1167.944) (-1175.279) [-1172.891] * (-1177.584) [-1169.273] (-1163.602) (-1166.390) -- 0:01:03
16000 -- (-1174.079) (-1170.881) (-1173.011) [-1169.434] * (-1174.688) (-1168.283) (-1166.759) [-1170.805] -- 0:01:01
16500 -- [-1168.728] (-1166.742) (-1175.848) (-1173.035) * (-1164.986) (-1173.216) (-1163.985) [-1166.502] -- 0:00:59
17000 -- (-1175.402) (-1169.814) (-1168.891) [-1163.950] * (-1171.666) (-1174.521) (-1163.619) [-1169.116] -- 0:00:57
17500 -- (-1173.419) (-1165.328) [-1170.582] (-1174.899) * (-1177.337) (-1170.639) (-1161.839) [-1165.661] -- 0:00:56
18000 -- (-1169.602) [-1169.883] (-1171.684) (-1166.059) * (-1176.514) (-1166.625) [-1163.395] (-1175.086) -- 0:00:54
18500 -- (-1169.854) (-1168.027) [-1165.201] (-1168.123) * (-1175.527) (-1169.815) [-1162.831] (-1177.058) -- 0:00:53
19000 -- (-1166.296) [-1170.256] (-1171.267) (-1166.723) * (-1173.864) [-1166.737] (-1161.986) (-1180.083) -- 0:00:51
19500 -- (-1173.010) (-1178.880) (-1169.930) [-1169.988] * (-1164.955) (-1169.780) (-1163.247) [-1168.702] -- 0:00:50
20000 -- (-1170.071) [-1173.899] (-1166.880) (-1174.708) * (-1165.797) (-1167.908) (-1166.237) [-1167.299] -- 0:00:49
Average standard deviation of split frequencies: 0.054744
20500 -- (-1170.097) [-1167.958] (-1167.239) (-1172.898) * [-1168.406] (-1168.241) (-1163.173) (-1167.910) -- 0:00:47
21000 -- [-1170.095] (-1166.016) (-1172.152) (-1173.034) * [-1171.900] (-1167.076) (-1161.527) (-1168.811) -- 0:00:46
21500 -- (-1172.509) (-1169.463) (-1169.555) [-1168.301] * [-1168.529] (-1169.218) (-1160.908) (-1179.203) -- 0:01:31
22000 -- [-1166.915] (-1168.622) (-1171.103) (-1172.745) * (-1172.236) (-1173.561) (-1161.648) [-1171.360] -- 0:01:28
22500 -- (-1171.201) [-1168.280] (-1170.973) (-1180.035) * (-1178.726) (-1171.029) [-1161.590] (-1163.534) -- 0:01:26
23000 -- [-1171.482] (-1168.796) (-1175.456) (-1172.113) * (-1162.542) (-1172.038) [-1162.744] (-1168.238) -- 0:01:24
23500 -- (-1179.725) [-1174.502] (-1166.518) (-1166.077) * (-1163.218) (-1167.115) [-1163.207] (-1170.700) -- 0:01:23
24000 -- (-1167.236) [-1172.665] (-1167.579) (-1168.253) * (-1166.118) [-1165.632] (-1161.992) (-1176.875) -- 0:01:21
24500 -- (-1170.769) (-1173.284) (-1167.060) [-1167.158] * (-1164.537) (-1168.191) [-1162.314] (-1167.772) -- 0:01:19
25000 -- (-1166.295) (-1165.605) (-1172.735) [-1167.745] * (-1164.095) (-1167.088) (-1163.347) [-1169.888] -- 0:01:18
Average standard deviation of split frequencies: 0.054393
25500 -- (-1165.252) [-1165.711] (-1166.216) (-1181.666) * (-1163.780) (-1166.691) [-1163.133] (-1165.238) -- 0:01:16
26000 -- [-1163.145] (-1169.811) (-1170.502) (-1175.501) * [-1164.542] (-1179.540) (-1162.619) (-1164.801) -- 0:01:14
26500 -- [-1162.577] (-1169.493) (-1168.443) (-1168.425) * (-1162.775) (-1170.672) (-1165.100) [-1169.276] -- 0:01:13
27000 -- [-1162.089] (-1172.007) (-1171.011) (-1173.001) * [-1162.084] (-1176.575) (-1164.902) (-1167.663) -- 0:01:12
27500 -- (-1161.597) (-1175.483) (-1179.964) [-1169.100] * [-1163.047] (-1180.345) (-1165.191) (-1172.940) -- 0:01:10
28000 -- (-1165.556) [-1175.224] (-1175.287) (-1167.608) * [-1161.748] (-1166.541) (-1162.023) (-1169.326) -- 0:01:09
28500 -- (-1162.538) (-1171.142) (-1168.165) [-1168.207] * (-1161.625) [-1165.653] (-1164.151) (-1166.441) -- 0:01:08
29000 -- (-1163.987) (-1175.003) [-1171.407] (-1170.312) * (-1162.866) [-1169.440] (-1163.563) (-1165.318) -- 0:01:06
29500 -- (-1164.086) [-1165.705] (-1166.932) (-1172.590) * (-1163.537) [-1169.869] (-1163.000) (-1169.441) -- 0:01:05
30000 -- [-1163.832] (-1172.670) (-1167.507) (-1170.454) * [-1161.565] (-1171.701) (-1161.684) (-1167.049) -- 0:01:04
Average standard deviation of split frequencies: 0.046116
30500 -- (-1162.913) (-1166.578) [-1170.000] (-1167.472) * (-1162.224) [-1168.616] (-1161.729) (-1169.947) -- 0:01:03
31000 -- (-1162.506) (-1169.714) [-1165.333] (-1172.884) * (-1161.924) (-1168.325) (-1164.361) [-1168.841] -- 0:01:02
31500 -- [-1162.535] (-1178.377) (-1165.878) (-1171.705) * (-1161.270) [-1168.502] (-1164.448) (-1173.305) -- 0:01:01
32000 -- (-1163.504) [-1170.205] (-1171.235) (-1168.457) * (-1161.883) (-1169.751) (-1165.022) [-1166.687] -- 0:01:00
32500 -- (-1162.557) [-1172.675] (-1170.302) (-1175.797) * [-1165.032] (-1166.968) (-1165.186) (-1169.440) -- 0:00:59
33000 -- (-1163.675) (-1170.424) [-1164.610] (-1170.958) * (-1164.841) (-1169.928) [-1163.497] (-1175.403) -- 0:00:58
33500 -- (-1165.547) [-1166.074] (-1162.693) (-1172.308) * (-1162.119) (-1170.522) [-1161.142] (-1170.958) -- 0:00:57
34000 -- [-1162.396] (-1167.458) (-1164.877) (-1166.027) * (-1162.286) [-1165.208] (-1162.544) (-1174.592) -- 0:00:56
34500 -- (-1164.555) [-1164.149] (-1165.467) (-1175.621) * (-1163.545) (-1170.198) (-1162.987) [-1167.792] -- 0:00:55
35000 -- [-1165.310] (-1167.175) (-1165.763) (-1171.350) * (-1163.223) (-1169.097) (-1162.750) [-1175.212] -- 0:00:55
Average standard deviation of split frequencies: 0.034046
35500 -- (-1163.532) (-1171.643) (-1165.014) [-1172.042] * (-1169.206) (-1170.639) [-1164.070] (-1169.117) -- 0:00:54
36000 -- (-1164.370) (-1170.050) (-1166.403) [-1166.428] * (-1164.672) [-1167.151] (-1162.580) (-1184.573) -- 0:00:53
36500 -- [-1163.566] (-1168.254) (-1163.933) (-1170.790) * (-1161.805) [-1170.754] (-1162.299) (-1179.495) -- 0:00:52
37000 -- (-1162.778) [-1166.674] (-1161.514) (-1169.259) * (-1161.347) [-1170.887] (-1162.636) (-1171.754) -- 0:00:52
37500 -- (-1162.941) [-1169.812] (-1162.540) (-1169.765) * (-1161.192) [-1165.600] (-1163.278) (-1163.360) -- 0:00:51
38000 -- (-1163.951) (-1173.080) (-1168.131) [-1169.218] * (-1161.689) (-1166.378) [-1164.564] (-1163.392) -- 0:01:15
38500 -- [-1163.321] (-1171.256) (-1166.424) (-1167.524) * (-1164.486) (-1166.321) (-1163.844) [-1162.218] -- 0:01:14
39000 -- (-1161.960) (-1175.609) [-1166.454] (-1169.434) * (-1162.595) [-1168.538] (-1164.420) (-1164.575) -- 0:01:13
39500 -- (-1161.995) [-1168.123] (-1163.192) (-1176.377) * [-1161.095] (-1171.305) (-1165.289) (-1164.854) -- 0:01:12
40000 -- (-1163.433) (-1171.072) (-1161.827) [-1171.166] * (-1163.642) (-1168.020) (-1164.385) [-1165.124] -- 0:01:12
Average standard deviation of split frequencies: 0.039413
40500 -- (-1162.467) (-1173.077) (-1161.443) [-1170.075] * [-1163.407] (-1169.383) (-1163.893) (-1169.042) -- 0:01:11
41000 -- (-1162.761) [-1164.654] (-1161.378) (-1166.948) * (-1163.188) (-1165.034) (-1165.898) [-1168.706] -- 0:01:10
41500 -- (-1167.780) [-1167.670] (-1161.664) (-1168.473) * (-1166.169) (-1167.895) [-1163.070] (-1165.069) -- 0:01:09
42000 -- (-1164.114) (-1172.819) (-1162.444) [-1169.388] * (-1164.422) [-1171.173] (-1165.000) (-1165.230) -- 0:01:08
42500 -- (-1163.573) [-1161.822] (-1162.372) (-1172.971) * (-1163.473) (-1170.475) (-1162.572) [-1166.916] -- 0:01:07
43000 -- (-1164.089) (-1161.410) [-1165.640] (-1167.231) * (-1163.548) (-1173.424) (-1166.412) [-1164.951] -- 0:01:06
43500 -- (-1161.614) (-1162.231) (-1170.588) [-1170.436] * [-1166.237] (-1171.507) (-1163.571) (-1161.710) -- 0:01:05
44000 -- [-1161.692] (-1162.146) (-1166.169) (-1172.938) * (-1165.926) (-1168.155) [-1162.637] (-1166.386) -- 0:01:05
44500 -- (-1161.509) [-1162.111] (-1166.839) (-1171.852) * (-1166.031) (-1171.672) (-1164.811) [-1162.882] -- 0:01:04
45000 -- (-1161.997) (-1165.857) [-1163.001] (-1167.438) * (-1166.031) [-1169.211] (-1162.847) (-1174.828) -- 0:01:03
Average standard deviation of split frequencies: 0.047140
45500 -- (-1162.133) (-1164.597) (-1163.204) [-1173.101] * (-1165.343) [-1169.143] (-1163.912) (-1164.395) -- 0:01:02
46000 -- (-1162.919) (-1163.397) (-1166.428) [-1169.951] * (-1164.120) (-1172.717) [-1163.147] (-1163.497) -- 0:01:02
46500 -- [-1162.620] (-1163.507) (-1163.919) (-1169.984) * (-1161.751) (-1174.419) [-1165.075] (-1164.198) -- 0:01:01
47000 -- (-1162.557) [-1162.861] (-1162.468) (-1167.025) * (-1160.778) [-1167.175] (-1163.446) (-1163.893) -- 0:01:00
47500 -- (-1162.934) (-1163.395) [-1161.241] (-1171.893) * (-1163.435) (-1171.006) (-1165.929) [-1164.502] -- 0:01:00
48000 -- (-1162.321) [-1162.725] (-1161.744) (-1174.805) * (-1163.154) (-1178.043) (-1161.421) [-1170.488] -- 0:00:59
48500 -- [-1162.439] (-1168.860) (-1162.282) (-1167.897) * (-1167.693) (-1170.247) (-1161.686) [-1162.837] -- 0:00:58
49000 -- (-1164.804) (-1164.226) [-1161.839] (-1165.292) * (-1169.362) (-1177.794) [-1162.531] (-1162.135) -- 0:00:58
49500 -- [-1161.703] (-1163.814) (-1161.537) (-1165.174) * (-1163.741) (-1172.197) (-1161.824) [-1161.164] -- 0:00:57
50000 -- [-1162.929] (-1162.559) (-1162.531) (-1163.764) * (-1163.907) (-1170.126) [-1162.630] (-1165.252) -- 0:00:57
Average standard deviation of split frequencies: 0.050242
50500 -- (-1164.769) (-1163.208) (-1162.299) [-1162.960] * [-1161.437] (-1166.468) (-1162.254) (-1164.285) -- 0:00:56
51000 -- [-1163.549] (-1162.043) (-1164.911) (-1162.630) * [-1162.155] (-1173.647) (-1162.624) (-1165.578) -- 0:00:55
51500 -- [-1162.388] (-1177.454) (-1163.992) (-1161.938) * (-1162.464) [-1173.840] (-1169.110) (-1162.754) -- 0:00:55
52000 -- [-1161.547] (-1173.307) (-1163.174) (-1163.298) * (-1164.627) (-1172.663) (-1170.857) [-1162.401] -- 0:00:54
52500 -- (-1165.038) (-1168.678) [-1162.764] (-1164.162) * (-1162.827) [-1169.993] (-1165.521) (-1162.422) -- 0:00:54
53000 -- (-1162.429) (-1168.576) [-1163.429] (-1161.986) * (-1166.018) (-1167.340) (-1164.819) [-1164.403] -- 0:00:53
53500 -- (-1163.118) (-1166.571) [-1162.507] (-1164.426) * [-1162.591] (-1171.545) (-1164.106) (-1164.044) -- 0:01:10
54000 -- (-1162.907) (-1166.469) (-1164.269) [-1163.906] * (-1164.501) (-1171.877) (-1164.866) [-1167.159] -- 0:01:10
54500 -- (-1162.482) (-1164.045) (-1163.902) [-1162.272] * (-1165.142) [-1165.938] (-1163.076) (-1161.603) -- 0:01:09
55000 -- [-1162.037] (-1165.106) (-1163.627) (-1161.353) * (-1162.871) (-1174.835) (-1163.092) [-1162.690] -- 0:01:08
Average standard deviation of split frequencies: 0.047140
55500 -- (-1162.144) [-1161.563] (-1164.548) (-1162.234) * [-1161.932] (-1166.502) (-1163.285) (-1163.728) -- 0:01:08
56000 -- [-1162.443] (-1164.770) (-1162.511) (-1162.270) * (-1162.136) (-1171.861) [-1163.544] (-1164.669) -- 0:01:07
56500 -- (-1162.831) (-1165.668) (-1164.653) [-1161.907] * [-1161.942] (-1170.571) (-1163.633) (-1165.427) -- 0:01:06
57000 -- (-1163.272) (-1166.350) [-1162.455] (-1162.688) * (-1161.230) (-1172.888) [-1164.476] (-1165.718) -- 0:01:06
57500 -- (-1161.886) [-1162.176] (-1162.906) (-1163.772) * [-1161.276] (-1167.625) (-1164.334) (-1161.727) -- 0:01:05
58000 -- [-1161.515] (-1163.258) (-1161.428) (-1164.196) * (-1163.626) (-1177.598) (-1162.406) [-1163.032] -- 0:01:04
58500 -- (-1165.334) (-1164.375) [-1166.497] (-1162.820) * [-1162.959] (-1183.076) (-1166.954) (-1165.327) -- 0:01:04
59000 -- (-1167.521) (-1163.984) (-1167.846) [-1162.393] * (-1161.006) (-1163.204) (-1163.628) [-1165.594] -- 0:01:03
59500 -- (-1169.435) (-1161.521) [-1163.902] (-1162.744) * (-1163.224) (-1167.116) (-1166.402) [-1162.948] -- 0:01:03
60000 -- (-1166.811) [-1161.140] (-1161.712) (-1165.405) * (-1163.822) (-1164.739) [-1169.655] (-1161.453) -- 0:01:02
Average standard deviation of split frequencies: 0.038852
60500 -- (-1161.123) (-1163.732) [-1162.328] (-1165.040) * (-1161.709) (-1163.269) (-1162.587) [-1161.357] -- 0:01:02
61000 -- [-1162.502] (-1163.035) (-1162.996) (-1163.305) * (-1165.810) [-1166.598] (-1166.362) (-1161.561) -- 0:01:01
61500 -- (-1162.083) (-1161.859) [-1165.311] (-1165.982) * [-1163.592] (-1162.561) (-1167.021) (-1162.713) -- 0:01:01
62000 -- [-1162.174] (-1162.782) (-1164.479) (-1164.704) * [-1163.477] (-1162.297) (-1162.471) (-1164.555) -- 0:01:00
62500 -- [-1161.954] (-1167.646) (-1163.078) (-1162.738) * [-1165.176] (-1162.131) (-1162.806) (-1161.218) -- 0:01:00
63000 -- (-1161.949) (-1165.352) [-1162.487] (-1163.514) * (-1164.870) [-1162.356] (-1162.153) (-1164.875) -- 0:00:59
63500 -- (-1161.373) (-1166.057) (-1162.922) [-1163.730] * [-1162.735] (-1162.184) (-1165.782) (-1172.118) -- 0:00:58
64000 -- (-1161.987) (-1164.189) [-1164.358] (-1163.729) * [-1165.656] (-1161.835) (-1166.762) (-1170.929) -- 0:00:58
64500 -- [-1161.058] (-1162.596) (-1166.823) (-1166.609) * (-1161.599) (-1164.840) [-1162.158] (-1170.994) -- 0:00:58
65000 -- (-1164.629) (-1164.602) [-1163.377] (-1165.194) * (-1160.926) (-1163.057) (-1162.347) [-1169.874] -- 0:00:57
Average standard deviation of split frequencies: 0.037141
65500 -- [-1161.592] (-1164.545) (-1163.375) (-1165.677) * (-1162.240) (-1164.286) (-1163.175) [-1165.722] -- 0:00:57
66000 -- (-1163.327) (-1164.127) [-1163.391] (-1166.740) * [-1163.373] (-1162.093) (-1163.173) (-1166.283) -- 0:00:56
66500 -- (-1162.680) [-1167.631] (-1162.608) (-1164.531) * [-1163.776] (-1162.168) (-1162.141) (-1165.376) -- 0:00:56
67000 -- [-1169.765] (-1165.570) (-1162.337) (-1163.896) * (-1166.000) [-1161.761] (-1164.081) (-1166.133) -- 0:00:55
67500 -- (-1166.077) (-1163.178) (-1162.741) [-1163.910] * (-1165.422) (-1163.492) (-1162.889) [-1162.867] -- 0:00:55
68000 -- (-1162.914) (-1165.165) (-1163.895) [-1164.846] * (-1162.320) [-1163.389] (-1162.941) (-1163.098) -- 0:00:54
68500 -- (-1162.921) (-1163.437) (-1162.887) [-1163.874] * (-1161.252) (-1161.422) [-1163.065] (-1163.516) -- 0:00:54
69000 -- (-1162.730) [-1161.700] (-1164.130) (-1161.490) * (-1163.518) [-1166.497] (-1161.816) (-1164.885) -- 0:00:53
69500 -- (-1162.226) [-1161.934] (-1164.347) (-1162.443) * (-1162.428) (-1166.016) [-1161.426] (-1162.883) -- 0:00:53
70000 -- (-1164.400) (-1161.913) (-1164.031) [-1162.134] * (-1166.163) (-1163.152) (-1162.182) [-1161.334] -- 0:00:53
Average standard deviation of split frequencies: 0.040025
70500 -- [-1162.648] (-1160.895) (-1165.702) (-1163.104) * (-1164.890) (-1161.256) [-1161.893] (-1163.574) -- 0:00:52
71000 -- (-1164.053) [-1161.273] (-1161.894) (-1161.745) * (-1162.458) [-1161.434] (-1166.119) (-1165.042) -- 0:01:05
71500 -- (-1165.097) [-1161.313] (-1162.984) (-1162.890) * (-1162.035) (-1162.771) (-1162.106) [-1161.435] -- 0:01:04
72000 -- (-1164.636) [-1161.474] (-1162.982) (-1163.148) * (-1164.853) (-1161.568) [-1161.558] (-1161.616) -- 0:01:04
72500 -- (-1165.073) (-1161.273) [-1166.494] (-1161.792) * (-1162.378) (-1161.213) (-1165.660) [-1163.207] -- 0:01:03
73000 -- [-1164.743] (-1163.846) (-1167.157) (-1164.662) * (-1165.077) [-1160.882] (-1164.484) (-1162.714) -- 0:01:03
73500 -- (-1164.401) [-1166.339] (-1163.982) (-1164.771) * (-1162.634) [-1162.434] (-1163.606) (-1162.832) -- 0:01:03
74000 -- (-1163.070) (-1162.754) [-1162.583] (-1166.506) * [-1162.836] (-1162.905) (-1166.460) (-1163.746) -- 0:01:02
74500 -- (-1163.724) (-1165.976) [-1161.664] (-1161.810) * (-1162.548) [-1163.402] (-1162.945) (-1162.021) -- 0:01:02
75000 -- (-1161.470) (-1162.488) [-1161.036] (-1162.833) * (-1164.475) [-1162.355] (-1164.225) (-1165.979) -- 0:01:01
Average standard deviation of split frequencies: 0.044659
75500 -- (-1161.827) [-1163.935] (-1161.315) (-1161.230) * (-1161.019) (-1162.729) [-1161.650] (-1163.188) -- 0:01:01
76000 -- (-1163.004) (-1161.651) (-1164.488) [-1162.112] * (-1165.481) (-1165.496) [-1163.948] (-1163.907) -- 0:01:00
76500 -- (-1161.671) [-1163.002] (-1163.320) (-1161.433) * (-1164.685) [-1164.949] (-1162.928) (-1162.275) -- 0:01:00
77000 -- (-1161.992) (-1163.424) [-1163.197] (-1163.587) * (-1165.836) (-1164.384) (-1164.331) [-1165.575] -- 0:00:59
77500 -- (-1162.807) [-1164.817] (-1163.844) (-1163.921) * [-1163.519] (-1164.836) (-1163.332) (-1164.592) -- 0:00:59
78000 -- [-1161.731] (-1163.652) (-1164.165) (-1164.041) * [-1163.411] (-1161.866) (-1161.797) (-1161.225) -- 0:00:59
78500 -- [-1161.738] (-1166.202) (-1161.593) (-1167.263) * (-1164.170) (-1162.665) (-1162.211) [-1162.982] -- 0:00:58
79000 -- (-1161.096) (-1166.568) [-1162.884] (-1162.622) * (-1166.074) (-1164.128) (-1163.577) [-1163.475] -- 0:00:58
79500 -- (-1161.101) (-1165.686) (-1161.912) [-1161.630] * [-1164.297] (-1160.925) (-1162.359) (-1161.574) -- 0:00:57
80000 -- [-1161.373] (-1162.894) (-1161.282) (-1163.158) * (-1163.719) [-1162.351] (-1162.251) (-1163.162) -- 0:00:57
Average standard deviation of split frequencies: 0.044413
80500 -- (-1160.696) (-1162.426) [-1161.276] (-1162.465) * (-1167.407) [-1162.647] (-1163.514) (-1161.232) -- 0:00:57
81000 -- [-1160.985] (-1164.718) (-1166.717) (-1161.974) * (-1164.020) [-1161.836] (-1161.964) (-1161.278) -- 0:00:56
81500 -- [-1162.664] (-1162.334) (-1163.208) (-1162.135) * (-1164.937) [-1162.484] (-1162.602) (-1161.336) -- 0:00:56
82000 -- (-1162.793) (-1162.251) (-1161.935) [-1162.575] * [-1166.602] (-1162.973) (-1160.791) (-1161.157) -- 0:00:55
82500 -- (-1162.600) (-1162.795) (-1161.114) [-1164.822] * [-1165.626] (-1162.491) (-1162.801) (-1161.157) -- 0:00:55
83000 -- [-1162.655] (-1162.993) (-1165.299) (-1161.918) * (-1161.763) [-1161.436] (-1165.208) (-1161.152) -- 0:00:55
83500 -- (-1162.417) (-1166.015) (-1165.656) [-1161.706] * (-1166.185) (-1161.342) [-1170.633] (-1165.710) -- 0:00:54
84000 -- (-1161.734) (-1165.828) (-1166.107) [-1161.706] * (-1168.306) [-1162.562] (-1165.570) (-1165.534) -- 0:00:54
84500 -- [-1161.062] (-1166.916) (-1161.957) (-1161.619) * [-1163.653] (-1160.819) (-1166.219) (-1162.850) -- 0:00:54
85000 -- (-1162.463) (-1163.686) [-1164.414] (-1162.654) * (-1166.280) [-1161.592] (-1163.980) (-1162.408) -- 0:00:53
Average standard deviation of split frequencies: 0.043852
85500 -- (-1161.994) [-1164.411] (-1162.696) (-1163.696) * [-1164.526] (-1162.213) (-1164.992) (-1161.690) -- 0:00:53
86000 -- (-1164.192) (-1165.146) [-1164.178] (-1163.562) * (-1166.124) [-1162.173] (-1162.728) (-1162.326) -- 0:00:53
86500 -- [-1161.785] (-1163.575) (-1165.753) (-1162.090) * (-1165.205) (-1160.981) (-1164.721) [-1164.474] -- 0:00:52
87000 -- [-1162.774] (-1165.689) (-1163.183) (-1163.929) * (-1166.517) (-1162.962) (-1165.021) [-1162.404] -- 0:00:52
87500 -- [-1161.836] (-1162.318) (-1162.695) (-1161.500) * [-1162.176] (-1162.803) (-1164.209) (-1162.315) -- 0:01:02
88000 -- (-1167.388) [-1163.907] (-1162.387) (-1170.573) * (-1162.276) [-1162.006] (-1166.695) (-1162.929) -- 0:01:02
88500 -- (-1170.921) (-1166.352) [-1162.083] (-1164.095) * (-1162.605) [-1162.005] (-1161.986) (-1165.807) -- 0:01:01
89000 -- (-1165.407) (-1166.774) (-1165.158) [-1163.382] * (-1162.298) [-1161.948] (-1161.568) (-1170.178) -- 0:01:01
89500 -- (-1166.580) [-1161.775] (-1164.676) (-1162.356) * (-1162.392) [-1164.243] (-1162.557) (-1164.385) -- 0:01:01
90000 -- (-1163.852) (-1161.343) [-1163.003] (-1164.547) * (-1164.196) (-1161.324) (-1166.842) [-1164.175] -- 0:01:00
Average standard deviation of split frequencies: 0.040555
90500 -- (-1164.996) (-1162.379) [-1161.392] (-1164.975) * (-1162.690) (-1160.824) (-1167.413) [-1164.401] -- 0:01:00
91000 -- [-1163.712] (-1162.075) (-1161.669) (-1165.451) * (-1163.098) (-1160.855) [-1162.056] (-1163.612) -- 0:00:59
91500 -- [-1163.536] (-1163.241) (-1163.492) (-1164.219) * (-1165.317) (-1160.734) [-1162.307] (-1163.172) -- 0:00:59
92000 -- [-1162.960] (-1163.241) (-1162.056) (-1162.519) * (-1160.794) (-1160.715) [-1161.184] (-1165.019) -- 0:00:59
92500 -- (-1162.605) (-1164.451) (-1164.418) [-1164.534] * (-1161.370) (-1162.370) [-1161.175] (-1163.611) -- 0:00:58
93000 -- [-1163.493] (-1163.788) (-1162.996) (-1164.452) * (-1161.355) (-1164.607) [-1161.975] (-1162.954) -- 0:00:58
93500 -- (-1168.057) (-1163.078) (-1167.150) [-1163.025] * [-1164.849] (-1161.305) (-1162.782) (-1163.935) -- 0:00:58
94000 -- [-1164.236] (-1162.471) (-1165.798) (-1164.717) * (-1164.904) (-1160.939) (-1165.426) [-1165.174] -- 0:00:57
94500 -- (-1161.044) (-1163.546) [-1164.654] (-1163.565) * (-1167.591) (-1161.866) [-1163.530] (-1163.424) -- 0:00:57
95000 -- (-1163.577) [-1163.680] (-1161.707) (-1165.077) * (-1165.453) [-1161.866] (-1164.267) (-1163.827) -- 0:00:57
Average standard deviation of split frequencies: 0.035355
95500 -- (-1163.962) (-1164.520) [-1163.746] (-1163.846) * (-1163.055) (-1164.168) (-1164.087) [-1163.567] -- 0:00:56
96000 -- (-1168.299) (-1165.137) (-1161.401) [-1163.970] * (-1162.245) (-1162.252) [-1164.801] (-1166.574) -- 0:00:56
96500 -- (-1163.661) [-1165.371] (-1164.187) (-1165.954) * (-1161.630) (-1163.612) (-1174.383) [-1162.393] -- 0:00:56
97000 -- (-1161.957) [-1163.716] (-1162.654) (-1165.892) * [-1162.875] (-1164.434) (-1167.735) (-1166.183) -- 0:00:55
97500 -- (-1161.071) [-1161.792] (-1161.371) (-1166.026) * (-1163.245) (-1164.284) [-1164.259] (-1164.775) -- 0:00:55
98000 -- (-1162.093) (-1161.472) (-1163.615) [-1165.871] * (-1164.632) [-1162.215] (-1168.365) (-1164.536) -- 0:00:55
98500 -- (-1163.858) (-1161.858) [-1163.215] (-1171.583) * (-1164.937) (-1163.460) (-1170.114) [-1162.628] -- 0:00:54
99000 -- [-1162.452] (-1161.148) (-1163.213) (-1169.695) * (-1163.998) [-1162.430] (-1167.637) (-1164.851) -- 0:00:54
99500 -- [-1161.949] (-1162.938) (-1162.646) (-1161.760) * (-1168.282) (-1162.663) [-1164.192] (-1168.073) -- 0:00:54
100000 -- (-1161.366) (-1166.188) [-1161.641] (-1161.178) * (-1165.469) (-1166.301) (-1162.704) [-1163.052] -- 0:00:54
Average standard deviation of split frequencies: 0.035589
100500 -- (-1161.631) (-1168.219) (-1161.397) [-1161.131] * (-1163.064) [-1163.614] (-1162.580) (-1164.819) -- 0:00:53
101000 -- [-1161.875] (-1164.167) (-1161.067) (-1161.461) * (-1163.062) (-1168.013) (-1162.106) [-1161.545] -- 0:00:53
101500 -- [-1162.716] (-1163.710) (-1160.969) (-1162.501) * (-1163.796) [-1164.331] (-1162.797) (-1161.948) -- 0:00:53
102000 -- [-1162.817] (-1161.723) (-1160.969) (-1163.674) * [-1161.787] (-1165.868) (-1162.107) (-1161.689) -- 0:00:52
102500 -- (-1164.934) (-1162.566) [-1163.777] (-1166.711) * (-1161.232) (-1165.290) [-1161.985] (-1163.215) -- 0:00:52
103000 -- [-1165.265] (-1161.653) (-1165.544) (-1162.918) * (-1163.822) (-1165.208) [-1162.021] (-1164.065) -- 0:00:52
103500 -- (-1164.432) [-1161.651] (-1161.580) (-1161.311) * (-1162.804) (-1165.242) (-1164.403) [-1164.689] -- 0:00:51
104000 -- (-1164.207) (-1161.543) (-1162.865) [-1163.256] * [-1163.210] (-1167.054) (-1165.806) (-1163.173) -- 0:00:51
104500 -- (-1163.223) [-1161.797] (-1160.971) (-1162.022) * [-1161.623] (-1164.965) (-1161.618) (-1161.416) -- 0:00:59
105000 -- (-1162.852) (-1162.853) (-1161.404) [-1163.677] * (-1161.269) [-1162.095] (-1164.930) (-1161.591) -- 0:00:59
Average standard deviation of split frequencies: 0.031130
105500 -- (-1162.989) [-1162.597] (-1162.006) (-1161.920) * (-1164.065) [-1162.085] (-1161.929) (-1161.362) -- 0:00:59
106000 -- (-1164.166) (-1162.296) (-1162.227) [-1162.217] * (-1163.346) (-1161.897) (-1162.045) [-1162.517] -- 0:00:59
106500 -- [-1166.376] (-1161.623) (-1163.303) (-1169.182) * (-1166.893) [-1162.566] (-1161.992) (-1162.905) -- 0:00:58
107000 -- [-1161.718] (-1162.668) (-1162.332) (-1164.418) * (-1164.923) (-1164.405) [-1162.585] (-1163.226) -- 0:00:58
107500 -- [-1163.118] (-1164.763) (-1161.504) (-1165.971) * (-1163.018) (-1163.116) (-1164.757) [-1163.161] -- 0:00:58
108000 -- (-1162.852) (-1161.135) [-1161.506] (-1166.665) * [-1163.019] (-1163.003) (-1165.340) (-1163.666) -- 0:00:57
108500 -- [-1161.072] (-1166.923) (-1164.869) (-1163.770) * (-1167.693) (-1164.147) (-1165.949) [-1162.570] -- 0:00:57
109000 -- (-1161.119) [-1164.044] (-1162.074) (-1164.711) * (-1161.789) (-1166.133) [-1163.465] (-1162.170) -- 0:00:57
109500 -- [-1161.113] (-1161.720) (-1163.999) (-1164.511) * (-1163.662) (-1166.149) [-1161.906] (-1161.829) -- 0:00:56
110000 -- (-1163.524) [-1161.587] (-1164.276) (-1162.632) * [-1161.928] (-1162.865) (-1161.202) (-1161.462) -- 0:00:56
Average standard deviation of split frequencies: 0.031522
110500 -- (-1162.916) [-1163.142] (-1163.818) (-1163.246) * (-1161.596) (-1161.760) (-1162.046) [-1166.413] -- 0:00:56
111000 -- (-1162.256) (-1162.783) [-1164.680] (-1162.780) * (-1163.318) (-1165.232) [-1164.791] (-1166.184) -- 0:00:56
111500 -- (-1163.648) (-1161.015) (-1164.936) [-1163.204] * [-1163.732] (-1164.049) (-1165.153) (-1166.478) -- 0:00:55
112000 -- [-1161.089] (-1162.024) (-1165.425) (-1161.299) * [-1161.596] (-1163.205) (-1166.597) (-1165.405) -- 0:00:55
112500 -- [-1163.162] (-1162.468) (-1166.103) (-1162.422) * (-1164.224) [-1162.518] (-1165.983) (-1164.789) -- 0:00:55
113000 -- (-1165.653) (-1163.421) (-1163.934) [-1161.904] * (-1166.664) (-1163.060) [-1165.072] (-1163.647) -- 0:00:54
113500 -- [-1164.339] (-1161.593) (-1164.558) (-1161.425) * (-1165.170) (-1163.900) [-1164.004] (-1162.920) -- 0:00:54
114000 -- (-1163.563) [-1167.392] (-1168.455) (-1163.214) * (-1164.540) (-1163.792) [-1163.754] (-1163.392) -- 0:00:54
114500 -- (-1163.990) [-1164.197] (-1167.926) (-1163.798) * (-1164.589) (-1163.257) (-1165.311) [-1162.020] -- 0:00:54
115000 -- (-1161.831) (-1163.794) (-1163.128) [-1168.175] * (-1164.348) [-1162.275] (-1164.346) (-1161.076) -- 0:00:53
Average standard deviation of split frequencies: 0.027634
115500 -- (-1166.401) (-1164.265) [-1162.242] (-1165.230) * (-1162.670) (-1162.378) [-1163.750] (-1163.430) -- 0:00:53
116000 -- (-1161.857) (-1161.382) (-1162.876) [-1162.782] * (-1163.431) (-1163.338) [-1162.262] (-1161.913) -- 0:00:53
116500 -- [-1163.656] (-1162.136) (-1164.513) (-1164.603) * (-1163.323) [-1162.731] (-1168.529) (-1161.077) -- 0:00:53
117000 -- (-1161.500) (-1162.815) [-1168.375] (-1163.063) * (-1164.196) (-1165.303) (-1170.132) [-1163.584] -- 0:00:52
117500 -- (-1163.405) [-1161.945] (-1166.356) (-1161.461) * [-1164.826] (-1161.968) (-1165.315) (-1162.820) -- 0:00:52
118000 -- (-1164.011) (-1161.661) [-1168.230] (-1163.066) * (-1164.629) (-1161.649) (-1164.731) [-1161.582] -- 0:00:52
118500 -- (-1162.674) (-1161.895) (-1164.342) [-1165.169] * [-1162.691] (-1164.105) (-1167.565) (-1162.108) -- 0:00:52
119000 -- (-1163.821) (-1163.998) [-1165.984] (-1163.392) * (-1163.415) [-1163.204] (-1166.165) (-1163.281) -- 0:00:51
119500 -- (-1165.202) [-1162.078] (-1162.700) (-1168.036) * [-1161.322] (-1165.269) (-1163.810) (-1163.787) -- 0:00:51
120000 -- [-1163.241] (-1167.545) (-1165.036) (-1170.545) * (-1163.261) [-1162.422] (-1161.223) (-1163.161) -- 0:00:51
Average standard deviation of split frequencies: 0.029691
120500 -- (-1164.463) (-1165.431) (-1164.925) [-1163.657] * [-1161.208] (-1164.875) (-1161.404) (-1161.908) -- 0:00:58
121000 -- [-1161.776] (-1162.289) (-1166.922) (-1165.152) * (-1161.181) (-1167.329) [-1161.077] (-1165.269) -- 0:00:58
121500 -- (-1162.173) (-1163.565) (-1162.083) [-1162.434] * (-1165.803) (-1164.213) [-1162.368] (-1162.631) -- 0:00:57
122000 -- [-1163.036] (-1163.141) (-1162.547) (-1163.020) * (-1167.316) [-1162.841] (-1161.413) (-1162.862) -- 0:00:57
122500 -- (-1161.217) (-1163.112) (-1163.095) [-1163.100] * (-1165.979) [-1164.175] (-1163.247) (-1163.246) -- 0:00:57
123000 -- (-1163.342) (-1165.516) (-1165.179) [-1161.928] * [-1165.026] (-1165.117) (-1165.071) (-1162.779) -- 0:00:57
123500 -- [-1169.727] (-1162.876) (-1162.315) (-1162.662) * [-1163.703] (-1166.087) (-1165.353) (-1162.577) -- 0:00:56
124000 -- [-1161.852] (-1161.924) (-1162.793) (-1163.828) * (-1163.628) (-1162.451) [-1164.391] (-1162.730) -- 0:00:56
124500 -- (-1162.774) [-1162.731] (-1167.510) (-1163.306) * (-1164.968) (-1161.510) [-1161.274] (-1161.408) -- 0:00:56
125000 -- (-1161.775) (-1164.963) (-1164.355) [-1164.862] * (-1165.154) (-1162.442) [-1161.637] (-1162.198) -- 0:00:56
Average standard deviation of split frequencies: 0.032175
125500 -- (-1161.926) (-1162.725) [-1162.056] (-1164.764) * (-1165.226) (-1161.643) (-1162.150) [-1161.381] -- 0:00:55
126000 -- (-1163.332) [-1162.719] (-1164.814) (-1167.660) * (-1164.555) [-1161.559] (-1163.220) (-1161.596) -- 0:00:55
126500 -- [-1161.536] (-1161.787) (-1163.905) (-1163.760) * (-1165.076) [-1161.030] (-1161.896) (-1166.364) -- 0:00:55
127000 -- (-1162.256) [-1161.682] (-1161.252) (-1163.133) * (-1168.211) [-1161.752] (-1163.372) (-1161.464) -- 0:00:54
127500 -- (-1163.315) [-1161.764] (-1161.565) (-1166.513) * [-1161.122] (-1161.111) (-1163.231) (-1161.838) -- 0:00:54
128000 -- (-1161.645) [-1162.060] (-1162.727) (-1163.141) * (-1161.576) (-1162.161) (-1164.053) [-1161.315] -- 0:00:54
128500 -- (-1169.556) (-1162.959) (-1161.826) [-1163.366] * [-1161.548] (-1162.473) (-1164.332) (-1163.378) -- 0:00:54
129000 -- (-1163.200) [-1163.124] (-1162.118) (-1163.299) * (-1161.511) (-1162.057) [-1162.558] (-1164.030) -- 0:00:54
129500 -- (-1162.413) (-1162.794) (-1164.500) [-1163.077] * [-1165.139] (-1162.081) (-1166.804) (-1163.317) -- 0:00:53
130000 -- [-1161.321] (-1163.883) (-1162.087) (-1162.438) * [-1160.934] (-1162.966) (-1167.094) (-1163.860) -- 0:00:53
Average standard deviation of split frequencies: 0.030305
130500 -- (-1164.849) (-1164.940) (-1161.594) [-1161.044] * [-1161.432] (-1162.090) (-1163.173) (-1161.627) -- 0:00:53
131000 -- (-1166.938) (-1166.323) (-1161.838) [-1161.232] * (-1164.033) (-1162.220) (-1161.540) [-1161.973] -- 0:00:53
131500 -- (-1164.628) (-1165.200) (-1168.021) [-1162.113] * (-1161.404) [-1162.312] (-1162.856) (-1162.129) -- 0:00:52
132000 -- [-1164.856] (-1166.473) (-1164.560) (-1162.420) * (-1164.301) (-1167.324) (-1161.154) [-1161.091] -- 0:00:52
132500 -- [-1163.991] (-1165.144) (-1161.496) (-1163.468) * (-1162.525) (-1163.063) (-1161.163) [-1162.556] -- 0:00:52
133000 -- [-1165.723] (-1167.382) (-1166.042) (-1164.003) * (-1161.278) (-1164.819) (-1161.841) [-1163.632] -- 0:00:52
133500 -- (-1164.596) (-1164.171) [-1164.519] (-1163.310) * (-1161.351) (-1163.899) (-1162.891) [-1165.902] -- 0:00:51
134000 -- (-1163.807) [-1162.138] (-1167.745) (-1163.428) * (-1162.464) [-1164.252] (-1162.612) (-1167.589) -- 0:00:51
134500 -- (-1164.931) (-1162.967) (-1167.836) [-1163.725] * (-1162.270) [-1163.151] (-1163.323) (-1168.653) -- 0:00:51
135000 -- [-1165.129] (-1161.754) (-1167.627) (-1163.835) * (-1169.232) [-1164.225] (-1162.758) (-1165.537) -- 0:00:51
Average standard deviation of split frequencies: 0.030503
135500 -- (-1166.286) (-1162.576) [-1164.224] (-1165.362) * (-1162.900) [-1164.031] (-1162.518) (-1165.541) -- 0:00:51
136000 -- (-1165.767) (-1165.401) [-1163.226] (-1169.492) * (-1162.530) [-1163.087] (-1163.592) (-1164.394) -- 0:00:50
136500 -- (-1163.012) (-1164.264) (-1164.651) [-1165.285] * [-1162.138] (-1166.685) (-1162.062) (-1163.169) -- 0:00:56
137000 -- [-1161.966] (-1163.040) (-1167.006) (-1166.076) * (-1163.446) (-1163.247) (-1162.295) [-1163.308] -- 0:00:56
137500 -- [-1163.043] (-1166.232) (-1165.342) (-1163.896) * (-1166.123) (-1162.049) (-1162.796) [-1167.014] -- 0:00:56
138000 -- [-1162.377] (-1165.289) (-1164.998) (-1163.916) * (-1162.464) (-1165.510) (-1162.766) [-1165.669] -- 0:00:56
138500 -- (-1162.451) [-1163.364] (-1164.065) (-1161.595) * [-1161.640] (-1164.567) (-1162.999) (-1167.190) -- 0:00:55
139000 -- (-1162.544) (-1164.259) [-1161.419] (-1161.628) * (-1161.676) (-1165.470) [-1162.557] (-1166.061) -- 0:00:55
139500 -- [-1162.108] (-1160.816) (-1163.268) (-1162.961) * (-1161.162) (-1163.002) [-1163.912] (-1163.575) -- 0:00:55
140000 -- [-1161.132] (-1160.930) (-1162.864) (-1169.766) * (-1161.159) [-1163.616] (-1163.436) (-1169.128) -- 0:00:55
Average standard deviation of split frequencies: 0.030831
140500 -- (-1162.917) (-1160.930) [-1162.304] (-1164.022) * (-1161.904) (-1163.357) (-1163.215) [-1166.161] -- 0:00:55
141000 -- (-1161.081) [-1161.050] (-1162.309) (-1162.010) * (-1161.183) (-1163.459) [-1163.235] (-1167.734) -- 0:00:54
141500 -- (-1163.540) [-1161.277] (-1164.339) (-1162.425) * (-1163.001) [-1163.267] (-1166.033) (-1164.348) -- 0:00:54
142000 -- [-1161.149] (-1161.663) (-1164.520) (-1163.334) * (-1163.486) [-1161.099] (-1165.684) (-1167.512) -- 0:00:54
142500 -- (-1162.816) (-1162.507) (-1165.076) [-1163.178] * (-1162.577) (-1161.327) [-1162.280] (-1167.731) -- 0:00:54
143000 -- (-1162.962) [-1163.039] (-1164.761) (-1166.998) * (-1162.587) (-1163.772) [-1162.781] (-1167.455) -- 0:00:53
143500 -- [-1163.516] (-1165.604) (-1163.310) (-1164.989) * (-1163.712) (-1163.778) [-1161.983] (-1164.911) -- 0:00:53
144000 -- (-1160.885) (-1161.456) [-1162.860] (-1162.673) * [-1163.119] (-1162.586) (-1166.079) (-1163.070) -- 0:00:53
144500 -- (-1161.868) (-1161.456) [-1162.971] (-1161.159) * (-1163.715) (-1161.524) [-1166.058] (-1164.185) -- 0:00:53
145000 -- (-1161.425) [-1163.811] (-1161.050) (-1161.162) * (-1163.755) [-1161.719] (-1165.420) (-1162.195) -- 0:00:53
Average standard deviation of split frequencies: 0.027768
145500 -- (-1160.738) [-1166.357] (-1161.041) (-1169.578) * (-1164.347) (-1162.360) (-1164.300) [-1162.809] -- 0:00:52
146000 -- [-1162.456] (-1164.040) (-1165.755) (-1162.484) * (-1161.448) (-1162.869) (-1164.196) [-1162.037] -- 0:00:52
146500 -- (-1162.718) (-1165.212) (-1167.402) [-1163.554] * (-1161.670) (-1163.100) (-1161.933) [-1161.618] -- 0:00:52
147000 -- [-1162.677] (-1164.402) (-1166.563) (-1165.922) * (-1161.501) (-1164.502) (-1161.505) [-1164.803] -- 0:00:52
147500 -- (-1161.270) (-1166.708) (-1162.023) [-1162.271] * (-1163.608) [-1164.541] (-1162.455) (-1165.267) -- 0:00:52
148000 -- (-1163.965) (-1162.500) (-1161.278) [-1161.996] * [-1163.840] (-1164.578) (-1162.471) (-1164.815) -- 0:00:51
148500 -- (-1163.154) (-1161.530) (-1162.773) [-1164.830] * (-1162.662) (-1164.647) [-1164.411] (-1163.993) -- 0:00:51
149000 -- (-1162.986) (-1165.947) [-1161.662] (-1162.545) * [-1162.356] (-1163.942) (-1162.560) (-1164.552) -- 0:00:51
149500 -- (-1163.224) [-1163.756] (-1162.302) (-1162.958) * (-1161.925) (-1162.494) (-1162.538) [-1162.293] -- 0:00:51
150000 -- (-1165.632) (-1162.583) [-1164.157] (-1164.981) * (-1161.476) [-1161.996] (-1161.714) (-1161.852) -- 0:00:51
Average standard deviation of split frequencies: 0.027533
150500 -- (-1166.334) [-1163.445] (-1162.588) (-1163.719) * (-1163.127) (-1162.632) (-1161.572) [-1161.953] -- 0:00:50
151000 -- (-1167.227) (-1164.343) [-1161.386] (-1167.129) * (-1164.525) (-1165.688) [-1161.782] (-1162.875) -- 0:00:50
151500 -- (-1166.605) [-1162.539] (-1162.845) (-1165.753) * (-1163.169) (-1165.736) (-1165.465) [-1160.973] -- 0:00:50
152000 -- (-1166.750) (-1163.300) (-1161.590) [-1165.008] * (-1162.144) (-1167.298) (-1165.476) [-1162.755] -- 0:00:50
152500 -- (-1166.292) (-1165.004) [-1160.916] (-1170.403) * (-1163.915) (-1166.668) [-1162.238] (-1163.132) -- 0:00:50
153000 -- (-1166.003) (-1162.912) (-1161.952) [-1163.236] * (-1161.537) (-1165.620) [-1163.401] (-1166.122) -- 0:00:55
153500 -- (-1170.967) (-1164.292) [-1163.249] (-1161.550) * (-1161.928) (-1163.334) [-1164.989] (-1167.050) -- 0:00:55
154000 -- [-1164.085] (-1164.565) (-1164.024) (-1161.903) * (-1165.086) (-1163.978) (-1162.870) [-1166.403] -- 0:00:54
154500 -- (-1162.880) (-1163.701) (-1165.633) [-1163.804] * (-1162.841) (-1163.138) (-1163.008) [-1161.221] -- 0:00:54
155000 -- (-1165.409) [-1164.082] (-1163.564) (-1165.069) * [-1160.835] (-1162.636) (-1163.255) (-1161.212) -- 0:00:54
Average standard deviation of split frequencies: 0.028405
155500 -- (-1164.999) [-1161.951] (-1161.472) (-1164.545) * (-1162.563) (-1163.083) (-1163.270) [-1161.595] -- 0:00:54
156000 -- (-1164.838) [-1161.655] (-1163.672) (-1164.474) * (-1165.216) [-1166.276] (-1164.625) (-1164.164) -- 0:00:54
156500 -- (-1164.428) (-1163.103) [-1163.398] (-1162.863) * (-1161.892) (-1162.547) [-1165.495] (-1161.546) -- 0:00:53
157000 -- [-1164.626] (-1162.742) (-1163.383) (-1161.374) * (-1163.647) (-1163.076) [-1162.506] (-1163.002) -- 0:00:53
157500 -- (-1162.492) (-1162.664) [-1162.351] (-1161.416) * [-1166.634] (-1162.115) (-1163.395) (-1161.070) -- 0:00:53
158000 -- (-1161.664) (-1162.474) [-1162.242] (-1163.217) * (-1162.823) [-1162.603] (-1162.942) (-1160.994) -- 0:00:53
158500 -- (-1164.738) (-1162.034) [-1162.901] (-1163.773) * (-1161.927) (-1163.626) [-1161.173] (-1166.317) -- 0:00:53
159000 -- (-1167.577) [-1164.378] (-1165.054) (-1164.128) * (-1161.023) [-1162.269] (-1162.352) (-1161.852) -- 0:00:52
159500 -- (-1163.721) (-1168.636) (-1163.017) [-1164.990] * (-1161.524) (-1163.230) (-1164.158) [-1162.802] -- 0:00:52
160000 -- (-1161.843) (-1161.159) (-1162.720) [-1163.964] * [-1164.642] (-1162.776) (-1161.348) (-1160.898) -- 0:00:52
Average standard deviation of split frequencies: 0.025820
160500 -- (-1166.766) (-1162.407) (-1162.540) [-1161.382] * (-1164.046) [-1162.461] (-1161.800) (-1160.936) -- 0:00:52
161000 -- (-1165.956) (-1162.799) (-1163.137) [-1163.642] * (-1163.613) [-1162.354] (-1162.761) (-1163.008) -- 0:00:52
161500 -- (-1170.081) (-1161.666) [-1162.971] (-1162.338) * (-1162.396) [-1162.786] (-1164.839) (-1162.993) -- 0:00:51
162000 -- (-1165.477) [-1160.852] (-1162.700) (-1163.127) * [-1163.029] (-1163.766) (-1168.441) (-1161.321) -- 0:00:51
162500 -- (-1165.995) (-1161.501) (-1162.768) [-1161.337] * (-1161.198) (-1164.859) [-1167.736] (-1162.967) -- 0:00:51
163000 -- [-1163.909] (-1162.421) (-1162.141) (-1166.179) * (-1168.713) (-1163.446) (-1165.075) [-1163.993] -- 0:00:51
163500 -- [-1164.706] (-1162.349) (-1163.342) (-1163.807) * (-1169.180) (-1164.875) (-1164.588) [-1162.773] -- 0:00:51
164000 -- (-1161.684) (-1162.704) (-1166.229) [-1164.196] * (-1168.152) [-1169.170] (-1164.621) (-1164.697) -- 0:00:50
164500 -- (-1161.406) (-1162.713) [-1163.094] (-1161.857) * (-1166.477) (-1164.682) (-1163.661) [-1164.623] -- 0:00:50
165000 -- (-1161.384) (-1163.550) (-1163.478) [-1164.154] * [-1168.981] (-1167.832) (-1163.373) (-1166.384) -- 0:00:50
Average standard deviation of split frequencies: 0.025558
165500 -- (-1161.579) (-1165.877) (-1162.263) [-1163.909] * (-1166.783) (-1163.611) (-1161.829) [-1164.340] -- 0:00:50
166000 -- (-1162.827) (-1162.679) (-1171.074) [-1163.695] * (-1167.408) (-1163.989) (-1162.457) [-1162.732] -- 0:00:50
166500 -- [-1161.537] (-1162.693) (-1161.674) (-1163.258) * (-1167.378) [-1162.795] (-1167.406) (-1161.369) -- 0:00:50
167000 -- [-1163.697] (-1162.903) (-1162.371) (-1162.255) * (-1169.381) (-1162.477) [-1164.455] (-1163.686) -- 0:00:49
167500 -- (-1162.612) [-1162.963] (-1164.957) (-1163.323) * (-1164.655) (-1168.624) (-1164.654) [-1162.461] -- 0:00:49
168000 -- (-1163.029) [-1162.390] (-1165.861) (-1166.726) * [-1164.303] (-1162.455) (-1163.808) (-1162.574) -- 0:00:49
168500 -- [-1162.968] (-1161.972) (-1164.747) (-1165.588) * (-1167.493) [-1161.259] (-1164.165) (-1162.685) -- 0:00:49
169000 -- [-1162.536] (-1161.505) (-1162.862) (-1166.260) * [-1163.950] (-1161.972) (-1163.909) (-1164.129) -- 0:00:49
169500 -- [-1161.329] (-1161.740) (-1162.632) (-1165.289) * (-1163.077) [-1162.913] (-1162.408) (-1162.813) -- 0:00:48
170000 -- (-1162.690) [-1161.939] (-1162.294) (-1167.127) * (-1161.232) (-1166.003) [-1164.355] (-1162.502) -- 0:00:53
Average standard deviation of split frequencies: 0.024859
170500 -- [-1162.764] (-1165.265) (-1161.990) (-1163.050) * (-1162.190) (-1166.545) (-1163.696) [-1161.957] -- 0:00:53
171000 -- [-1162.712] (-1161.901) (-1168.692) (-1163.766) * [-1161.727] (-1163.116) (-1162.072) (-1165.038) -- 0:00:53
171500 -- (-1167.516) [-1162.569] (-1162.450) (-1162.303) * [-1162.041] (-1164.257) (-1161.567) (-1162.658) -- 0:00:53
172000 -- (-1164.148) [-1161.849] (-1163.145) (-1162.542) * [-1162.112] (-1164.243) (-1163.093) (-1163.417) -- 0:00:52
172500 -- (-1163.741) [-1161.900] (-1164.965) (-1163.444) * [-1163.484] (-1165.218) (-1162.816) (-1163.833) -- 0:00:52
173000 -- (-1166.322) (-1161.631) (-1161.749) [-1162.299] * (-1165.545) (-1163.306) (-1162.768) [-1161.395] -- 0:00:52
173500 -- [-1164.461] (-1163.072) (-1163.189) (-1165.843) * [-1161.326] (-1162.949) (-1162.182) (-1162.862) -- 0:00:52
174000 -- (-1162.057) (-1163.479) [-1163.128] (-1162.626) * (-1162.374) [-1164.120] (-1162.035) (-1167.256) -- 0:00:52
174500 -- [-1162.476] (-1162.219) (-1163.051) (-1163.419) * (-1161.849) [-1162.730] (-1162.035) (-1163.232) -- 0:00:52
175000 -- (-1162.743) [-1164.198] (-1166.050) (-1162.463) * [-1161.961] (-1163.263) (-1162.078) (-1162.389) -- 0:00:51
Average standard deviation of split frequencies: 0.025177
175500 -- [-1162.954] (-1163.110) (-1166.472) (-1163.646) * (-1163.056) (-1163.876) (-1162.613) [-1163.465] -- 0:00:51
176000 -- (-1165.032) (-1167.981) [-1162.402] (-1162.373) * (-1167.298) [-1164.578] (-1163.487) (-1164.790) -- 0:00:51
176500 -- (-1162.974) (-1165.724) (-1165.092) [-1162.645] * (-1162.620) (-1167.906) (-1162.721) [-1165.289] -- 0:00:51
177000 -- (-1165.836) (-1162.117) (-1163.756) [-1163.691] * (-1163.245) (-1168.050) (-1162.903) [-1163.651] -- 0:00:51
177500 -- (-1163.517) (-1162.617) (-1167.271) [-1163.230] * [-1163.241] (-1167.212) (-1163.620) (-1164.767) -- 0:00:50
178000 -- [-1164.332] (-1167.059) (-1163.161) (-1163.930) * (-1161.912) [-1163.162] (-1162.907) (-1166.024) -- 0:00:50
178500 -- (-1162.194) (-1164.931) [-1162.789] (-1163.713) * (-1162.686) (-1166.213) [-1163.475] (-1167.194) -- 0:00:50
179000 -- (-1165.624) (-1163.796) (-1162.867) [-1162.425] * (-1168.308) [-1162.677] (-1164.043) (-1163.712) -- 0:00:50
179500 -- (-1163.009) (-1162.659) (-1161.682) [-1164.355] * (-1167.231) (-1162.170) (-1162.137) [-1164.170] -- 0:00:50
180000 -- (-1165.455) (-1161.818) (-1162.412) [-1162.971] * (-1164.272) (-1165.773) (-1162.414) [-1162.485] -- 0:00:50
Average standard deviation of split frequencies: 0.020874
180500 -- [-1162.913] (-1162.106) (-1162.376) (-1162.841) * (-1164.353) (-1161.919) (-1162.479) [-1163.283] -- 0:00:49
181000 -- [-1165.016] (-1162.519) (-1163.648) (-1162.945) * (-1162.762) [-1163.250] (-1161.944) (-1162.897) -- 0:00:49
181500 -- [-1170.460] (-1163.829) (-1164.339) (-1164.237) * (-1161.843) (-1161.576) (-1163.521) [-1161.714] -- 0:00:49
182000 -- (-1163.843) [-1162.637] (-1163.841) (-1162.954) * [-1161.527] (-1161.997) (-1161.976) (-1164.524) -- 0:00:49
182500 -- (-1164.854) [-1164.394] (-1165.276) (-1163.578) * [-1164.046] (-1166.861) (-1163.176) (-1164.253) -- 0:00:49
183000 -- (-1166.486) (-1166.641) [-1165.054] (-1164.126) * [-1162.222] (-1162.156) (-1163.727) (-1165.587) -- 0:00:49
183500 -- (-1163.924) (-1163.333) [-1161.612] (-1163.693) * [-1161.097] (-1163.582) (-1165.404) (-1164.533) -- 0:00:48
184000 -- (-1164.235) (-1161.768) (-1167.532) [-1162.811] * (-1164.574) [-1163.903] (-1165.267) (-1164.384) -- 0:00:48
184500 -- (-1165.270) (-1161.347) [-1164.785] (-1164.434) * (-1164.453) (-1169.238) (-1164.950) [-1163.739] -- 0:00:48
185000 -- [-1163.468] (-1161.681) (-1164.432) (-1164.419) * (-1163.863) (-1163.817) [-1161.638] (-1166.822) -- 0:00:48
Average standard deviation of split frequencies: 0.019262
185500 -- (-1166.106) [-1162.156] (-1167.239) (-1166.491) * (-1161.316) (-1163.467) (-1161.631) [-1167.703] -- 0:00:48
186000 -- (-1162.643) [-1162.401] (-1167.406) (-1163.879) * [-1162.507] (-1162.619) (-1166.416) (-1165.196) -- 0:00:48
186500 -- (-1162.874) [-1163.704] (-1165.625) (-1162.854) * (-1162.111) [-1166.476] (-1163.783) (-1164.514) -- 0:00:47
187000 -- (-1163.256) (-1161.723) [-1163.190] (-1163.552) * (-1167.434) (-1166.653) (-1164.615) [-1164.099] -- 0:00:47
187500 -- (-1163.083) [-1164.135] (-1163.027) (-1165.117) * (-1163.568) (-1163.601) [-1164.547] (-1162.041) -- 0:00:52
188000 -- [-1163.444] (-1164.681) (-1165.179) (-1164.863) * (-1166.729) (-1163.311) (-1163.339) [-1161.896] -- 0:00:51
188500 -- [-1162.525] (-1169.444) (-1164.208) (-1163.415) * (-1163.450) [-1163.665] (-1164.907) (-1164.175) -- 0:00:51
189000 -- [-1161.310] (-1165.301) (-1162.168) (-1164.595) * (-1161.144) (-1161.629) [-1163.487] (-1163.960) -- 0:00:51
189500 -- (-1164.745) (-1165.014) [-1163.188] (-1164.597) * [-1161.941] (-1165.895) (-1162.362) (-1162.238) -- 0:00:51
190000 -- (-1161.373) [-1162.886] (-1163.721) (-1162.328) * (-1163.067) (-1166.674) (-1164.332) [-1161.809] -- 0:00:51
Average standard deviation of split frequencies: 0.018296
190500 -- [-1161.387] (-1167.329) (-1164.513) (-1162.722) * (-1162.084) (-1170.371) [-1163.582] (-1162.906) -- 0:00:50
191000 -- [-1161.457] (-1164.042) (-1163.779) (-1163.394) * [-1162.554] (-1162.345) (-1166.106) (-1163.134) -- 0:00:50
191500 -- [-1164.139] (-1165.075) (-1162.940) (-1167.630) * (-1162.850) (-1163.852) [-1165.053] (-1164.794) -- 0:00:50
192000 -- (-1162.406) (-1166.186) [-1161.224] (-1164.756) * [-1163.783] (-1163.707) (-1162.004) (-1164.100) -- 0:00:50
192500 -- [-1164.338] (-1162.843) (-1164.702) (-1163.306) * [-1164.251] (-1163.211) (-1166.897) (-1164.103) -- 0:00:50
193000 -- (-1161.193) (-1164.063) (-1163.488) [-1163.124] * (-1162.393) (-1162.908) [-1165.275] (-1163.410) -- 0:00:50
193500 -- (-1161.592) (-1162.116) (-1161.667) [-1165.584] * (-1161.051) (-1161.989) (-1164.696) [-1163.256] -- 0:00:50
194000 -- (-1161.494) (-1162.081) (-1168.797) [-1165.030] * [-1162.443] (-1163.486) (-1164.457) (-1163.464) -- 0:00:49
194500 -- (-1161.345) (-1162.240) (-1165.769) [-1162.353] * (-1165.287) [-1166.139] (-1166.677) (-1163.933) -- 0:00:49
195000 -- (-1162.210) [-1162.472] (-1168.250) (-1162.376) * (-1165.490) (-1167.214) [-1165.009] (-1165.643) -- 0:00:49
Average standard deviation of split frequencies: 0.018760
195500 -- (-1163.416) [-1162.203] (-1167.336) (-1162.035) * (-1164.364) [-1162.569] (-1164.161) (-1167.090) -- 0:00:49
196000 -- [-1161.054] (-1163.556) (-1162.302) (-1163.464) * [-1163.105] (-1162.096) (-1164.170) (-1162.332) -- 0:00:49
196500 -- (-1160.936) [-1161.916] (-1165.250) (-1163.991) * (-1161.034) (-1161.157) (-1163.149) [-1161.821] -- 0:00:49
197000 -- (-1161.705) [-1163.740] (-1161.772) (-1161.881) * (-1161.019) (-1167.842) (-1161.713) [-1162.276] -- 0:00:48
197500 -- (-1161.705) (-1165.717) [-1162.523] (-1162.304) * [-1162.344] (-1161.701) (-1161.622) (-1161.010) -- 0:00:48
198000 -- (-1163.511) [-1162.212] (-1162.649) (-1163.493) * [-1161.379] (-1162.187) (-1161.466) (-1160.997) -- 0:00:48
198500 -- (-1161.492) (-1162.093) [-1165.632] (-1163.947) * [-1163.110] (-1161.653) (-1164.196) (-1162.728) -- 0:00:48
199000 -- [-1164.093] (-1162.354) (-1162.159) (-1163.996) * (-1162.551) [-1165.038] (-1165.752) (-1167.200) -- 0:00:48
199500 -- (-1160.905) [-1163.382] (-1163.423) (-1163.890) * (-1164.959) [-1161.748] (-1163.501) (-1164.736) -- 0:00:48
200000 -- (-1164.089) (-1163.119) (-1164.819) [-1163.080] * (-1163.390) [-1167.324] (-1161.637) (-1164.760) -- 0:00:48
Average standard deviation of split frequencies: 0.017384
200500 -- (-1161.952) [-1162.395] (-1162.496) (-1164.236) * (-1164.943) [-1162.093] (-1162.235) (-1162.953) -- 0:00:47
201000 -- (-1161.532) [-1162.465] (-1166.297) (-1162.647) * (-1164.212) [-1163.232] (-1163.276) (-1162.953) -- 0:00:47
201500 -- (-1166.333) (-1162.596) (-1163.075) [-1162.921] * (-1163.844) (-1161.982) (-1161.484) [-1166.335] -- 0:00:47
202000 -- [-1163.198] (-1163.305) (-1163.154) (-1167.337) * [-1163.365] (-1163.657) (-1163.959) (-1162.443) -- 0:00:47
202500 -- (-1166.291) (-1162.402) [-1162.277] (-1166.071) * [-1164.157] (-1162.632) (-1165.262) (-1162.709) -- 0:00:47
203000 -- [-1162.769] (-1162.073) (-1166.147) (-1162.769) * (-1165.276) (-1163.785) (-1163.721) [-1166.494] -- 0:00:51
203500 -- [-1163.355] (-1163.699) (-1166.278) (-1162.456) * (-1166.188) (-1161.499) (-1167.527) [-1163.186] -- 0:00:50
204000 -- (-1167.769) (-1162.484) (-1164.980) [-1163.543] * (-1163.560) (-1161.004) (-1166.662) [-1164.197] -- 0:00:50
204500 -- (-1165.619) [-1162.873] (-1161.287) (-1163.461) * (-1164.418) (-1162.920) [-1167.508] (-1166.164) -- 0:00:50
205000 -- (-1164.116) (-1166.061) (-1163.166) [-1162.659] * (-1166.751) (-1162.314) (-1162.293) [-1163.245] -- 0:00:50
Average standard deviation of split frequencies: 0.017392
205500 -- (-1163.121) [-1163.747] (-1161.995) (-1162.317) * (-1162.560) (-1164.230) (-1163.354) [-1161.858] -- 0:00:50
206000 -- (-1165.111) (-1164.613) [-1162.561] (-1164.032) * [-1165.835] (-1163.202) (-1165.581) (-1163.360) -- 0:00:50
206500 -- (-1163.431) [-1165.096] (-1166.568) (-1163.980) * (-1161.259) (-1163.019) (-1169.472) [-1162.676] -- 0:00:49
207000 -- (-1161.000) (-1163.165) (-1164.280) [-1161.313] * (-1161.164) (-1164.173) (-1164.379) [-1162.886] -- 0:00:49
207500 -- (-1162.561) (-1161.605) (-1162.716) [-1160.820] * [-1163.776] (-1162.818) (-1165.613) (-1163.466) -- 0:00:49
208000 -- (-1161.695) [-1161.616] (-1163.760) (-1168.656) * (-1162.932) [-1162.861] (-1162.383) (-1166.412) -- 0:00:49
208500 -- (-1164.266) (-1162.940) (-1165.113) [-1164.443] * [-1163.730] (-1163.159) (-1164.998) (-1163.685) -- 0:00:49
209000 -- (-1165.442) (-1165.090) [-1163.317] (-1163.707) * [-1163.261] (-1162.962) (-1162.897) (-1164.293) -- 0:00:49
209500 -- [-1161.985] (-1164.498) (-1163.912) (-1165.386) * (-1165.549) [-1162.458] (-1162.200) (-1163.319) -- 0:00:49
210000 -- (-1164.558) (-1165.006) [-1164.904] (-1166.018) * [-1161.445] (-1162.064) (-1165.788) (-1161.916) -- 0:00:48
Average standard deviation of split frequencies: 0.015664
210500 -- (-1168.174) (-1165.755) [-1163.490] (-1170.495) * [-1161.414] (-1161.307) (-1164.505) (-1161.882) -- 0:00:48
211000 -- [-1166.324] (-1161.918) (-1167.561) (-1164.217) * [-1163.953] (-1162.705) (-1164.779) (-1165.221) -- 0:00:48
211500 -- (-1163.142) [-1162.959] (-1165.493) (-1164.764) * [-1162.509] (-1161.327) (-1164.778) (-1161.990) -- 0:00:48
212000 -- (-1164.146) (-1162.166) [-1162.755] (-1164.119) * (-1162.465) [-1161.481] (-1161.024) (-1161.820) -- 0:00:48
212500 -- [-1162.740] (-1162.778) (-1163.946) (-1163.139) * (-1163.826) (-1162.637) [-1161.024] (-1161.771) -- 0:00:48
213000 -- [-1163.675] (-1162.216) (-1163.444) (-1164.474) * (-1163.743) [-1163.350] (-1162.236) (-1161.800) -- 0:00:48
213500 -- (-1162.777) (-1164.915) [-1162.178] (-1162.577) * (-1163.387) [-1162.928] (-1161.952) (-1163.368) -- 0:00:47
214000 -- [-1161.481] (-1162.796) (-1163.652) (-1161.751) * (-1169.789) [-1162.583] (-1162.047) (-1168.968) -- 0:00:47
214500 -- (-1161.873) [-1161.572] (-1162.573) (-1164.072) * (-1165.441) (-1162.896) (-1162.616) [-1167.119] -- 0:00:47
215000 -- (-1162.078) (-1164.871) [-1162.261] (-1166.658) * (-1163.480) [-1163.884] (-1161.781) (-1165.353) -- 0:00:47
Average standard deviation of split frequencies: 0.019205
215500 -- (-1162.026) (-1166.490) (-1161.737) [-1160.858] * [-1161.352] (-1162.221) (-1163.625) (-1164.902) -- 0:00:47
216000 -- (-1162.397) [-1162.340] (-1161.080) (-1161.153) * (-1162.729) [-1161.785] (-1162.639) (-1163.797) -- 0:00:47
216500 -- (-1163.041) [-1161.750] (-1163.869) (-1161.607) * (-1163.535) (-1162.035) (-1163.714) [-1164.897] -- 0:00:47
217000 -- (-1162.225) (-1161.944) (-1162.091) [-1161.627] * (-1165.776) (-1162.479) (-1163.780) [-1163.340] -- 0:00:46
217500 -- [-1161.265] (-1163.648) (-1162.085) (-1161.199) * (-1164.584) [-1164.246] (-1162.133) (-1162.967) -- 0:00:46
218000 -- (-1163.316) (-1163.210) [-1163.156] (-1162.756) * (-1163.245) (-1165.160) [-1161.548] (-1161.901) -- 0:00:46
218500 -- (-1168.143) (-1163.840) (-1162.429) [-1162.724] * (-1163.430) (-1163.321) [-1161.768] (-1162.052) -- 0:00:46
219000 -- (-1168.655) [-1164.569] (-1162.080) (-1164.064) * (-1166.634) [-1162.652] (-1162.984) (-1163.310) -- 0:00:49
219500 -- [-1163.838] (-1164.384) (-1161.278) (-1161.271) * (-1163.936) [-1161.848] (-1164.744) (-1162.400) -- 0:00:49
220000 -- (-1161.970) [-1165.008] (-1163.524) (-1166.492) * (-1166.211) (-1161.503) (-1162.966) [-1162.256] -- 0:00:49
Average standard deviation of split frequencies: 0.017517
220500 -- [-1163.105] (-1161.710) (-1166.463) (-1162.205) * (-1166.406) [-1165.114] (-1162.521) (-1164.328) -- 0:00:49
221000 -- (-1161.636) [-1161.740] (-1163.069) (-1161.497) * (-1161.867) (-1165.854) (-1161.887) [-1164.145] -- 0:00:49
221500 -- (-1161.141) (-1162.835) (-1164.535) [-1162.059] * (-1163.566) (-1163.581) [-1163.115] (-1164.286) -- 0:00:49
222000 -- [-1161.142] (-1167.337) (-1165.244) (-1161.733) * (-1161.144) (-1163.424) (-1163.131) [-1164.624] -- 0:00:49
222500 -- (-1162.010) (-1166.862) (-1162.226) [-1162.110] * (-1161.614) (-1163.620) (-1167.544) [-1163.657] -- 0:00:48
223000 -- [-1161.085] (-1160.990) (-1164.171) (-1163.467) * [-1162.198] (-1161.268) (-1161.296) (-1163.290) -- 0:00:48
223500 -- (-1163.671) [-1161.037] (-1163.144) (-1162.421) * (-1162.865) (-1163.734) [-1161.713] (-1162.325) -- 0:00:48
224000 -- [-1164.351] (-1161.035) (-1162.837) (-1163.816) * (-1162.112) (-1163.183) (-1162.736) [-1162.056] -- 0:00:48
224500 -- [-1164.306] (-1161.322) (-1164.146) (-1161.820) * [-1162.764] (-1164.552) (-1162.726) (-1161.192) -- 0:00:48
225000 -- (-1167.606) (-1163.737) (-1163.169) [-1161.583] * (-1161.276) [-1165.648] (-1165.772) (-1161.182) -- 0:00:48
Average standard deviation of split frequencies: 0.020024
225500 -- (-1166.464) (-1163.671) [-1163.272] (-1162.371) * [-1162.730] (-1167.925) (-1165.497) (-1163.381) -- 0:00:48
226000 -- [-1162.674] (-1162.646) (-1163.968) (-1162.659) * (-1166.820) [-1166.454] (-1163.872) (-1163.456) -- 0:00:47
226500 -- (-1163.300) (-1165.064) (-1163.554) [-1163.777] * (-1163.720) (-1164.689) [-1164.027] (-1164.837) -- 0:00:47
227000 -- (-1166.418) (-1161.784) [-1161.756] (-1161.943) * [-1160.871] (-1163.051) (-1162.990) (-1165.155) -- 0:00:47
227500 -- [-1166.887] (-1165.440) (-1162.722) (-1161.938) * (-1162.072) (-1162.540) (-1161.928) [-1163.809] -- 0:00:47
228000 -- (-1166.114) (-1161.643) (-1164.253) [-1161.468] * (-1162.790) (-1164.171) (-1162.181) [-1162.912] -- 0:00:47
228500 -- (-1169.143) [-1161.811] (-1165.422) (-1163.296) * [-1165.531] (-1162.873) (-1163.045) (-1164.046) -- 0:00:47
229000 -- (-1165.818) (-1162.187) [-1164.047] (-1166.637) * (-1163.599) (-1164.025) [-1162.195] (-1161.493) -- 0:00:47
229500 -- (-1164.938) (-1165.247) (-1161.911) [-1165.724] * (-1164.831) [-1163.182] (-1161.921) (-1162.060) -- 0:00:47
230000 -- (-1164.239) (-1162.227) [-1165.823] (-1165.558) * (-1165.230) (-1163.457) [-1162.290] (-1161.486) -- 0:00:46
Average standard deviation of split frequencies: 0.017984
230500 -- (-1166.197) (-1163.191) (-1164.948) [-1162.564] * (-1162.864) [-1163.234] (-1167.793) (-1162.370) -- 0:00:46
231000 -- [-1163.105] (-1166.951) (-1165.242) (-1164.523) * (-1163.551) (-1164.490) [-1167.852] (-1162.112) -- 0:00:46
231500 -- (-1165.769) [-1164.074] (-1164.722) (-1165.935) * (-1161.796) (-1166.328) [-1166.075] (-1162.412) -- 0:00:46
232000 -- (-1163.795) (-1163.778) [-1164.293] (-1163.744) * (-1168.662) (-1163.757) [-1168.015] (-1161.646) -- 0:00:46
232500 -- (-1163.313) (-1164.304) (-1163.493) [-1164.051] * [-1162.799] (-1163.852) (-1162.504) (-1164.482) -- 0:00:46
233000 -- [-1162.865] (-1164.717) (-1161.950) (-1163.713) * (-1163.218) [-1165.469] (-1162.807) (-1162.169) -- 0:00:46
233500 -- (-1168.495) (-1165.786) [-1162.735] (-1163.668) * (-1163.530) [-1163.584] (-1161.895) (-1163.196) -- 0:00:49
234000 -- (-1170.052) [-1163.075] (-1162.941) (-1167.103) * (-1166.021) [-1163.850] (-1161.820) (-1164.495) -- 0:00:49
234500 -- (-1166.561) (-1162.098) [-1161.680] (-1162.254) * (-1168.367) (-1164.403) [-1162.268] (-1163.072) -- 0:00:48
235000 -- (-1163.171) [-1161.747] (-1161.974) (-1161.919) * [-1163.149] (-1163.114) (-1164.468) (-1163.552) -- 0:00:48
Average standard deviation of split frequencies: 0.016779
235500 -- (-1162.094) [-1162.630] (-1163.156) (-1162.549) * (-1163.953) [-1163.952] (-1166.404) (-1162.737) -- 0:00:48
236000 -- (-1161.940) (-1163.206) (-1163.227) [-1165.338] * (-1162.036) (-1163.757) [-1164.936] (-1162.279) -- 0:00:48
236500 -- [-1163.306] (-1164.485) (-1165.205) (-1162.542) * (-1163.967) [-1163.245] (-1162.617) (-1162.644) -- 0:00:48
237000 -- (-1162.347) (-1165.351) (-1163.156) [-1164.398] * [-1163.534] (-1162.582) (-1165.049) (-1161.865) -- 0:00:48
237500 -- [-1162.029] (-1161.351) (-1161.303) (-1163.246) * (-1163.266) (-1163.539) (-1163.071) [-1161.428] -- 0:00:48
238000 -- (-1161.620) [-1162.298] (-1162.638) (-1162.148) * (-1163.495) (-1164.766) [-1162.502] (-1161.876) -- 0:00:48
238500 -- [-1160.750] (-1163.227) (-1164.842) (-1166.759) * (-1161.262) (-1164.476) (-1163.407) [-1163.211] -- 0:00:47
239000 -- (-1162.387) (-1161.939) (-1163.137) [-1164.345] * (-1161.670) [-1163.679] (-1164.017) (-1166.761) -- 0:00:47
239500 -- (-1162.364) (-1163.391) [-1162.106] (-1161.315) * (-1164.357) (-1162.427) [-1164.227] (-1167.067) -- 0:00:47
240000 -- (-1163.068) (-1162.279) (-1163.361) [-1161.508] * (-1162.237) [-1161.663] (-1161.365) (-1163.072) -- 0:00:47
Average standard deviation of split frequencies: 0.019196
240500 -- (-1164.094) (-1162.042) [-1161.252] (-1161.283) * (-1164.958) (-1164.980) [-1163.092] (-1163.580) -- 0:00:47
241000 -- (-1163.147) (-1162.167) [-1161.924] (-1161.850) * (-1162.912) (-1164.358) [-1164.124] (-1163.663) -- 0:00:47
241500 -- (-1164.615) (-1164.536) [-1163.007] (-1161.401) * (-1162.038) [-1161.914] (-1164.433) (-1163.682) -- 0:00:47
242000 -- (-1166.609) (-1162.736) [-1161.825] (-1164.162) * (-1164.231) [-1161.896] (-1162.284) (-1162.502) -- 0:00:46
242500 -- (-1162.533) (-1161.562) [-1162.396] (-1161.943) * [-1162.911] (-1162.910) (-1162.033) (-1165.170) -- 0:00:46
243000 -- (-1163.529) (-1161.903) [-1163.806] (-1163.509) * [-1165.917] (-1161.548) (-1163.202) (-1164.928) -- 0:00:46
243500 -- [-1161.215] (-1161.510) (-1162.688) (-1165.144) * (-1161.546) [-1161.778] (-1161.459) (-1165.723) -- 0:00:46
244000 -- (-1162.297) [-1165.544] (-1167.445) (-1164.711) * (-1163.344) (-1162.784) (-1162.457) [-1163.453] -- 0:00:46
244500 -- [-1164.298] (-1161.308) (-1163.501) (-1166.167) * [-1162.763] (-1161.854) (-1166.435) (-1164.481) -- 0:00:46
245000 -- (-1166.330) (-1167.281) (-1162.492) [-1161.740] * [-1164.643] (-1162.184) (-1164.154) (-1162.128) -- 0:00:46
Average standard deviation of split frequencies: 0.020313
245500 -- (-1170.939) (-1164.970) (-1163.724) [-1162.996] * [-1163.223] (-1163.336) (-1162.120) (-1162.821) -- 0:00:46
246000 -- (-1163.828) (-1166.917) [-1165.846] (-1163.366) * [-1164.576] (-1165.326) (-1162.740) (-1162.558) -- 0:00:45
246500 -- [-1161.290] (-1165.541) (-1163.171) (-1163.061) * (-1164.463) (-1168.321) [-1162.346] (-1163.369) -- 0:00:45
247000 -- (-1162.260) [-1163.904] (-1162.480) (-1164.965) * (-1164.933) (-1165.001) (-1162.602) [-1162.140] -- 0:00:45
247500 -- (-1161.562) [-1162.471] (-1166.773) (-1164.876) * (-1163.238) [-1161.549] (-1162.822) (-1163.111) -- 0:00:45
248000 -- (-1163.757) (-1165.419) [-1162.180] (-1166.248) * (-1165.739) (-1164.225) (-1167.062) [-1165.032] -- 0:00:45
248500 -- (-1163.333) (-1164.682) [-1162.604] (-1165.331) * (-1166.304) (-1163.245) (-1165.816) [-1162.895] -- 0:00:45
249000 -- (-1164.295) (-1164.018) (-1167.688) [-1162.056] * (-1164.267) (-1163.661) (-1164.287) [-1164.841] -- 0:00:45
249500 -- (-1162.401) (-1162.287) [-1162.646] (-1163.844) * [-1162.701] (-1165.367) (-1164.101) (-1165.886) -- 0:00:48
250000 -- (-1162.133) [-1161.697] (-1161.793) (-1162.347) * (-1163.758) [-1163.579] (-1164.283) (-1165.270) -- 0:00:48
Average standard deviation of split frequencies: 0.020311
250500 -- (-1162.443) [-1162.083] (-1162.404) (-1162.591) * [-1162.018] (-1163.522) (-1167.866) (-1163.381) -- 0:00:47
251000 -- (-1162.411) (-1161.034) (-1160.841) [-1162.913] * [-1164.404] (-1165.579) (-1163.255) (-1162.730) -- 0:00:47
251500 -- (-1168.445) (-1161.405) (-1161.502) [-1161.347] * (-1162.233) (-1162.371) (-1163.587) [-1162.100] -- 0:00:47
252000 -- [-1165.227] (-1162.650) (-1162.119) (-1162.570) * (-1162.232) (-1164.046) [-1164.007] (-1162.200) -- 0:00:47
252500 -- [-1165.232] (-1162.432) (-1162.205) (-1164.404) * (-1162.770) (-1173.821) (-1164.682) [-1162.554] -- 0:00:47
253000 -- (-1163.798) [-1162.274] (-1162.233) (-1165.380) * (-1161.775) (-1169.247) [-1162.609] (-1163.056) -- 0:00:47
253500 -- (-1165.361) [-1166.176] (-1163.600) (-1163.325) * [-1163.041] (-1163.904) (-1167.958) (-1166.573) -- 0:00:47
254000 -- (-1160.914) (-1163.263) (-1162.385) [-1161.028] * (-1163.645) (-1165.519) (-1163.445) [-1163.598] -- 0:00:46
254500 -- (-1160.992) (-1161.571) [-1162.476] (-1160.877) * [-1163.257] (-1166.559) (-1161.084) (-1163.846) -- 0:00:46
255000 -- (-1164.144) (-1166.006) (-1163.078) [-1161.304] * (-1163.812) (-1168.192) (-1161.172) [-1161.100] -- 0:00:46
Average standard deviation of split frequencies: 0.019151
255500 -- (-1161.625) (-1164.464) [-1165.395] (-1161.721) * [-1162.491] (-1162.168) (-1162.996) (-1162.623) -- 0:00:46
256000 -- (-1163.854) (-1163.074) (-1161.330) [-1162.176] * (-1163.098) [-1162.833] (-1162.866) (-1162.617) -- 0:00:46
256500 -- (-1161.909) (-1164.032) [-1161.058] (-1163.195) * (-1162.909) (-1162.726) (-1164.489) [-1162.388] -- 0:00:46
257000 -- (-1164.415) (-1170.570) (-1160.825) [-1162.897] * [-1162.672] (-1162.878) (-1163.966) (-1163.132) -- 0:00:46
257500 -- (-1161.759) (-1167.613) [-1161.051] (-1163.425) * (-1163.072) (-1168.359) [-1165.314] (-1163.527) -- 0:00:46
258000 -- (-1162.262) (-1161.608) [-1161.135] (-1165.440) * (-1162.978) (-1168.010) (-1164.086) [-1166.223] -- 0:00:46
258500 -- [-1161.308] (-1163.433) (-1161.713) (-1162.640) * (-1166.628) (-1168.851) [-1162.499] (-1167.107) -- 0:00:45
259000 -- (-1161.093) [-1165.556] (-1163.472) (-1163.411) * (-1162.626) (-1166.960) (-1163.385) [-1162.874] -- 0:00:45
259500 -- [-1163.017] (-1163.732) (-1164.036) (-1163.214) * (-1161.760) (-1163.892) (-1165.220) [-1162.960] -- 0:00:45
260000 -- (-1163.723) (-1161.324) [-1164.737] (-1162.829) * (-1165.449) [-1165.540] (-1164.355) (-1163.954) -- 0:00:45
Average standard deviation of split frequencies: 0.020616
260500 -- (-1162.583) (-1162.868) [-1164.452] (-1163.342) * (-1164.850) (-1163.749) [-1165.260] (-1164.415) -- 0:00:45
261000 -- [-1166.446] (-1164.579) (-1161.332) (-1163.895) * (-1164.519) (-1163.554) (-1165.286) [-1165.131] -- 0:00:45
261500 -- (-1163.632) (-1163.132) (-1162.598) [-1164.446] * [-1167.722] (-1166.975) (-1162.771) (-1163.073) -- 0:00:45
262000 -- (-1164.774) (-1164.208) (-1164.609) [-1166.042] * (-1166.960) (-1166.587) (-1163.537) [-1163.233] -- 0:00:45
262500 -- [-1164.463] (-1166.462) (-1162.553) (-1163.943) * (-1162.101) [-1161.179] (-1162.981) (-1166.492) -- 0:00:44
263000 -- (-1164.654) (-1166.103) (-1162.395) [-1167.132] * (-1163.676) [-1161.299] (-1161.465) (-1163.838) -- 0:00:44
263500 -- (-1163.787) (-1164.985) [-1163.809] (-1163.517) * [-1163.268] (-1162.256) (-1163.368) (-1165.098) -- 0:00:44
264000 -- (-1162.631) (-1162.554) (-1164.178) [-1161.672] * (-1162.942) (-1162.168) [-1163.277] (-1164.622) -- 0:00:44
264500 -- (-1166.807) [-1162.745] (-1165.398) (-1161.455) * (-1163.362) (-1162.453) [-1163.858] (-1164.116) -- 0:00:44
265000 -- (-1167.576) (-1162.195) [-1163.860] (-1161.880) * (-1166.179) (-1161.213) (-1168.321) [-1162.540] -- 0:00:44
Average standard deviation of split frequencies: 0.019494
265500 -- (-1164.436) (-1161.693) (-1161.523) [-1162.358] * (-1163.190) (-1163.051) [-1161.767] (-1161.054) -- 0:00:44
266000 -- (-1161.548) (-1163.013) (-1164.036) [-1162.498] * (-1164.915) [-1161.075] (-1162.685) (-1161.139) -- 0:00:46
266500 -- (-1162.795) (-1163.262) (-1163.068) [-1161.708] * (-1163.511) [-1161.233] (-1161.538) (-1162.013) -- 0:00:46
267000 -- (-1163.286) (-1163.943) (-1166.963) [-1162.313] * (-1161.866) (-1162.415) [-1162.089] (-1162.226) -- 0:00:46
267500 -- (-1162.176) (-1162.885) [-1164.745] (-1169.483) * (-1165.156) (-1165.354) (-1162.748) [-1162.381] -- 0:00:46
268000 -- [-1164.914] (-1165.708) (-1163.346) (-1170.958) * (-1161.731) (-1162.465) [-1162.158] (-1165.135) -- 0:00:46
268500 -- (-1163.345) (-1166.251) [-1164.014] (-1165.953) * (-1164.608) (-1162.033) [-1163.323] (-1164.330) -- 0:00:46
269000 -- (-1160.913) (-1162.290) [-1163.210] (-1164.938) * (-1167.236) (-1162.421) (-1163.769) [-1164.830] -- 0:00:46
269500 -- (-1161.402) (-1165.449) [-1161.281] (-1164.251) * (-1165.011) (-1162.636) [-1163.532] (-1162.380) -- 0:00:46
270000 -- [-1161.915] (-1163.486) (-1162.624) (-1163.431) * (-1164.154) (-1161.136) (-1162.950) [-1164.215] -- 0:00:45
Average standard deviation of split frequencies: 0.019158
270500 -- (-1161.796) (-1162.489) (-1164.475) [-1162.234] * (-1164.119) (-1161.299) [-1164.307] (-1162.214) -- 0:00:45
271000 -- [-1161.021] (-1161.111) (-1164.047) (-1164.355) * [-1162.321] (-1164.079) (-1164.112) (-1163.785) -- 0:00:45
271500 -- [-1160.743] (-1161.851) (-1165.533) (-1163.358) * (-1165.712) [-1165.434] (-1162.948) (-1168.410) -- 0:00:45
272000 -- (-1161.939) [-1162.068] (-1164.295) (-1165.970) * [-1162.054] (-1166.909) (-1162.947) (-1163.908) -- 0:00:45
272500 -- (-1160.780) [-1162.568] (-1164.042) (-1164.049) * (-1165.856) (-1167.160) [-1165.053] (-1164.713) -- 0:00:45
273000 -- (-1161.686) (-1162.649) (-1164.824) [-1163.532] * (-1165.651) (-1167.173) (-1163.117) [-1164.392] -- 0:00:45
273500 -- [-1161.255] (-1164.718) (-1164.212) (-1161.789) * [-1164.065] (-1162.393) (-1164.284) (-1166.253) -- 0:00:45
274000 -- [-1165.275] (-1166.673) (-1166.840) (-1162.754) * [-1162.852] (-1163.378) (-1167.530) (-1168.083) -- 0:00:45
274500 -- (-1166.783) [-1165.858] (-1165.780) (-1161.632) * (-1163.348) [-1164.266] (-1169.794) (-1163.912) -- 0:00:44
275000 -- (-1166.881) [-1161.706] (-1165.423) (-1165.268) * (-1162.230) (-1164.872) [-1168.433] (-1163.303) -- 0:00:44
Average standard deviation of split frequencies: 0.017421
275500 -- (-1165.923) [-1163.606] (-1162.065) (-1167.956) * (-1163.949) [-1165.796] (-1163.075) (-1162.781) -- 0:00:44
276000 -- (-1163.603) (-1165.348) [-1164.064] (-1166.094) * [-1166.600] (-1167.860) (-1164.960) (-1163.003) -- 0:00:44
276500 -- (-1163.174) (-1163.411) (-1164.628) [-1163.204] * (-1165.066) (-1163.973) (-1163.003) [-1161.922] -- 0:00:44
277000 -- (-1165.199) [-1166.517] (-1163.674) (-1162.914) * (-1163.992) (-1164.016) [-1164.561] (-1162.704) -- 0:00:44
277500 -- (-1164.746) (-1163.460) (-1162.247) [-1162.197] * (-1165.518) (-1165.804) [-1163.459] (-1163.668) -- 0:00:44
278000 -- (-1169.391) [-1163.429] (-1163.657) (-1164.444) * (-1166.054) (-1161.333) [-1162.759] (-1163.529) -- 0:00:44
278500 -- [-1163.126] (-1164.263) (-1165.333) (-1165.266) * (-1165.006) (-1161.205) [-1162.830] (-1164.989) -- 0:00:44
279000 -- (-1162.466) [-1165.666] (-1161.436) (-1161.557) * (-1163.900) (-1166.912) [-1161.490] (-1163.336) -- 0:00:43
279500 -- (-1162.823) [-1161.632] (-1162.953) (-1161.674) * (-1163.145) (-1166.792) [-1164.677] (-1163.366) -- 0:00:43
280000 -- (-1161.975) [-1163.740] (-1162.965) (-1161.418) * (-1163.880) (-1163.108) (-1163.790) [-1164.401] -- 0:00:43
Average standard deviation of split frequencies: 0.014780
280500 -- [-1161.720] (-1165.140) (-1163.756) (-1160.732) * [-1167.542] (-1164.808) (-1163.638) (-1164.345) -- 0:00:43
281000 -- [-1161.745] (-1162.591) (-1163.681) (-1162.831) * (-1164.118) (-1161.618) (-1163.805) [-1162.583] -- 0:00:43
281500 -- (-1162.690) [-1162.549] (-1164.465) (-1162.714) * (-1163.919) [-1164.721] (-1162.873) (-1161.400) -- 0:00:43
282000 -- (-1163.582) [-1163.333] (-1165.913) (-1165.787) * (-1164.509) (-1161.977) (-1163.726) [-1161.511] -- 0:00:43
282500 -- [-1163.355] (-1162.225) (-1166.599) (-1163.229) * [-1163.408] (-1162.473) (-1165.150) (-1161.384) -- 0:00:45
283000 -- (-1161.358) (-1163.454) (-1170.949) [-1161.835] * [-1162.658] (-1165.235) (-1163.059) (-1162.362) -- 0:00:45
283500 -- (-1162.523) (-1163.473) (-1162.067) [-1163.188] * (-1165.481) (-1163.413) (-1163.049) [-1162.874] -- 0:00:45
284000 -- (-1163.037) [-1160.888] (-1162.683) (-1161.696) * [-1161.462] (-1162.887) (-1162.423) (-1166.046) -- 0:00:45
284500 -- [-1166.943] (-1162.352) (-1162.879) (-1161.355) * (-1162.659) [-1163.089] (-1166.200) (-1163.492) -- 0:00:45
285000 -- [-1165.225] (-1162.625) (-1162.216) (-1161.427) * [-1164.348] (-1165.482) (-1162.241) (-1161.618) -- 0:00:45
Average standard deviation of split frequencies: 0.013845
285500 -- (-1169.442) (-1162.077) (-1163.481) [-1161.698] * (-1162.812) (-1165.027) (-1163.072) [-1165.311] -- 0:00:45
286000 -- (-1164.881) (-1163.785) (-1164.923) [-1161.687] * (-1161.209) [-1162.545] (-1163.907) (-1162.944) -- 0:00:44
286500 -- [-1161.940] (-1166.435) (-1163.061) (-1161.677) * [-1161.711] (-1163.367) (-1166.678) (-1164.066) -- 0:00:44
287000 -- (-1163.961) (-1166.073) (-1161.374) [-1162.368] * (-1161.641) (-1162.904) (-1164.335) [-1165.134] -- 0:00:44
287500 -- (-1164.994) (-1163.873) (-1161.834) [-1163.373] * (-1162.769) (-1163.448) (-1164.328) [-1161.876] -- 0:00:44
288000 -- [-1170.156] (-1166.732) (-1161.829) (-1163.665) * (-1165.766) [-1163.005] (-1166.057) (-1165.148) -- 0:00:44
288500 -- (-1162.517) (-1164.745) (-1161.706) [-1168.435] * (-1166.922) [-1163.199] (-1166.528) (-1163.080) -- 0:00:44
289000 -- [-1162.476] (-1161.904) (-1162.753) (-1164.525) * (-1164.434) (-1165.536) (-1165.592) [-1162.743] -- 0:00:44
289500 -- (-1163.875) [-1162.291] (-1164.192) (-1166.402) * (-1163.674) [-1162.512] (-1165.266) (-1165.852) -- 0:00:44
290000 -- (-1165.427) (-1163.113) [-1161.157] (-1162.670) * [-1164.148] (-1163.699) (-1162.462) (-1164.877) -- 0:00:44
Average standard deviation of split frequencies: 0.012974
290500 -- (-1167.733) (-1163.341) (-1163.548) [-1162.172] * [-1161.244] (-1162.581) (-1162.965) (-1163.539) -- 0:00:43
291000 -- (-1162.545) (-1163.076) [-1166.390] (-1165.306) * [-1161.181] (-1162.019) (-1165.354) (-1165.714) -- 0:00:43
291500 -- (-1162.233) [-1161.885] (-1166.801) (-1166.270) * [-1161.187] (-1161.417) (-1165.975) (-1163.859) -- 0:00:43
292000 -- (-1167.012) (-1162.128) [-1163.494] (-1161.349) * (-1161.383) [-1161.455] (-1170.253) (-1161.604) -- 0:00:43
292500 -- (-1166.095) (-1162.013) (-1163.728) [-1161.372] * (-1161.706) [-1161.513] (-1168.488) (-1162.092) -- 0:00:43
293000 -- (-1161.574) [-1161.749] (-1162.764) (-1162.595) * (-1163.829) (-1161.821) [-1165.089] (-1163.777) -- 0:00:43
293500 -- (-1161.907) [-1162.203] (-1162.667) (-1168.498) * (-1166.199) (-1162.567) [-1164.376] (-1165.356) -- 0:00:43
294000 -- [-1161.915] (-1161.308) (-1163.699) (-1170.480) * [-1162.372] (-1161.584) (-1162.405) (-1161.776) -- 0:00:43
294500 -- (-1163.998) [-1161.248] (-1165.014) (-1164.786) * (-1161.301) (-1162.454) (-1162.067) [-1163.639] -- 0:00:43
295000 -- (-1163.273) [-1163.392] (-1165.529) (-1167.065) * (-1161.301) [-1162.145] (-1161.242) (-1163.941) -- 0:00:43
Average standard deviation of split frequencies: 0.012422
295500 -- [-1162.064] (-1164.284) (-1163.783) (-1164.864) * (-1160.972) (-1164.426) [-1160.854] (-1162.021) -- 0:00:42
296000 -- [-1161.584] (-1161.692) (-1163.708) (-1166.489) * (-1163.121) (-1163.775) [-1162.201] (-1164.995) -- 0:00:42
296500 -- [-1161.341] (-1161.897) (-1163.882) (-1167.504) * [-1163.015] (-1162.013) (-1164.014) (-1164.271) -- 0:00:42
297000 -- (-1163.003) (-1161.894) [-1161.637] (-1166.967) * (-1161.758) [-1162.006] (-1164.941) (-1163.031) -- 0:00:42
297500 -- (-1164.567) [-1162.166] (-1162.020) (-1163.458) * [-1163.267] (-1161.235) (-1165.219) (-1161.648) -- 0:00:42
298000 -- [-1162.004] (-1165.550) (-1163.514) (-1165.267) * (-1162.998) [-1163.876] (-1168.278) (-1168.058) -- 0:00:42
298500 -- (-1162.999) (-1162.704) (-1162.134) [-1166.622] * (-1164.255) (-1163.019) [-1163.450] (-1163.014) -- 0:00:42
299000 -- [-1162.012] (-1166.801) (-1167.009) (-1166.553) * (-1162.645) (-1163.051) (-1164.513) [-1165.671] -- 0:00:42
299500 -- (-1161.415) (-1166.742) (-1164.886) [-1163.263] * (-1162.954) (-1162.929) [-1168.358] (-1166.083) -- 0:00:44
300000 -- (-1162.943) [-1162.984] (-1163.190) (-1164.060) * (-1162.898) (-1164.781) [-1162.766] (-1162.517) -- 0:00:44
Average standard deviation of split frequencies: 0.013484
300500 -- (-1164.730) (-1167.462) [-1162.674] (-1161.583) * (-1165.823) (-1162.964) (-1164.439) [-1162.222] -- 0:00:44
301000 -- (-1165.691) (-1165.732) [-1161.952] (-1164.068) * (-1165.564) (-1161.639) [-1164.000] (-1165.484) -- 0:00:44
301500 -- (-1167.568) (-1161.648) (-1163.382) [-1167.111] * (-1162.945) [-1161.253] (-1163.642) (-1164.164) -- 0:00:44
302000 -- (-1163.351) [-1161.893] (-1162.100) (-1166.632) * (-1167.997) (-1162.542) (-1163.649) [-1167.455] -- 0:00:43
302500 -- (-1163.304) (-1161.673) (-1162.672) [-1164.053] * (-1161.696) (-1161.532) (-1163.046) [-1163.981] -- 0:00:43
303000 -- (-1166.236) (-1161.683) (-1162.901) [-1161.622] * (-1161.370) [-1161.572] (-1161.741) (-1165.053) -- 0:00:43
303500 -- (-1165.615) [-1162.435] (-1162.119) (-1161.705) * (-1165.333) (-1164.787) (-1162.574) [-1166.600] -- 0:00:43
304000 -- (-1163.659) (-1165.203) (-1164.195) [-1165.444] * (-1165.621) (-1168.365) [-1161.946] (-1166.360) -- 0:00:43
304500 -- [-1164.270] (-1163.213) (-1162.102) (-1166.177) * (-1166.847) [-1162.430] (-1162.023) (-1163.673) -- 0:00:43
305000 -- (-1162.596) (-1163.500) (-1162.270) [-1162.486] * (-1165.008) (-1162.658) [-1165.139] (-1161.243) -- 0:00:43
Average standard deviation of split frequencies: 0.012016
305500 -- (-1162.541) (-1164.140) (-1166.677) [-1166.400] * (-1164.865) (-1166.464) [-1163.710] (-1161.539) -- 0:00:43
306000 -- (-1161.679) (-1163.616) [-1166.130] (-1162.409) * (-1163.063) (-1161.821) [-1162.285] (-1161.497) -- 0:00:43
306500 -- (-1162.963) [-1164.625] (-1162.435) (-1164.015) * (-1163.370) (-1161.607) (-1161.671) [-1162.345] -- 0:00:42
307000 -- (-1165.479) [-1162.894] (-1162.682) (-1163.503) * (-1163.138) (-1166.004) (-1165.178) [-1163.731] -- 0:00:42
307500 -- (-1166.900) (-1162.456) [-1163.707] (-1163.103) * (-1164.032) (-1162.518) (-1161.776) [-1165.754] -- 0:00:42
308000 -- (-1164.697) [-1162.591] (-1161.748) (-1162.813) * (-1162.384) (-1163.523) [-1161.955] (-1164.562) -- 0:00:42
308500 -- (-1163.910) (-1166.620) [-1161.834] (-1165.453) * (-1163.717) [-1162.249] (-1162.797) (-1162.677) -- 0:00:42
309000 -- (-1164.123) [-1162.333] (-1162.079) (-1162.097) * (-1162.451) (-1163.756) [-1164.121] (-1161.861) -- 0:00:42
309500 -- (-1163.403) (-1162.154) [-1161.007] (-1165.196) * [-1161.325] (-1163.090) (-1163.859) (-1163.871) -- 0:00:42
310000 -- (-1164.260) (-1164.019) [-1164.967] (-1164.419) * (-1164.950) [-1161.788] (-1162.670) (-1162.492) -- 0:00:42
Average standard deviation of split frequencies: 0.011532
310500 -- [-1163.120] (-1163.900) (-1164.030) (-1162.029) * (-1165.404) (-1161.998) (-1162.302) [-1166.598] -- 0:00:42
311000 -- (-1166.516) (-1163.398) (-1166.227) [-1161.679] * (-1162.345) [-1165.216] (-1162.379) (-1162.354) -- 0:00:42
311500 -- (-1163.054) (-1162.009) [-1161.633] (-1161.909) * (-1164.405) [-1162.442] (-1162.184) (-1163.224) -- 0:00:41
312000 -- (-1162.679) (-1161.437) [-1163.432] (-1163.227) * (-1165.798) (-1162.712) [-1162.530] (-1164.300) -- 0:00:41
312500 -- (-1164.067) [-1161.462] (-1163.721) (-1164.451) * (-1165.979) (-1162.429) (-1168.982) [-1168.111] -- 0:00:41
313000 -- (-1163.378) (-1165.281) (-1164.902) [-1162.935] * [-1164.959] (-1163.539) (-1167.397) (-1170.119) -- 0:00:41
313500 -- (-1165.342) (-1163.004) (-1161.927) [-1162.635] * (-1165.979) [-1165.108] (-1166.086) (-1162.509) -- 0:00:41
314000 -- [-1163.643] (-1162.506) (-1161.461) (-1163.168) * (-1163.753) (-1162.265) (-1164.093) [-1164.136] -- 0:00:41
314500 -- (-1163.519) (-1172.607) (-1164.349) [-1162.563] * (-1161.725) [-1162.259] (-1165.345) (-1163.940) -- 0:00:41
315000 -- (-1162.671) (-1166.070) (-1164.774) [-1161.565] * (-1166.627) (-1164.407) (-1164.825) [-1160.902] -- 0:00:41
Average standard deviation of split frequencies: 0.011636
315500 -- [-1162.058] (-1165.392) (-1165.161) (-1163.091) * [-1164.594] (-1164.404) (-1162.226) (-1161.518) -- 0:00:41
316000 -- (-1162.920) (-1161.588) (-1163.535) [-1163.685] * (-1164.143) (-1161.732) (-1163.799) [-1162.023] -- 0:00:43
316500 -- (-1162.874) (-1162.375) [-1162.666] (-1162.184) * (-1164.696) (-1161.740) (-1162.488) [-1162.278] -- 0:00:43
317000 -- (-1162.298) (-1163.447) [-1163.211] (-1161.976) * [-1161.467] (-1167.946) (-1165.462) (-1161.832) -- 0:00:43
317500 -- (-1162.382) (-1162.247) [-1161.499] (-1163.312) * (-1161.335) (-1168.165) [-1165.392] (-1161.970) -- 0:00:42
318000 -- [-1161.464] (-1162.949) (-1164.219) (-1167.028) * [-1161.411] (-1167.040) (-1165.896) (-1162.537) -- 0:00:42
318500 -- (-1163.695) (-1164.499) [-1163.492] (-1167.657) * [-1162.432] (-1164.075) (-1163.423) (-1161.967) -- 0:00:42
319000 -- (-1162.703) [-1161.528] (-1164.343) (-1164.553) * (-1163.875) (-1164.180) [-1161.675] (-1162.814) -- 0:00:42
319500 -- (-1164.218) [-1164.234] (-1166.878) (-1160.757) * (-1165.406) (-1165.481) [-1161.935] (-1163.464) -- 0:00:42
320000 -- (-1164.767) [-1163.190] (-1163.229) (-1165.036) * (-1164.197) (-1166.836) [-1162.761] (-1162.040) -- 0:00:42
Average standard deviation of split frequencies: 0.009703
320500 -- [-1164.225] (-1163.129) (-1163.046) (-1162.381) * (-1161.960) [-1162.579] (-1165.101) (-1165.590) -- 0:00:42
321000 -- [-1164.208] (-1165.443) (-1162.163) (-1162.760) * (-1162.616) (-1161.349) [-1163.808] (-1162.278) -- 0:00:42
321500 -- [-1163.421] (-1167.644) (-1161.396) (-1164.959) * (-1161.499) [-1166.918] (-1168.092) (-1163.423) -- 0:00:42
322000 -- [-1160.958] (-1167.510) (-1161.314) (-1165.114) * (-1164.016) [-1161.683] (-1168.319) (-1164.288) -- 0:00:42
322500 -- [-1160.958] (-1167.423) (-1162.538) (-1162.196) * (-1163.673) (-1162.163) [-1163.888] (-1165.029) -- 0:00:42
323000 -- [-1163.900] (-1164.283) (-1161.943) (-1162.302) * [-1164.024] (-1161.698) (-1163.305) (-1165.293) -- 0:00:41
323500 -- (-1164.994) [-1164.580] (-1164.309) (-1161.623) * (-1161.400) [-1161.699] (-1164.026) (-1166.234) -- 0:00:41
324000 -- [-1166.645] (-1165.072) (-1163.170) (-1161.617) * (-1165.976) [-1162.472] (-1165.423) (-1164.998) -- 0:00:41
324500 -- (-1167.387) [-1162.716] (-1162.156) (-1162.154) * [-1167.047] (-1162.623) (-1165.177) (-1163.242) -- 0:00:41
325000 -- (-1161.450) [-1162.615] (-1162.356) (-1162.971) * (-1164.142) (-1161.469) (-1163.997) [-1161.327] -- 0:00:41
Average standard deviation of split frequencies: 0.010990
325500 -- (-1161.354) (-1166.577) (-1165.871) [-1164.893] * (-1161.412) (-1164.661) [-1164.453] (-1162.952) -- 0:00:41
326000 -- (-1163.797) (-1166.070) (-1166.555) [-1162.708] * [-1162.698] (-1165.450) (-1163.301) (-1166.646) -- 0:00:41
326500 -- [-1163.280] (-1164.067) (-1164.322) (-1163.143) * (-1161.477) [-1161.205] (-1164.124) (-1167.445) -- 0:00:41
327000 -- (-1165.415) [-1161.779] (-1167.021) (-1163.408) * (-1161.649) [-1163.242] (-1162.499) (-1163.828) -- 0:00:41
327500 -- (-1163.387) [-1161.862] (-1161.752) (-1163.146) * [-1163.128] (-1166.383) (-1162.159) (-1161.059) -- 0:00:41
328000 -- (-1161.995) [-1161.576] (-1162.758) (-1165.034) * (-1162.841) [-1167.810] (-1163.742) (-1162.971) -- 0:00:40
328500 -- (-1161.372) (-1162.710) [-1161.782] (-1164.620) * [-1163.832] (-1161.759) (-1167.041) (-1162.210) -- 0:00:40
329000 -- [-1162.906] (-1162.109) (-1161.774) (-1167.246) * (-1164.458) (-1163.180) (-1165.836) [-1163.382] -- 0:00:40
329500 -- [-1161.492] (-1162.558) (-1164.602) (-1163.777) * (-1161.342) (-1163.231) [-1166.880] (-1163.932) -- 0:00:40
330000 -- (-1162.815) (-1165.343) [-1163.084] (-1162.137) * (-1162.443) (-1162.085) (-1165.081) [-1162.044] -- 0:00:40
Average standard deviation of split frequencies: 0.009409
330500 -- (-1160.833) [-1161.643] (-1164.857) (-1161.680) * (-1165.477) (-1165.070) (-1168.742) [-1162.260] -- 0:00:40
331000 -- (-1161.590) (-1163.336) (-1162.694) [-1161.764] * (-1163.381) [-1161.853] (-1161.696) (-1162.008) -- 0:00:40
331500 -- (-1161.765) [-1162.237] (-1164.304) (-1161.858) * (-1165.333) (-1163.028) (-1163.279) [-1161.867] -- 0:00:40
332000 -- (-1162.831) [-1162.507] (-1165.706) (-1162.036) * [-1165.565] (-1163.786) (-1162.979) (-1163.055) -- 0:00:40
332500 -- (-1162.147) [-1162.856] (-1165.415) (-1164.537) * (-1163.221) (-1165.730) (-1164.008) [-1162.048] -- 0:00:40
333000 -- [-1163.909] (-1162.807) (-1162.272) (-1162.338) * (-1167.898) (-1162.973) (-1162.299) [-1162.024] -- 0:00:42
333500 -- [-1163.971] (-1162.727) (-1162.459) (-1162.528) * (-1168.293) [-1162.124] (-1167.396) (-1165.327) -- 0:00:41
334000 -- (-1164.909) (-1170.866) [-1162.398] (-1162.206) * (-1161.524) (-1163.223) (-1164.706) [-1162.978] -- 0:00:41
334500 -- (-1169.557) (-1163.447) (-1162.950) [-1161.911] * [-1165.708] (-1162.929) (-1161.637) (-1165.053) -- 0:00:41
335000 -- (-1166.867) (-1165.932) (-1165.728) [-1163.166] * [-1164.450] (-1164.790) (-1162.565) (-1163.191) -- 0:00:41
Average standard deviation of split frequencies: 0.009821
335500 -- [-1163.054] (-1161.461) (-1161.838) (-1164.020) * (-1165.178) [-1162.739] (-1163.043) (-1163.461) -- 0:00:41
336000 -- (-1163.574) (-1163.181) (-1163.368) [-1163.836] * (-1164.303) (-1167.191) (-1166.268) [-1164.638] -- 0:00:41
336500 -- (-1164.063) (-1163.138) [-1162.625] (-1162.811) * [-1163.274] (-1163.772) (-1165.891) (-1163.341) -- 0:00:41
337000 -- (-1163.182) (-1161.285) (-1165.308) [-1161.595] * (-1161.063) (-1162.908) [-1162.573] (-1163.759) -- 0:00:41
337500 -- [-1161.280] (-1164.053) (-1163.480) (-1164.695) * [-1161.067] (-1162.469) (-1161.892) (-1161.715) -- 0:00:41
338000 -- (-1163.104) (-1161.973) [-1165.374] (-1164.431) * (-1163.443) (-1162.138) (-1161.975) [-1161.705] -- 0:00:41
338500 -- (-1165.170) [-1161.803] (-1169.083) (-1163.683) * (-1166.778) (-1162.931) [-1166.362] (-1161.646) -- 0:00:41
339000 -- (-1161.885) [-1161.729] (-1162.468) (-1162.808) * (-1170.714) [-1162.704] (-1167.255) (-1161.694) -- 0:00:40
339500 -- (-1161.250) [-1163.018] (-1165.537) (-1162.063) * (-1168.185) [-1161.637] (-1164.393) (-1161.683) -- 0:00:40
340000 -- (-1162.775) [-1162.600] (-1165.627) (-1161.143) * (-1166.308) (-1162.514) [-1163.821] (-1163.171) -- 0:00:40
Average standard deviation of split frequencies: 0.010793
340500 -- (-1162.021) (-1166.974) [-1161.878] (-1161.654) * (-1164.418) [-1162.560] (-1163.891) (-1165.140) -- 0:00:40
341000 -- (-1162.684) (-1164.229) (-1162.376) [-1161.163] * (-1163.538) [-1163.413] (-1165.864) (-1168.492) -- 0:00:40
341500 -- (-1164.751) (-1162.984) [-1162.373] (-1161.580) * (-1162.912) (-1162.594) [-1163.866] (-1165.596) -- 0:00:40
342000 -- (-1165.047) (-1161.547) (-1162.181) [-1160.932] * (-1161.437) (-1161.506) (-1161.845) [-1162.004] -- 0:00:40
342500 -- [-1162.930] (-1167.502) (-1165.916) (-1163.238) * (-1163.018) (-1161.488) (-1164.468) [-1162.859] -- 0:00:40
343000 -- (-1166.256) (-1162.934) [-1162.662] (-1164.333) * (-1162.551) [-1161.481] (-1165.035) (-1163.175) -- 0:00:40
343500 -- (-1169.549) (-1165.031) (-1165.954) [-1161.258] * (-1163.514) [-1162.033] (-1165.368) (-1162.972) -- 0:00:40
344000 -- (-1162.259) (-1162.455) [-1161.570] (-1161.258) * (-1162.146) (-1161.325) (-1164.701) [-1163.400] -- 0:00:40
344500 -- (-1164.749) (-1162.926) (-1167.569) [-1162.743] * (-1161.892) [-1161.807] (-1161.463) (-1170.511) -- 0:00:39
345000 -- (-1171.901) [-1163.564] (-1164.255) (-1162.216) * (-1162.956) (-1164.563) [-1161.340] (-1165.182) -- 0:00:39
Average standard deviation of split frequencies: 0.010082
345500 -- (-1165.658) (-1162.870) [-1164.460] (-1167.497) * (-1164.954) (-1162.569) (-1163.801) [-1164.112] -- 0:00:39
346000 -- (-1166.856) [-1165.942] (-1162.299) (-1163.632) * [-1163.302] (-1166.337) (-1162.383) (-1168.338) -- 0:00:39
346500 -- (-1161.562) (-1162.050) (-1162.559) [-1161.788] * (-1162.471) (-1166.710) (-1164.007) [-1168.944] -- 0:00:39
347000 -- (-1163.217) (-1164.087) (-1163.294) [-1163.800] * (-1160.905) (-1164.047) (-1165.523) [-1165.268] -- 0:00:39
347500 -- (-1166.550) (-1162.119) (-1166.759) [-1162.650] * (-1163.869) (-1167.097) [-1162.276] (-1168.040) -- 0:00:39
348000 -- [-1161.455] (-1162.934) (-1165.913) (-1165.539) * (-1163.794) (-1162.030) [-1161.376] (-1164.308) -- 0:00:39
348500 -- (-1162.903) [-1162.228] (-1163.376) (-1165.207) * (-1164.890) [-1162.065] (-1162.027) (-1165.079) -- 0:00:39
349000 -- (-1162.070) [-1163.631] (-1164.217) (-1166.079) * (-1162.266) [-1163.232] (-1164.155) (-1163.080) -- 0:00:39
349500 -- (-1163.387) [-1162.399] (-1166.951) (-1162.865) * [-1165.945] (-1162.245) (-1163.354) (-1163.910) -- 0:00:40
350000 -- (-1163.685) (-1163.205) (-1162.225) [-1162.293] * (-1164.322) (-1167.001) (-1162.189) [-1164.080] -- 0:00:40
Average standard deviation of split frequencies: 0.008066
350500 -- (-1163.035) (-1165.774) (-1161.332) [-1161.745] * (-1161.938) (-1163.743) [-1163.590] (-1168.712) -- 0:00:40
351000 -- [-1162.306] (-1162.718) (-1162.636) (-1161.495) * [-1163.411] (-1164.577) (-1161.957) (-1163.408) -- 0:00:40
351500 -- (-1162.672) (-1167.331) [-1162.632] (-1163.408) * (-1166.896) (-1164.467) (-1163.544) [-1162.328] -- 0:00:40
352000 -- (-1168.054) (-1164.073) [-1163.129] (-1161.272) * (-1164.146) (-1162.797) (-1162.158) [-1162.536] -- 0:00:40
352500 -- (-1163.709) (-1162.623) (-1161.093) [-1161.222] * [-1162.650] (-1162.906) (-1164.552) (-1162.820) -- 0:00:40
353000 -- (-1162.922) (-1165.731) (-1162.110) [-1163.243] * [-1162.444] (-1162.384) (-1164.087) (-1163.926) -- 0:00:40
353500 -- [-1162.904] (-1162.116) (-1164.136) (-1163.620) * (-1165.000) (-1165.161) [-1164.183] (-1165.914) -- 0:00:40
354000 -- (-1163.378) [-1162.550] (-1164.002) (-1162.958) * (-1165.972) (-1162.563) [-1162.191] (-1163.426) -- 0:00:40
354500 -- (-1161.888) (-1162.346) [-1161.210] (-1163.520) * (-1164.606) [-1163.354] (-1161.342) (-1164.803) -- 0:00:40
355000 -- [-1161.685] (-1163.729) (-1161.503) (-1163.616) * (-1169.978) (-1162.417) [-1161.406] (-1163.016) -- 0:00:39
Average standard deviation of split frequencies: 0.008210
355500 -- [-1161.307] (-1165.122) (-1161.503) (-1165.961) * (-1166.795) (-1164.330) [-1162.194] (-1161.872) -- 0:00:39
356000 -- [-1162.158] (-1162.320) (-1161.503) (-1162.281) * (-1165.167) (-1166.091) (-1164.272) [-1161.793] -- 0:00:39
356500 -- [-1163.167] (-1163.832) (-1164.209) (-1162.768) * [-1162.802] (-1164.543) (-1163.449) (-1161.566) -- 0:00:39
357000 -- (-1166.668) [-1161.798] (-1164.010) (-1166.114) * (-1163.682) (-1164.716) (-1162.186) [-1163.611] -- 0:00:39
357500 -- (-1163.370) (-1160.987) (-1166.310) [-1163.886] * (-1165.124) (-1166.175) [-1163.737] (-1161.302) -- 0:00:39
358000 -- (-1162.311) [-1160.987] (-1163.957) (-1176.666) * [-1164.110] (-1163.661) (-1163.823) (-1161.300) -- 0:00:39
358500 -- [-1163.991] (-1162.198) (-1163.243) (-1165.626) * (-1162.481) [-1162.768] (-1164.437) (-1161.491) -- 0:00:39
359000 -- (-1165.720) (-1162.406) [-1163.275] (-1165.481) * (-1160.987) [-1164.451] (-1160.891) (-1161.748) -- 0:00:39
359500 -- (-1165.589) (-1162.541) (-1166.332) [-1161.335] * (-1165.637) (-1161.602) [-1162.957] (-1166.031) -- 0:00:39
360000 -- [-1163.662] (-1168.292) (-1163.132) (-1163.960) * (-1163.111) (-1163.899) (-1163.729) [-1163.407] -- 0:00:39
Average standard deviation of split frequencies: 0.008626
360500 -- (-1163.416) [-1169.755] (-1161.764) (-1161.669) * (-1162.980) (-1164.762) (-1162.797) [-1163.297] -- 0:00:39
361000 -- (-1163.126) [-1163.419] (-1161.627) (-1163.924) * (-1165.541) [-1164.391] (-1161.619) (-1164.467) -- 0:00:38
361500 -- (-1163.621) (-1162.904) (-1162.787) [-1163.838] * (-1162.396) [-1164.054] (-1161.365) (-1162.678) -- 0:00:38
362000 -- (-1165.951) [-1162.241] (-1161.892) (-1162.865) * [-1163.737] (-1163.115) (-1161.462) (-1161.832) -- 0:00:38
362500 -- (-1162.828) (-1162.822) [-1161.790] (-1162.725) * [-1164.943] (-1166.159) (-1161.424) (-1163.749) -- 0:00:38
363000 -- (-1161.348) (-1166.899) (-1161.850) [-1164.129] * (-1163.054) (-1165.903) (-1162.305) [-1162.525] -- 0:00:38
363500 -- (-1162.711) (-1163.101) [-1162.308] (-1161.780) * (-1162.739) (-1166.181) (-1161.936) [-1165.532] -- 0:00:38
364000 -- [-1163.820] (-1162.029) (-1162.639) (-1161.918) * (-1163.127) (-1161.190) [-1163.072] (-1161.096) -- 0:00:38
364500 -- (-1164.807) (-1162.375) [-1162.915] (-1162.926) * (-1162.361) [-1161.241] (-1168.381) (-1162.783) -- 0:00:40
365000 -- (-1166.721) (-1162.812) [-1165.760] (-1164.251) * (-1162.226) (-1162.374) (-1164.816) [-1167.501] -- 0:00:40
Average standard deviation of split frequencies: 0.007213
365500 -- (-1168.755) (-1161.389) (-1162.272) [-1164.998] * (-1163.324) (-1166.378) [-1161.836] (-1164.805) -- 0:00:39
366000 -- [-1163.627] (-1163.758) (-1161.511) (-1163.461) * (-1162.163) (-1166.568) [-1164.300] (-1163.560) -- 0:00:39
366500 -- (-1164.636) [-1163.580] (-1163.955) (-1165.864) * [-1162.866] (-1163.648) (-1166.430) (-1164.302) -- 0:00:39
367000 -- [-1162.390] (-1163.898) (-1164.049) (-1162.321) * [-1163.452] (-1163.055) (-1168.865) (-1162.592) -- 0:00:39
367500 -- [-1161.238] (-1166.397) (-1166.362) (-1161.501) * (-1163.933) [-1168.418] (-1164.738) (-1165.067) -- 0:00:39
368000 -- (-1162.678) (-1161.646) (-1162.333) [-1162.843] * (-1162.784) (-1163.877) (-1163.897) [-1164.830] -- 0:00:39
368500 -- (-1167.034) (-1169.576) [-1163.203] (-1163.433) * (-1163.768) [-1166.374] (-1163.698) (-1166.323) -- 0:00:39
369000 -- (-1162.837) [-1164.661] (-1164.053) (-1161.841) * (-1163.335) (-1165.196) [-1161.424] (-1163.917) -- 0:00:39
369500 -- (-1163.789) (-1163.983) [-1163.885] (-1161.760) * (-1162.674) (-1167.227) [-1161.803] (-1165.148) -- 0:00:39
370000 -- (-1162.805) [-1162.495] (-1162.235) (-1161.687) * [-1161.854] (-1165.038) (-1162.459) (-1163.555) -- 0:00:39
Average standard deviation of split frequencies: 0.007376
370500 -- (-1163.635) (-1162.139) [-1163.154] (-1161.132) * (-1161.956) (-1165.684) [-1162.522] (-1163.336) -- 0:00:39
371000 -- (-1163.262) [-1168.789] (-1162.700) (-1162.181) * (-1164.987) [-1163.523] (-1162.572) (-1162.757) -- 0:00:38
371500 -- (-1164.159) (-1168.836) [-1162.759] (-1161.025) * (-1161.121) (-1162.523) (-1162.621) [-1161.950] -- 0:00:38
372000 -- (-1166.904) (-1162.532) [-1161.738] (-1160.936) * (-1163.277) (-1162.605) [-1162.725] (-1161.452) -- 0:00:38
372500 -- (-1165.131) [-1161.943] (-1161.495) (-1164.240) * (-1167.682) (-1163.155) (-1163.208) [-1162.897] -- 0:00:38
373000 -- (-1162.768) (-1161.409) (-1165.025) [-1161.648] * (-1161.982) (-1162.219) [-1162.499] (-1162.903) -- 0:00:38
373500 -- (-1164.199) (-1162.276) (-1161.639) [-1164.348] * (-1162.614) (-1162.083) (-1164.618) [-1161.869] -- 0:00:38
374000 -- (-1166.407) [-1162.231] (-1161.417) (-1165.201) * (-1162.550) (-1162.094) [-1163.415] (-1165.357) -- 0:00:38
374500 -- [-1162.124] (-1163.665) (-1163.416) (-1164.324) * (-1162.070) (-1165.476) (-1163.999) [-1162.214] -- 0:00:38
375000 -- (-1162.009) [-1164.590] (-1161.474) (-1166.350) * (-1161.078) [-1163.165] (-1164.671) (-1162.537) -- 0:00:38
Average standard deviation of split frequencies: 0.008275
375500 -- [-1164.498] (-1168.105) (-1161.566) (-1164.505) * (-1163.254) (-1163.655) [-1167.253] (-1162.846) -- 0:00:38
376000 -- (-1167.655) [-1161.283] (-1164.286) (-1164.055) * (-1161.039) (-1161.207) (-1163.841) [-1163.658] -- 0:00:38
376500 -- (-1165.596) [-1161.281] (-1163.374) (-1163.035) * (-1161.323) [-1161.328] (-1161.479) (-1166.172) -- 0:00:38
377000 -- (-1163.863) [-1161.074] (-1163.669) (-1163.001) * (-1162.344) (-1161.448) (-1164.108) [-1163.396] -- 0:00:38
377500 -- (-1165.623) (-1161.545) [-1161.626] (-1163.121) * [-1165.142] (-1164.299) (-1161.566) (-1163.608) -- 0:00:37
378000 -- (-1162.350) [-1161.790] (-1161.240) (-1164.173) * (-1170.205) (-1166.836) (-1161.442) [-1163.388] -- 0:00:37
378500 -- [-1163.800] (-1162.976) (-1167.061) (-1163.576) * (-1168.422) (-1165.743) (-1161.834) [-1164.116] -- 0:00:37
379000 -- (-1162.051) [-1162.279] (-1164.058) (-1164.747) * (-1169.723) [-1162.330] (-1161.785) (-1161.923) -- 0:00:37
379500 -- (-1164.504) [-1165.981] (-1164.513) (-1164.230) * [-1164.244] (-1162.638) (-1161.449) (-1161.831) -- 0:00:39
380000 -- (-1166.363) (-1163.460) (-1165.167) [-1161.566] * (-1163.023) [-1162.491] (-1161.564) (-1162.152) -- 0:00:39
Average standard deviation of split frequencies: 0.008421
380500 -- (-1163.286) (-1162.966) (-1161.141) [-1161.549] * (-1163.710) (-1162.798) (-1162.553) [-1162.373] -- 0:00:39
381000 -- [-1163.063] (-1163.203) (-1160.970) (-1161.941) * (-1161.683) (-1164.062) [-1162.769] (-1164.992) -- 0:00:38
381500 -- (-1162.018) (-1165.078) (-1161.030) [-1161.870] * (-1163.394) (-1165.153) (-1163.813) [-1162.046] -- 0:00:38
382000 -- [-1160.994] (-1164.168) (-1163.057) (-1162.151) * (-1163.586) (-1163.950) [-1164.661] (-1164.556) -- 0:00:38
382500 -- (-1163.974) (-1164.414) (-1163.926) [-1163.285] * (-1162.172) [-1162.688] (-1167.315) (-1161.796) -- 0:00:38
383000 -- (-1161.191) (-1164.622) (-1161.482) [-1163.952] * (-1161.815) (-1165.338) (-1167.507) [-1163.768] -- 0:00:38
383500 -- (-1165.697) (-1163.320) [-1161.591] (-1165.631) * (-1162.861) (-1167.450) (-1162.279) [-1162.314] -- 0:00:38
384000 -- (-1162.277) (-1163.890) [-1162.865] (-1165.620) * (-1165.167) (-1162.911) [-1164.521] (-1162.036) -- 0:00:38
384500 -- [-1162.862] (-1164.488) (-1162.286) (-1166.702) * (-1163.132) (-1167.155) [-1166.873] (-1161.074) -- 0:00:38
385000 -- (-1165.157) [-1163.963] (-1163.262) (-1163.467) * (-1165.133) (-1163.885) [-1165.687] (-1164.725) -- 0:00:38
Average standard deviation of split frequencies: 0.008549
385500 -- (-1163.773) [-1162.805] (-1161.730) (-1165.099) * [-1162.614] (-1163.302) (-1162.015) (-1169.453) -- 0:00:38
386000 -- (-1163.119) (-1163.714) (-1162.797) [-1162.800] * (-1163.848) (-1162.194) [-1163.241] (-1167.870) -- 0:00:38
386500 -- (-1163.732) (-1163.182) (-1162.661) [-1165.007] * [-1163.310] (-1162.087) (-1161.693) (-1170.733) -- 0:00:38
387000 -- (-1162.152) (-1161.277) (-1161.999) [-1163.286] * (-1164.369) (-1163.602) (-1162.219) [-1161.830] -- 0:00:38
387500 -- [-1163.722] (-1163.713) (-1165.892) (-1165.215) * (-1161.628) (-1162.818) [-1161.927] (-1161.120) -- 0:00:37
388000 -- (-1163.559) (-1162.052) (-1161.453) [-1161.185] * (-1168.781) [-1163.493] (-1164.761) (-1161.123) -- 0:00:37
388500 -- (-1162.544) (-1162.985) (-1162.828) [-1161.678] * [-1161.133] (-1165.182) (-1166.281) (-1168.251) -- 0:00:37
389000 -- (-1163.234) (-1162.216) [-1161.963] (-1161.265) * (-1162.479) [-1161.853] (-1166.844) (-1162.687) -- 0:00:37
389500 -- (-1169.333) [-1161.239] (-1161.920) (-1165.080) * (-1163.829) [-1166.387] (-1164.474) (-1163.048) -- 0:00:37
390000 -- (-1162.022) (-1161.845) (-1162.205) [-1163.772] * (-1165.133) [-1168.265] (-1163.386) (-1163.372) -- 0:00:37
Average standard deviation of split frequencies: 0.009412
390500 -- [-1162.936] (-1162.936) (-1164.344) (-1163.871) * (-1168.666) (-1164.644) [-1161.497] (-1162.518) -- 0:00:37
391000 -- [-1163.583] (-1162.995) (-1164.237) (-1163.592) * (-1170.267) (-1160.815) [-1161.179] (-1163.588) -- 0:00:37
391500 -- (-1166.992) (-1163.693) [-1163.631] (-1161.991) * [-1161.723] (-1161.116) (-1161.820) (-1161.921) -- 0:00:37
392000 -- (-1165.375) (-1163.823) [-1162.869] (-1162.551) * [-1165.446] (-1165.107) (-1163.684) (-1162.255) -- 0:00:37
392500 -- (-1162.659) (-1162.175) [-1167.673] (-1161.997) * [-1161.758] (-1162.820) (-1161.551) (-1162.692) -- 0:00:37
393000 -- (-1167.873) [-1161.738] (-1161.619) (-1166.309) * [-1162.608] (-1161.479) (-1163.121) (-1163.223) -- 0:00:37
393500 -- (-1163.142) (-1162.319) [-1162.345] (-1170.415) * (-1162.216) (-1165.005) (-1162.296) [-1163.604] -- 0:00:36
394000 -- [-1163.960] (-1162.723) (-1164.070) (-1163.040) * [-1163.039] (-1167.257) (-1162.385) (-1162.202) -- 0:00:36
394500 -- [-1167.619] (-1163.744) (-1162.617) (-1163.335) * (-1166.619) (-1164.242) (-1163.958) [-1162.486] -- 0:00:36
395000 -- [-1162.347] (-1165.849) (-1163.969) (-1164.732) * [-1164.118] (-1162.713) (-1163.121) (-1163.076) -- 0:00:36
Average standard deviation of split frequencies: 0.009523
395500 -- (-1166.045) (-1165.982) [-1163.868] (-1163.277) * (-1163.159) (-1161.970) [-1164.505] (-1162.712) -- 0:00:36
396000 -- (-1161.554) [-1165.999] (-1162.291) (-1162.446) * (-1164.095) [-1161.960] (-1162.414) (-1162.102) -- 0:00:36
396500 -- (-1162.034) (-1167.171) (-1161.748) [-1165.169] * (-1162.246) (-1161.199) (-1166.847) [-1165.203] -- 0:00:38
397000 -- [-1161.895] (-1163.147) (-1162.936) (-1162.905) * (-1162.716) [-1163.869] (-1164.219) (-1161.686) -- 0:00:37
397500 -- [-1162.106] (-1162.230) (-1163.498) (-1163.851) * (-1162.262) [-1163.309] (-1163.268) (-1160.903) -- 0:00:37
398000 -- (-1161.092) [-1161.812] (-1163.624) (-1165.519) * [-1165.682] (-1165.856) (-1163.864) (-1161.655) -- 0:00:37
398500 -- [-1160.783] (-1161.415) (-1164.389) (-1164.314) * [-1165.043] (-1165.361) (-1161.791) (-1161.163) -- 0:00:37
399000 -- [-1161.868] (-1161.178) (-1162.154) (-1162.890) * (-1161.963) [-1168.102] (-1161.738) (-1161.257) -- 0:00:37
399500 -- (-1167.788) (-1162.144) [-1162.774] (-1162.025) * (-1163.544) [-1164.674] (-1162.147) (-1165.113) -- 0:00:37
400000 -- (-1164.667) (-1166.345) (-1163.013) [-1161.341] * (-1166.189) (-1161.033) [-1163.048] (-1163.869) -- 0:00:37
Average standard deviation of split frequencies: 0.009648
400500 -- (-1163.859) (-1163.815) [-1163.743] (-1162.497) * [-1167.789] (-1164.319) (-1163.667) (-1163.017) -- 0:00:37
401000 -- [-1162.977] (-1164.057) (-1162.727) (-1162.776) * (-1167.090) [-1161.291] (-1161.810) (-1161.312) -- 0:00:37
401500 -- (-1163.834) (-1162.315) [-1162.730] (-1163.807) * (-1165.574) (-1164.580) [-1165.004] (-1164.253) -- 0:00:37
402000 -- (-1166.270) (-1162.886) (-1162.182) [-1164.336] * [-1165.041] (-1164.170) (-1163.291) (-1162.787) -- 0:00:37
402500 -- (-1166.902) (-1162.321) (-1162.210) [-1166.368] * (-1162.422) [-1163.292] (-1162.701) (-1163.074) -- 0:00:37
403000 -- (-1164.308) (-1164.033) [-1162.285] (-1165.832) * (-1165.740) [-1162.490] (-1163.345) (-1161.173) -- 0:00:37
403500 -- (-1161.696) (-1165.640) (-1161.406) [-1167.239] * (-1164.787) (-1162.022) [-1162.698] (-1162.760) -- 0:00:36
404000 -- (-1165.323) (-1167.959) [-1161.406] (-1162.413) * [-1162.530] (-1161.993) (-1164.308) (-1166.646) -- 0:00:36
404500 -- (-1161.752) (-1163.720) [-1161.575] (-1162.334) * (-1161.284) (-1162.268) [-1163.418] (-1162.995) -- 0:00:36
405000 -- [-1161.642] (-1164.110) (-1162.068) (-1161.483) * [-1161.736] (-1162.012) (-1162.738) (-1167.165) -- 0:00:36
Average standard deviation of split frequencies: 0.009521
405500 -- (-1167.423) (-1163.453) [-1162.433] (-1164.798) * (-1164.522) [-1161.807] (-1163.252) (-1165.900) -- 0:00:36
406000 -- (-1165.759) [-1160.736] (-1161.824) (-1165.231) * (-1163.800) (-1162.996) [-1163.185] (-1162.966) -- 0:00:36
406500 -- [-1163.909] (-1163.618) (-1161.954) (-1174.449) * [-1163.751] (-1163.323) (-1162.560) (-1162.638) -- 0:00:36
407000 -- (-1163.009) (-1162.590) [-1163.046] (-1163.357) * (-1164.876) [-1162.713] (-1163.285) (-1164.455) -- 0:00:36
407500 -- (-1161.642) (-1163.225) (-1166.535) [-1164.349] * (-1164.784) (-1163.457) (-1163.396) [-1163.100] -- 0:00:36
408000 -- (-1163.759) [-1163.142] (-1165.373) (-1163.281) * [-1161.363] (-1163.543) (-1161.653) (-1161.871) -- 0:00:36
408500 -- (-1161.503) [-1161.096] (-1162.613) (-1162.219) * [-1162.300] (-1164.631) (-1161.959) (-1163.494) -- 0:00:36
409000 -- (-1161.300) [-1161.595] (-1164.242) (-1161.343) * [-1162.356] (-1161.280) (-1164.418) (-1161.537) -- 0:00:36
409500 -- [-1164.136] (-1163.547) (-1165.832) (-1161.658) * [-1162.020] (-1164.601) (-1162.717) (-1164.321) -- 0:00:36
410000 -- (-1165.990) (-1161.917) (-1162.411) [-1162.985] * (-1162.343) (-1164.829) [-1164.943] (-1161.707) -- 0:00:35
Average standard deviation of split frequencies: 0.009872
410500 -- [-1165.106] (-1161.513) (-1164.940) (-1163.544) * (-1161.452) (-1162.755) (-1165.059) [-1164.753] -- 0:00:35
411000 -- (-1162.820) [-1161.475] (-1161.660) (-1163.843) * [-1161.915] (-1163.107) (-1163.266) (-1162.973) -- 0:00:35
411500 -- (-1163.934) (-1161.095) [-1161.383] (-1164.863) * (-1162.876) [-1164.143] (-1161.907) (-1162.400) -- 0:00:35
412000 -- (-1161.016) (-1163.090) [-1161.493] (-1162.590) * (-1166.187) (-1164.166) [-1164.657] (-1162.326) -- 0:00:35
412500 -- (-1160.905) (-1162.408) (-1165.699) [-1162.041] * (-1164.144) (-1162.332) [-1162.593] (-1163.042) -- 0:00:35
413000 -- (-1164.185) (-1162.250) (-1165.555) [-1161.377] * (-1161.714) (-1163.388) (-1160.971) [-1161.603] -- 0:00:35
413500 -- (-1167.160) (-1162.237) (-1168.418) [-1161.324] * (-1162.598) (-1162.871) (-1166.778) [-1162.080] -- 0:00:36
414000 -- (-1163.763) (-1162.539) (-1166.013) [-1161.680] * (-1164.878) [-1161.459] (-1162.579) (-1163.043) -- 0:00:36
414500 -- (-1166.916) [-1162.558] (-1166.053) (-1161.934) * (-1161.682) (-1167.498) (-1162.721) [-1164.728] -- 0:00:36
415000 -- [-1163.507] (-1161.463) (-1164.875) (-1161.899) * (-1161.742) [-1161.905] (-1164.046) (-1162.535) -- 0:00:36
Average standard deviation of split frequencies: 0.011558
415500 -- (-1163.808) (-1164.455) [-1167.062] (-1162.261) * [-1162.988] (-1161.796) (-1170.378) (-1161.998) -- 0:00:36
416000 -- (-1162.141) [-1164.397] (-1164.391) (-1161.751) * (-1162.919) (-1161.725) (-1163.486) [-1162.028] -- 0:00:36
416500 -- (-1161.409) (-1164.881) [-1163.038] (-1163.844) * [-1162.805] (-1162.352) (-1165.500) (-1167.893) -- 0:00:36
417000 -- (-1161.457) [-1169.187] (-1164.302) (-1162.575) * (-1161.256) (-1162.385) [-1162.197] (-1163.003) -- 0:00:36
417500 -- [-1164.295] (-1164.343) (-1162.438) (-1162.702) * (-1161.759) (-1165.631) [-1164.836] (-1163.447) -- 0:00:36
418000 -- (-1162.947) (-1162.153) [-1164.132] (-1161.975) * (-1166.712) [-1162.471] (-1161.701) (-1164.829) -- 0:00:36
418500 -- (-1164.295) [-1163.836] (-1163.614) (-1162.288) * (-1162.999) [-1164.961] (-1165.956) (-1161.476) -- 0:00:36
419000 -- (-1166.176) [-1162.005] (-1161.537) (-1164.471) * (-1164.415) (-1165.061) (-1161.686) [-1162.120] -- 0:00:36
419500 -- (-1166.105) (-1166.425) [-1162.476] (-1163.236) * [-1163.664] (-1165.348) (-1164.096) (-1162.813) -- 0:00:35
420000 -- [-1163.852] (-1165.600) (-1163.945) (-1162.131) * (-1162.044) (-1165.287) (-1163.815) [-1161.281] -- 0:00:35
Average standard deviation of split frequencies: 0.010534
420500 -- [-1162.564] (-1165.715) (-1161.759) (-1166.675) * [-1164.345] (-1163.445) (-1164.342) (-1165.164) -- 0:00:35
421000 -- (-1167.980) [-1162.975] (-1162.723) (-1162.008) * [-1161.960] (-1161.252) (-1162.131) (-1162.976) -- 0:00:35
421500 -- (-1165.740) (-1165.895) [-1161.452] (-1161.987) * [-1164.414] (-1164.138) (-1164.518) (-1162.848) -- 0:00:35
422000 -- (-1169.799) (-1165.605) [-1161.292] (-1164.307) * (-1162.980) (-1166.634) (-1163.601) [-1162.561] -- 0:00:35
422500 -- (-1161.527) [-1162.565] (-1161.042) (-1163.626) * (-1165.627) (-1165.633) (-1161.665) [-1161.938] -- 0:00:35
423000 -- (-1161.499) (-1164.291) (-1164.463) [-1161.887] * [-1167.635] (-1165.029) (-1162.160) (-1164.238) -- 0:00:35
423500 -- [-1163.141] (-1164.850) (-1163.326) (-1162.051) * (-1163.052) [-1164.337] (-1166.769) (-1162.564) -- 0:00:35
424000 -- [-1164.055] (-1166.332) (-1162.730) (-1164.639) * (-1163.982) [-1163.006] (-1164.397) (-1162.520) -- 0:00:35
424500 -- (-1164.468) [-1164.875] (-1164.250) (-1166.653) * (-1163.557) [-1161.519] (-1162.925) (-1161.689) -- 0:00:35
425000 -- (-1164.730) (-1166.201) (-1164.862) [-1163.001] * [-1162.562] (-1162.293) (-1162.179) (-1163.953) -- 0:00:35
Average standard deviation of split frequencies: 0.010181
425500 -- (-1163.428) (-1164.867) (-1165.455) [-1161.914] * (-1165.644) (-1164.250) (-1163.483) [-1161.367] -- 0:00:35
426000 -- (-1166.359) [-1161.283] (-1162.630) (-1163.850) * (-1165.260) (-1164.030) [-1165.304] (-1162.834) -- 0:00:35
426500 -- (-1165.519) (-1162.421) [-1164.887] (-1161.988) * (-1168.430) (-1164.388) (-1164.165) [-1162.778] -- 0:00:34
427000 -- (-1163.365) [-1161.747] (-1163.491) (-1162.195) * (-1164.319) (-1164.393) (-1161.394) [-1163.669] -- 0:00:34
427500 -- (-1163.130) (-1161.058) [-1164.130] (-1162.277) * (-1166.707) [-1164.469] (-1163.216) (-1162.093) -- 0:00:34
428000 -- (-1162.839) [-1163.518] (-1164.270) (-1163.851) * (-1163.746) (-1162.745) [-1162.167] (-1163.146) -- 0:00:34
428500 -- (-1162.859) [-1162.997] (-1162.894) (-1167.169) * [-1162.966] (-1165.618) (-1163.067) (-1161.876) -- 0:00:34
429000 -- (-1161.695) [-1161.740] (-1165.552) (-1162.658) * [-1161.535] (-1162.650) (-1162.040) (-1162.220) -- 0:00:34
429500 -- (-1164.469) (-1165.542) (-1161.971) [-1161.250] * (-1162.600) (-1162.148) [-1163.376] (-1162.073) -- 0:00:35
430000 -- [-1162.123] (-1165.885) (-1165.725) (-1163.491) * (-1161.815) (-1162.582) (-1162.942) [-1162.439] -- 0:00:35
Average standard deviation of split frequencies: 0.010508
430500 -- (-1163.198) (-1163.803) (-1163.382) [-1161.150] * (-1162.382) [-1161.115] (-1165.000) (-1161.814) -- 0:00:35
431000 -- [-1164.519] (-1164.870) (-1162.828) (-1161.628) * (-1161.176) (-1164.059) (-1164.554) [-1162.234] -- 0:00:35
431500 -- (-1163.637) (-1162.698) (-1162.539) [-1161.524] * (-1161.778) [-1161.231] (-1162.624) (-1164.178) -- 0:00:35
432000 -- [-1161.933] (-1164.239) (-1163.742) (-1161.579) * (-1165.817) (-1164.277) [-1163.011] (-1164.372) -- 0:00:35
432500 -- (-1162.818) (-1162.054) (-1163.104) [-1163.959] * (-1161.935) [-1164.434] (-1163.877) (-1164.819) -- 0:00:35
433000 -- (-1165.581) (-1164.368) (-1162.588) [-1162.027] * [-1161.010] (-1165.428) (-1162.793) (-1164.711) -- 0:00:35
433500 -- (-1164.403) (-1163.021) [-1161.315] (-1162.275) * (-1162.092) (-1162.400) [-1162.236] (-1164.111) -- 0:00:35
434000 -- [-1162.134] (-1170.405) (-1161.907) (-1161.870) * (-1162.476) [-1161.864] (-1161.777) (-1165.734) -- 0:00:35
434500 -- (-1162.425) (-1163.837) (-1163.183) [-1167.836] * (-1162.937) (-1164.351) (-1163.620) [-1164.470] -- 0:00:35
435000 -- [-1161.095] (-1162.314) (-1162.239) (-1164.335) * (-1163.826) (-1161.645) [-1166.236] (-1163.335) -- 0:00:35
Average standard deviation of split frequencies: 0.011677
435500 -- [-1161.433] (-1162.060) (-1164.212) (-1162.384) * (-1162.772) [-1162.699] (-1163.888) (-1163.312) -- 0:00:34
436000 -- (-1161.436) (-1162.272) [-1163.370] (-1162.512) * (-1160.991) (-1165.031) (-1165.502) [-1163.365] -- 0:00:34
436500 -- [-1163.149] (-1161.741) (-1166.217) (-1163.838) * (-1162.403) (-1165.751) [-1162.068] (-1164.476) -- 0:00:34
437000 -- (-1162.703) [-1161.483] (-1163.667) (-1164.136) * (-1162.256) (-1169.419) [-1163.425] (-1164.612) -- 0:00:34
437500 -- [-1164.778] (-1164.089) (-1163.848) (-1162.801) * (-1161.535) [-1163.773] (-1161.868) (-1163.663) -- 0:00:34
438000 -- (-1163.864) (-1162.991) (-1164.533) [-1162.495] * (-1163.650) (-1163.677) [-1162.346] (-1163.167) -- 0:00:34
438500 -- (-1162.269) (-1165.195) (-1165.097) [-1163.101] * (-1162.593) [-1163.541] (-1163.356) (-1162.139) -- 0:00:34
439000 -- [-1161.169] (-1171.557) (-1163.326) (-1163.099) * (-1164.264) [-1163.271] (-1165.336) (-1171.049) -- 0:00:34
439500 -- [-1165.838] (-1165.601) (-1162.510) (-1161.629) * (-1164.876) (-1163.652) (-1162.947) [-1165.826] -- 0:00:34
440000 -- (-1164.053) [-1163.269] (-1166.690) (-1164.747) * (-1163.861) (-1164.010) (-1161.939) [-1165.354] -- 0:00:34
Average standard deviation of split frequencies: 0.011125
440500 -- (-1162.573) (-1162.712) [-1163.359] (-1162.582) * (-1166.102) (-1164.974) [-1162.528] (-1163.300) -- 0:00:34
441000 -- (-1165.426) [-1162.101] (-1168.699) (-1169.495) * (-1161.224) (-1165.508) [-1163.038] (-1165.319) -- 0:00:34
441500 -- (-1166.150) (-1163.226) [-1166.379] (-1169.503) * [-1161.304] (-1161.884) (-1163.277) (-1163.975) -- 0:00:34
442000 -- (-1163.878) [-1163.290] (-1163.640) (-1163.887) * (-1165.943) (-1163.908) [-1162.065] (-1164.130) -- 0:00:34
442500 -- (-1161.503) (-1162.714) (-1163.027) [-1162.150] * (-1166.223) [-1161.377] (-1164.044) (-1164.413) -- 0:00:34
443000 -- (-1163.444) (-1163.475) (-1162.447) [-1161.909] * (-1169.609) (-1162.402) (-1163.233) [-1163.309] -- 0:00:33
443500 -- (-1163.743) [-1162.300] (-1162.913) (-1162.007) * (-1162.457) (-1162.793) (-1163.549) [-1164.469] -- 0:00:33
444000 -- [-1163.701] (-1164.650) (-1164.293) (-1161.999) * (-1162.736) [-1161.648] (-1166.575) (-1167.663) -- 0:00:33
444500 -- (-1163.749) (-1163.299) (-1169.301) [-1162.717] * (-1162.381) (-1161.951) (-1165.944) [-1164.373] -- 0:00:33
445000 -- (-1163.479) [-1163.087] (-1162.748) (-1162.179) * [-1164.490] (-1163.175) (-1161.645) (-1164.978) -- 0:00:33
Average standard deviation of split frequencies: 0.011415
445500 -- (-1162.920) (-1163.174) [-1162.050] (-1161.712) * (-1166.916) [-1161.218] (-1162.440) (-1164.118) -- 0:00:34
446000 -- [-1165.957] (-1162.236) (-1162.620) (-1166.304) * [-1162.462] (-1161.122) (-1163.804) (-1162.394) -- 0:00:34
446500 -- (-1162.077) [-1161.774] (-1163.225) (-1164.322) * (-1164.841) (-1162.652) [-1165.691] (-1162.012) -- 0:00:34
447000 -- [-1163.549] (-1163.820) (-1164.254) (-1165.214) * (-1164.477) (-1162.598) [-1167.354] (-1161.313) -- 0:00:34
447500 -- [-1165.458] (-1164.345) (-1163.636) (-1162.356) * (-1165.414) [-1163.677] (-1164.437) (-1161.504) -- 0:00:34
448000 -- (-1164.328) (-1164.396) [-1161.713] (-1162.912) * (-1164.995) [-1161.428] (-1162.800) (-1162.884) -- 0:00:34
448500 -- (-1167.114) (-1162.430) (-1162.882) [-1164.120] * (-1163.315) (-1165.022) (-1162.964) [-1162.691] -- 0:00:34
449000 -- (-1162.147) (-1161.921) (-1161.341) [-1163.436] * (-1170.452) (-1165.727) (-1162.372) [-1166.899] -- 0:00:34
449500 -- (-1163.008) [-1161.361] (-1163.792) (-1163.419) * (-1166.518) (-1164.394) (-1162.062) [-1163.645] -- 0:00:34
450000 -- (-1161.983) (-1164.373) (-1165.205) [-1162.858] * (-1165.419) (-1165.783) [-1162.458] (-1164.067) -- 0:00:34
Average standard deviation of split frequencies: 0.012134
450500 -- (-1166.411) [-1162.782] (-1166.461) (-1165.440) * (-1162.127) [-1164.384] (-1161.901) (-1165.155) -- 0:00:34
451000 -- [-1162.416] (-1166.033) (-1162.100) (-1163.824) * (-1163.907) [-1164.826] (-1163.837) (-1164.074) -- 0:00:34
451500 -- [-1164.116] (-1162.705) (-1161.727) (-1163.004) * (-1165.050) [-1164.676] (-1163.548) (-1163.518) -- 0:00:34
452000 -- (-1163.833) (-1161.705) [-1164.688] (-1163.892) * (-1162.138) (-1164.673) (-1162.988) [-1161.543] -- 0:00:33
452500 -- (-1164.864) [-1163.422] (-1164.427) (-1161.947) * (-1162.463) [-1163.330] (-1161.420) (-1160.827) -- 0:00:33
453000 -- [-1162.571] (-1162.164) (-1163.538) (-1162.156) * [-1162.350] (-1166.009) (-1163.236) (-1161.208) -- 0:00:33
453500 -- (-1162.971) [-1162.341] (-1162.197) (-1165.701) * (-1164.597) (-1161.836) [-1164.154] (-1161.860) -- 0:00:33
454000 -- (-1161.795) [-1162.211] (-1162.424) (-1167.576) * [-1161.452] (-1163.876) (-1163.823) (-1161.654) -- 0:00:33
454500 -- (-1163.836) [-1163.984] (-1163.051) (-1165.881) * (-1162.008) (-1162.321) [-1161.141] (-1163.694) -- 0:00:33
455000 -- [-1164.760] (-1161.794) (-1166.153) (-1169.707) * (-1165.593) (-1162.888) (-1161.830) [-1162.199] -- 0:00:33
Average standard deviation of split frequencies: 0.012819
455500 -- (-1161.412) [-1161.706] (-1165.119) (-1167.380) * (-1162.289) [-1163.738] (-1165.585) (-1164.013) -- 0:00:33
456000 -- [-1162.335] (-1161.251) (-1162.886) (-1162.329) * (-1164.631) [-1164.598] (-1164.142) (-1163.154) -- 0:00:33
456500 -- (-1163.319) [-1163.671] (-1162.161) (-1164.855) * [-1163.448] (-1164.319) (-1165.760) (-1163.897) -- 0:00:33
457000 -- [-1166.480] (-1161.551) (-1165.546) (-1162.376) * (-1166.099) (-1164.561) (-1168.382) [-1163.063] -- 0:00:33
457500 -- (-1164.165) (-1165.232) [-1162.610] (-1164.810) * (-1164.640) [-1161.586] (-1163.820) (-1166.309) -- 0:00:33
458000 -- (-1163.076) (-1161.973) (-1162.076) [-1166.362] * (-1164.218) [-1161.901] (-1165.650) (-1164.596) -- 0:00:33
458500 -- (-1163.749) (-1167.871) [-1165.625] (-1162.302) * (-1161.812) (-1163.829) (-1162.930) [-1161.378] -- 0:00:33
459000 -- [-1162.563] (-1166.026) (-1163.454) (-1162.831) * (-1168.069) (-1164.990) (-1169.369) [-1161.378] -- 0:00:33
459500 -- (-1162.134) (-1168.934) (-1164.250) [-1165.445] * (-1162.654) (-1162.818) [-1163.508] (-1163.551) -- 0:00:32
460000 -- (-1163.273) (-1166.126) [-1163.185] (-1165.155) * (-1164.861) (-1162.303) (-1161.478) [-1162.029] -- 0:00:32
Average standard deviation of split frequencies: 0.013098
460500 -- (-1162.908) (-1164.572) [-1164.091] (-1164.289) * (-1164.626) (-1162.285) (-1163.223) [-1163.166] -- 0:00:32
461000 -- (-1161.542) (-1164.486) [-1163.343] (-1163.279) * (-1163.254) (-1161.286) [-1163.973] (-1163.111) -- 0:00:32
461500 -- [-1161.278] (-1164.288) (-1168.037) (-1164.396) * (-1163.446) (-1161.943) (-1162.333) [-1163.061] -- 0:00:32
462000 -- (-1164.578) (-1163.773) (-1167.544) [-1165.896] * [-1164.700] (-1161.390) (-1162.304) (-1163.900) -- 0:00:32
462500 -- (-1166.737) [-1162.762] (-1166.505) (-1165.508) * (-1164.053) (-1160.728) [-1162.425] (-1162.121) -- 0:00:33
463000 -- (-1165.586) (-1163.489) [-1162.808] (-1165.433) * [-1163.510] (-1164.886) (-1161.328) (-1161.205) -- 0:00:33
463500 -- [-1162.083] (-1166.487) (-1161.928) (-1165.200) * [-1161.367] (-1167.443) (-1165.298) (-1163.011) -- 0:00:33
464000 -- [-1163.320] (-1164.924) (-1163.528) (-1167.612) * (-1162.654) [-1163.697] (-1162.202) (-1163.790) -- 0:00:33
464500 -- (-1161.614) (-1165.952) [-1168.942] (-1169.227) * (-1162.942) [-1161.187] (-1163.342) (-1164.172) -- 0:00:33
465000 -- [-1162.993] (-1164.732) (-1164.917) (-1166.663) * (-1162.915) [-1161.364] (-1162.118) (-1162.867) -- 0:00:33
Average standard deviation of split frequencies: 0.012948
465500 -- (-1162.644) (-1164.720) [-1163.597] (-1165.012) * (-1163.097) [-1160.746] (-1161.313) (-1162.219) -- 0:00:33
466000 -- (-1164.040) (-1161.997) [-1162.070] (-1164.406) * (-1166.262) (-1166.057) (-1162.225) [-1162.986] -- 0:00:33
466500 -- [-1165.832] (-1164.300) (-1162.182) (-1161.409) * (-1161.498) [-1161.170] (-1161.790) (-1165.963) -- 0:00:33
467000 -- [-1164.465] (-1166.109) (-1163.190) (-1162.434) * (-1161.856) (-1165.235) (-1161.792) [-1162.204] -- 0:00:33
467500 -- (-1162.102) [-1163.588] (-1164.891) (-1162.852) * (-1160.950) [-1163.171] (-1161.337) (-1161.706) -- 0:00:33
468000 -- (-1161.508) (-1163.613) (-1164.346) [-1163.535] * [-1161.966] (-1164.367) (-1163.353) (-1164.974) -- 0:00:32
468500 -- (-1164.592) [-1162.106] (-1164.599) (-1162.586) * (-1163.458) [-1162.107] (-1165.397) (-1166.334) -- 0:00:32
469000 -- (-1162.009) (-1168.202) (-1165.191) [-1161.330] * [-1163.029] (-1167.668) (-1162.882) (-1164.707) -- 0:00:32
469500 -- (-1161.353) [-1163.217] (-1163.417) (-1164.759) * (-1161.882) (-1164.300) (-1163.492) [-1161.977] -- 0:00:32
470000 -- (-1160.859) [-1161.970] (-1164.989) (-1165.763) * [-1165.233] (-1162.685) (-1163.254) (-1162.392) -- 0:00:32
Average standard deviation of split frequencies: 0.013822
470500 -- (-1161.700) [-1162.972] (-1163.327) (-1164.003) * (-1168.188) (-1163.531) [-1163.208] (-1165.135) -- 0:00:32
471000 -- [-1161.689] (-1162.043) (-1166.809) (-1166.962) * [-1161.556] (-1162.182) (-1162.965) (-1163.575) -- 0:00:32
471500 -- [-1163.462] (-1165.358) (-1163.890) (-1167.571) * (-1161.593) (-1162.213) [-1161.893] (-1162.793) -- 0:00:32
472000 -- (-1164.100) (-1166.083) [-1164.558] (-1165.554) * (-1163.241) [-1162.826] (-1161.109) (-1162.593) -- 0:00:32
472500 -- (-1163.844) (-1163.531) (-1164.575) [-1162.366] * [-1162.283] (-1165.477) (-1161.137) (-1162.946) -- 0:00:32
473000 -- (-1164.797) (-1164.348) [-1163.246] (-1161.692) * (-1162.805) (-1163.554) (-1168.215) [-1161.170] -- 0:00:32
473500 -- (-1163.286) (-1162.570) (-1162.534) [-1161.443] * [-1161.260] (-1163.459) (-1168.799) (-1163.114) -- 0:00:32
474000 -- (-1162.069) [-1161.660] (-1169.516) (-1163.744) * (-1161.454) (-1163.977) (-1164.474) [-1162.802] -- 0:00:32
474500 -- (-1162.566) [-1161.709] (-1165.642) (-1166.178) * (-1163.086) (-1164.997) [-1163.665] (-1163.008) -- 0:00:32
475000 -- (-1162.058) [-1162.315] (-1166.937) (-1161.949) * (-1165.676) (-1165.216) [-1166.527] (-1164.101) -- 0:00:32
Average standard deviation of split frequencies: 0.012874
475500 -- (-1162.995) (-1163.774) [-1161.885] (-1162.687) * (-1163.070) (-1162.393) [-1162.027] (-1162.204) -- 0:00:31
476000 -- [-1163.188] (-1165.611) (-1164.349) (-1163.438) * (-1163.408) (-1166.800) (-1162.927) [-1163.183] -- 0:00:31
476500 -- (-1162.134) [-1161.198] (-1161.890) (-1164.830) * (-1163.107) (-1164.410) [-1162.296] (-1163.824) -- 0:00:31
477000 -- (-1163.079) [-1165.559] (-1162.513) (-1166.950) * (-1163.070) [-1165.421] (-1168.980) (-1161.757) -- 0:00:31
477500 -- (-1164.949) [-1165.838] (-1164.519) (-1166.461) * (-1168.677) (-1161.400) [-1161.566] (-1162.309) -- 0:00:31
478000 -- (-1164.125) (-1164.343) [-1163.317] (-1161.951) * (-1162.851) [-1164.662] (-1163.389) (-1163.580) -- 0:00:31
478500 -- [-1165.310] (-1165.396) (-1168.498) (-1161.522) * (-1162.778) (-1163.511) (-1165.157) [-1161.348] -- 0:00:31
479000 -- (-1163.459) (-1163.022) (-1161.226) [-1161.590] * (-1162.522) [-1162.646] (-1162.886) (-1162.551) -- 0:00:31
479500 -- [-1163.147] (-1161.140) (-1162.814) (-1164.932) * (-1163.741) (-1161.260) [-1161.031] (-1163.081) -- 0:00:32
480000 -- (-1163.450) [-1161.319] (-1162.100) (-1161.714) * (-1162.310) (-1161.356) [-1160.972] (-1166.649) -- 0:00:32
Average standard deviation of split frequencies: 0.012161
480500 -- (-1165.093) [-1162.866] (-1160.927) (-1162.408) * (-1165.572) (-1161.395) [-1160.958] (-1161.984) -- 0:00:32
481000 -- (-1163.542) (-1163.916) (-1161.013) [-1160.999] * (-1162.962) (-1168.249) (-1160.970) [-1165.457] -- 0:00:32
481500 -- (-1168.399) (-1163.257) (-1161.033) [-1160.935] * (-1163.241) [-1165.640] (-1161.578) (-1166.125) -- 0:00:32
482000 -- (-1162.166) [-1163.007] (-1161.383) (-1162.666) * (-1163.795) [-1163.254] (-1164.825) (-1165.724) -- 0:00:32
482500 -- (-1163.462) (-1162.347) [-1161.293] (-1166.850) * (-1166.985) (-1165.189) (-1164.800) [-1163.788] -- 0:00:32
483000 -- (-1162.918) [-1161.696] (-1166.289) (-1162.385) * [-1164.391] (-1163.922) (-1165.343) (-1162.391) -- 0:00:32
483500 -- (-1162.148) [-1163.190] (-1166.321) (-1162.395) * (-1163.018) (-1161.215) (-1164.836) [-1162.250] -- 0:00:32
484000 -- (-1163.837) [-1161.744] (-1164.812) (-1163.091) * [-1162.436] (-1162.569) (-1165.018) (-1163.961) -- 0:00:31
484500 -- (-1162.459) (-1162.082) (-1162.942) [-1165.184] * [-1164.755] (-1163.855) (-1162.912) (-1162.814) -- 0:00:31
485000 -- (-1165.682) (-1162.889) [-1162.751] (-1161.609) * [-1166.149] (-1162.151) (-1161.679) (-1162.132) -- 0:00:31
Average standard deviation of split frequencies: 0.013386
485500 -- [-1165.721] (-1163.504) (-1162.674) (-1161.509) * (-1165.833) (-1162.162) [-1161.853] (-1162.038) -- 0:00:31
486000 -- (-1163.440) (-1163.924) [-1164.621] (-1165.154) * (-1168.520) (-1162.682) [-1161.842] (-1169.529) -- 0:00:31
486500 -- [-1162.549] (-1168.777) (-1162.179) (-1164.906) * (-1166.840) (-1164.990) [-1162.810] (-1162.830) -- 0:00:31
487000 -- (-1164.004) (-1163.381) [-1163.317] (-1162.595) * [-1164.795] (-1164.967) (-1166.688) (-1162.935) -- 0:00:31
487500 -- (-1165.549) (-1161.209) (-1162.765) [-1164.880] * (-1166.532) [-1162.511] (-1164.669) (-1162.372) -- 0:00:31
488000 -- (-1163.355) [-1162.916] (-1162.432) (-1167.439) * (-1166.646) [-1164.771] (-1165.687) (-1162.255) -- 0:00:31
488500 -- (-1163.201) [-1161.478] (-1163.257) (-1164.343) * (-1162.981) (-1163.662) [-1165.026] (-1163.289) -- 0:00:31
489000 -- (-1162.890) [-1164.144] (-1167.452) (-1162.187) * (-1165.435) (-1162.269) [-1165.084] (-1162.628) -- 0:00:31
489500 -- (-1163.145) (-1165.707) (-1163.197) [-1163.189] * (-1163.862) (-1161.972) [-1167.422] (-1162.458) -- 0:00:31
490000 -- (-1167.124) (-1163.409) (-1162.470) [-1161.832] * [-1168.448] (-1168.006) (-1167.650) (-1162.102) -- 0:00:31
Average standard deviation of split frequencies: 0.011721
490500 -- (-1164.592) [-1163.008] (-1161.771) (-1162.629) * (-1165.892) (-1162.846) [-1161.887] (-1164.048) -- 0:00:31
491000 -- (-1163.632) (-1161.364) (-1163.757) [-1161.369] * (-1164.140) (-1164.125) [-1162.436] (-1164.281) -- 0:00:31
491500 -- (-1163.317) (-1161.749) [-1163.457] (-1161.753) * [-1163.922] (-1167.000) (-1164.623) (-1161.960) -- 0:00:31
492000 -- [-1162.683] (-1163.644) (-1162.104) (-1161.501) * (-1163.106) [-1164.895] (-1164.729) (-1164.610) -- 0:00:30
492500 -- (-1165.428) (-1161.614) [-1166.966] (-1166.224) * (-1163.593) (-1164.057) [-1164.112] (-1161.496) -- 0:00:30
493000 -- (-1170.388) (-1161.509) [-1163.983] (-1163.134) * (-1161.852) (-1161.893) (-1162.328) [-1163.240] -- 0:00:30
493500 -- [-1162.148] (-1161.881) (-1163.343) (-1165.850) * [-1161.928] (-1165.594) (-1162.289) (-1163.084) -- 0:00:30
494000 -- (-1161.438) (-1167.963) (-1163.255) [-1165.550] * (-1161.672) (-1164.563) (-1164.164) [-1164.818] -- 0:00:30
494500 -- (-1164.180) [-1161.866] (-1160.973) (-1165.792) * (-1162.840) [-1164.801] (-1161.427) (-1165.349) -- 0:00:30
495000 -- (-1164.380) (-1162.333) [-1163.492] (-1163.375) * [-1163.685] (-1164.131) (-1161.519) (-1166.061) -- 0:00:30
Average standard deviation of split frequencies: 0.011215
495500 -- [-1163.892] (-1162.859) (-1163.249) (-1162.558) * (-1164.699) (-1167.985) (-1163.986) [-1163.854] -- 0:00:30
496000 -- (-1161.718) [-1162.240] (-1161.305) (-1163.552) * (-1163.711) (-1166.427) (-1162.056) [-1163.091] -- 0:00:31
496500 -- (-1165.316) (-1163.467) (-1161.409) [-1163.204] * [-1166.453] (-1160.965) (-1163.253) (-1162.777) -- 0:00:31
497000 -- [-1163.118] (-1161.419) (-1161.128) (-1162.201) * (-1162.409) [-1162.382] (-1163.033) (-1171.121) -- 0:00:31
497500 -- (-1162.223) (-1161.990) [-1161.285] (-1162.651) * (-1163.912) (-1162.934) [-1166.630] (-1164.458) -- 0:00:31
498000 -- (-1164.670) (-1164.916) [-1161.052] (-1162.483) * (-1163.446) (-1162.968) (-1168.604) [-1162.764] -- 0:00:31
498500 -- (-1163.960) (-1162.032) (-1164.612) [-1162.320] * (-1163.775) (-1163.760) [-1165.425] (-1161.739) -- 0:00:31
499000 -- (-1162.517) (-1161.513) (-1164.903) [-1162.211] * (-1162.724) [-1164.004] (-1163.041) (-1163.443) -- 0:00:31
499500 -- (-1166.203) [-1160.978] (-1164.599) (-1162.613) * [-1161.571] (-1162.638) (-1163.404) (-1163.610) -- 0:00:31
500000 -- (-1165.033) (-1162.458) [-1165.499] (-1162.302) * (-1161.677) (-1162.327) (-1162.249) [-1163.015] -- 0:00:31
Average standard deviation of split frequencies: 0.010734
500500 -- (-1164.016) (-1165.554) [-1163.750] (-1163.424) * [-1162.462] (-1161.959) (-1162.013) (-1162.998) -- 0:00:30
501000 -- (-1162.302) (-1163.967) (-1164.870) [-1161.408] * [-1164.632] (-1161.839) (-1161.792) (-1164.317) -- 0:00:30
501500 -- (-1165.810) (-1161.398) (-1165.950) [-1161.775] * (-1162.685) (-1166.156) [-1161.005] (-1161.062) -- 0:00:30
502000 -- (-1164.338) (-1162.525) (-1162.823) [-1163.036] * (-1164.764) (-1162.400) [-1162.242] (-1161.565) -- 0:00:30
502500 -- [-1162.043] (-1163.051) (-1162.600) (-1162.489) * (-1162.967) [-1163.446] (-1162.897) (-1162.130) -- 0:00:30
503000 -- (-1161.310) (-1161.082) [-1162.502] (-1165.765) * (-1164.736) [-1164.476] (-1162.992) (-1163.387) -- 0:00:30
503500 -- (-1161.145) (-1162.973) [-1166.528] (-1165.443) * (-1161.780) [-1166.047] (-1164.482) (-1164.311) -- 0:00:30
504000 -- (-1161.946) (-1162.463) (-1166.548) [-1162.028] * (-1163.594) (-1162.810) [-1165.091] (-1163.763) -- 0:00:30
504500 -- [-1162.137] (-1163.857) (-1163.753) (-1162.161) * (-1163.092) (-1166.353) [-1163.650] (-1163.794) -- 0:00:30
505000 -- (-1164.358) (-1163.488) (-1162.749) [-1162.916] * (-1165.288) (-1162.181) (-1163.463) [-1163.422] -- 0:00:30
Average standard deviation of split frequencies: 0.009503
505500 -- (-1163.590) (-1165.070) (-1162.133) [-1164.439] * (-1164.521) (-1161.398) (-1164.700) [-1162.040] -- 0:00:30
506000 -- (-1162.694) [-1163.240] (-1163.939) (-1166.321) * [-1162.790] (-1163.050) (-1165.660) (-1162.867) -- 0:00:30
506500 -- (-1162.042) (-1164.240) [-1163.397] (-1165.289) * (-1163.289) (-1166.657) [-1166.939] (-1164.730) -- 0:00:30
507000 -- (-1161.768) (-1164.046) (-1162.651) [-1162.342] * [-1164.360] (-1164.032) (-1165.251) (-1164.952) -- 0:00:30
507500 -- [-1161.073] (-1161.652) (-1162.472) (-1164.271) * [-1164.262] (-1169.208) (-1162.996) (-1167.738) -- 0:00:30
508000 -- (-1161.949) [-1165.588] (-1162.306) (-1161.891) * (-1162.177) (-1168.927) [-1164.423] (-1163.200) -- 0:00:30
508500 -- [-1162.908] (-1166.872) (-1162.064) (-1162.474) * (-1162.707) (-1163.422) (-1165.323) [-1164.497] -- 0:00:29
509000 -- (-1162.625) (-1169.645) [-1162.322] (-1164.377) * (-1162.414) (-1162.571) [-1163.942] (-1168.022) -- 0:00:29
509500 -- (-1161.364) [-1167.563] (-1161.580) (-1162.378) * (-1162.235) [-1164.190] (-1165.538) (-1171.781) -- 0:00:29
510000 -- (-1161.325) (-1164.273) (-1161.580) [-1163.630] * (-1161.306) (-1164.481) (-1168.248) [-1162.934] -- 0:00:29
Average standard deviation of split frequencies: 0.009231
510500 -- (-1163.087) (-1166.246) [-1163.521] (-1161.884) * [-1163.160] (-1163.379) (-1165.838) (-1161.980) -- 0:00:29
511000 -- (-1163.602) (-1162.672) (-1164.130) [-1161.864] * (-1162.014) (-1162.057) (-1164.657) [-1162.111] -- 0:00:29
511500 -- [-1162.496] (-1162.117) (-1169.009) (-1162.933) * (-1162.149) [-1162.875] (-1166.298) (-1165.831) -- 0:00:29
512000 -- (-1162.970) (-1161.560) [-1162.007] (-1163.018) * (-1169.893) [-1163.396] (-1163.226) (-1164.654) -- 0:00:29
512500 -- [-1163.682] (-1161.812) (-1166.019) (-1162.944) * (-1169.408) [-1162.123] (-1164.609) (-1162.852) -- 0:00:29
513000 -- (-1167.055) (-1163.911) (-1164.346) [-1162.007] * (-1172.865) (-1162.137) [-1163.826] (-1163.306) -- 0:00:29
513500 -- (-1162.709) [-1163.155] (-1166.163) (-1162.875) * [-1171.773] (-1161.626) (-1164.458) (-1163.443) -- 0:00:30
514000 -- (-1162.321) [-1163.186] (-1164.334) (-1166.161) * (-1173.360) [-1163.493] (-1162.395) (-1164.251) -- 0:00:30
514500 -- [-1163.633] (-1165.781) (-1163.901) (-1165.942) * (-1161.985) (-1162.962) [-1162.502] (-1162.161) -- 0:00:30
515000 -- (-1164.674) [-1162.403] (-1162.789) (-1163.844) * (-1164.354) [-1162.910] (-1163.088) (-1163.358) -- 0:00:30
Average standard deviation of split frequencies: 0.009318
515500 -- [-1161.344] (-1162.367) (-1163.876) (-1164.472) * (-1163.425) (-1164.005) (-1162.696) [-1163.619] -- 0:00:30
516000 -- (-1166.197) (-1162.415) [-1161.360] (-1162.848) * (-1162.822) (-1165.130) [-1161.817] (-1161.844) -- 0:00:30
516500 -- (-1161.871) (-1163.805) [-1162.924] (-1163.643) * [-1164.934] (-1162.156) (-1161.598) (-1162.554) -- 0:00:29
517000 -- (-1162.227) [-1163.610] (-1162.886) (-1160.976) * (-1164.696) (-1163.294) [-1161.739] (-1160.994) -- 0:00:29
517500 -- (-1162.489) (-1162.112) (-1164.068) [-1161.469] * (-1171.642) (-1165.789) (-1167.188) [-1161.690] -- 0:00:29
518000 -- (-1163.870) [-1162.112] (-1163.711) (-1162.851) * [-1162.384] (-1166.363) (-1163.712) (-1164.683) -- 0:00:29
518500 -- (-1163.754) (-1161.880) (-1162.371) [-1164.959] * [-1163.094] (-1167.377) (-1163.444) (-1164.184) -- 0:00:29
519000 -- [-1163.896] (-1161.360) (-1162.367) (-1163.624) * (-1163.371) (-1164.734) [-1161.711] (-1162.675) -- 0:00:29
519500 -- (-1162.979) [-1161.369] (-1165.129) (-1163.067) * (-1165.435) (-1165.687) [-1162.466] (-1162.669) -- 0:00:29
520000 -- (-1161.565) (-1163.179) (-1165.355) [-1168.180] * (-1163.987) [-1166.485] (-1162.449) (-1162.413) -- 0:00:29
Average standard deviation of split frequencies: 0.009597
520500 -- (-1161.948) (-1165.554) [-1163.779] (-1163.082) * (-1163.780) [-1164.333] (-1163.627) (-1162.250) -- 0:00:29
521000 -- (-1161.754) (-1165.561) [-1162.915] (-1163.458) * (-1164.369) (-1163.896) (-1162.908) [-1163.075] -- 0:00:29
521500 -- [-1164.557] (-1165.154) (-1161.617) (-1166.131) * (-1169.192) (-1162.174) [-1162.527] (-1163.280) -- 0:00:29
522000 -- (-1164.092) [-1165.647] (-1161.941) (-1164.683) * (-1165.856) (-1171.033) [-1163.215] (-1163.594) -- 0:00:29
522500 -- [-1163.082] (-1163.220) (-1162.438) (-1164.766) * (-1163.672) [-1162.094] (-1162.033) (-1162.747) -- 0:00:29
523000 -- (-1162.985) (-1165.621) (-1163.343) [-1161.559] * (-1162.500) [-1164.061] (-1163.932) (-1163.818) -- 0:00:29
523500 -- (-1162.976) (-1160.728) [-1161.941] (-1163.030) * (-1166.747) (-1162.833) [-1162.688] (-1162.583) -- 0:00:29
524000 -- (-1161.412) (-1161.597) [-1161.886] (-1162.929) * (-1167.661) (-1163.689) (-1164.796) [-1166.017] -- 0:00:29
524500 -- (-1162.507) (-1163.065) (-1165.646) [-1164.623] * [-1163.125] (-1163.321) (-1162.866) (-1162.258) -- 0:00:29
525000 -- (-1163.873) [-1163.487] (-1169.239) (-1161.912) * [-1162.058] (-1165.633) (-1162.159) (-1163.707) -- 0:00:28
Average standard deviation of split frequencies: 0.009858
525500 -- (-1163.200) (-1163.476) [-1163.351] (-1162.480) * (-1164.683) (-1161.517) (-1163.531) [-1167.033] -- 0:00:28
526000 -- [-1163.414] (-1166.874) (-1161.364) (-1166.962) * (-1162.500) [-1161.823] (-1162.029) (-1161.817) -- 0:00:28
526500 -- (-1164.529) (-1165.231) (-1163.436) [-1162.321] * (-1165.154) (-1162.094) (-1164.077) [-1163.195] -- 0:00:28
527000 -- (-1162.572) (-1163.326) (-1163.567) [-1164.509] * (-1163.322) (-1161.728) [-1163.371] (-1163.689) -- 0:00:28
527500 -- (-1165.103) (-1169.534) (-1162.115) [-1162.459] * (-1164.291) (-1166.203) (-1162.233) [-1162.835] -- 0:00:28
528000 -- (-1162.875) [-1163.600] (-1162.353) (-1162.364) * (-1162.845) (-1165.992) [-1161.737] (-1162.182) -- 0:00:28
528500 -- (-1161.731) (-1163.740) (-1163.676) [-1161.726] * (-1162.922) [-1161.867] (-1167.197) (-1162.958) -- 0:00:28
529000 -- (-1163.347) [-1164.511] (-1164.824) (-1162.202) * (-1164.268) [-1162.760] (-1161.415) (-1162.695) -- 0:00:28
529500 -- (-1163.098) [-1164.757] (-1164.969) (-1163.740) * (-1164.341) [-1162.852] (-1161.460) (-1161.862) -- 0:00:29
530000 -- [-1163.632] (-1162.991) (-1165.923) (-1162.830) * (-1164.030) (-1164.190) (-1163.315) [-1163.761] -- 0:00:29
Average standard deviation of split frequencies: 0.010660
530500 -- [-1162.528] (-1163.011) (-1163.035) (-1161.649) * (-1164.535) (-1168.496) (-1162.471) [-1165.275] -- 0:00:29
531000 -- (-1161.780) (-1168.767) [-1162.488] (-1160.737) * (-1162.914) (-1165.809) [-1160.867] (-1164.480) -- 0:00:29
531500 -- (-1162.825) (-1166.661) [-1163.699] (-1162.930) * (-1167.040) [-1165.016] (-1163.204) (-1163.113) -- 0:00:29
532000 -- [-1161.480] (-1164.647) (-1161.103) (-1163.734) * [-1166.950] (-1162.209) (-1166.288) (-1162.938) -- 0:00:29
532500 -- (-1162.290) [-1162.240] (-1161.043) (-1163.510) * (-1164.837) (-1163.798) [-1163.191] (-1162.379) -- 0:00:28
533000 -- (-1162.105) (-1163.233) (-1163.633) [-1163.798] * (-1162.537) [-1163.248] (-1162.790) (-1162.565) -- 0:00:28
533500 -- [-1163.479] (-1161.600) (-1165.615) (-1166.298) * (-1162.545) (-1163.180) [-1162.044] (-1162.995) -- 0:00:28
534000 -- (-1164.276) (-1161.908) (-1163.854) [-1163.841] * (-1162.548) (-1164.974) (-1162.570) [-1161.996] -- 0:00:28
534500 -- (-1163.319) [-1161.980] (-1162.077) (-1164.521) * [-1163.803] (-1165.215) (-1163.130) (-1162.657) -- 0:00:28
535000 -- (-1164.361) [-1162.808] (-1162.834) (-1167.791) * (-1162.518) [-1161.763] (-1165.012) (-1162.335) -- 0:00:28
Average standard deviation of split frequencies: 0.009498
535500 -- (-1169.474) [-1163.690] (-1169.251) (-1164.865) * (-1163.240) (-1161.873) [-1161.877] (-1162.194) -- 0:00:28
536000 -- (-1164.499) (-1164.305) (-1165.091) [-1162.723] * [-1162.889] (-1161.875) (-1162.668) (-1162.506) -- 0:00:28
536500 -- (-1163.157) (-1168.944) (-1163.245) [-1164.683] * (-1163.177) [-1163.002] (-1162.429) (-1162.531) -- 0:00:28
537000 -- (-1162.084) (-1162.913) [-1163.245] (-1162.939) * (-1161.843) (-1161.671) [-1162.607] (-1164.205) -- 0:00:28
537500 -- (-1162.374) (-1166.927) (-1161.907) [-1161.992] * (-1162.382) (-1161.781) (-1162.592) [-1162.612] -- 0:00:28
538000 -- [-1162.772] (-1165.926) (-1164.049) (-1165.118) * [-1162.705] (-1162.915) (-1163.624) (-1160.988) -- 0:00:28
538500 -- (-1162.353) (-1165.903) [-1164.620] (-1162.390) * [-1165.960] (-1164.450) (-1163.696) (-1161.543) -- 0:00:28
539000 -- (-1163.485) (-1162.868) [-1164.300] (-1164.018) * (-1163.402) (-1164.547) [-1163.100] (-1161.840) -- 0:00:28
539500 -- (-1162.808) (-1161.780) (-1166.291) [-1163.666] * (-1162.060) (-1163.733) (-1162.689) [-1161.673] -- 0:00:28
540000 -- (-1167.371) (-1163.914) [-1165.113] (-1164.789) * [-1163.682] (-1167.799) (-1163.394) (-1161.679) -- 0:00:28
Average standard deviation of split frequencies: 0.009416
540500 -- [-1163.530] (-1163.063) (-1162.552) (-1163.246) * [-1162.634] (-1166.807) (-1164.323) (-1163.758) -- 0:00:28
541000 -- (-1165.881) (-1164.359) (-1162.324) [-1164.577] * (-1162.749) (-1165.095) [-1162.571] (-1163.200) -- 0:00:27
541500 -- [-1164.259] (-1165.691) (-1163.073) (-1162.966) * (-1164.427) (-1167.382) [-1161.404] (-1164.003) -- 0:00:27
542000 -- [-1163.764] (-1163.869) (-1164.192) (-1162.625) * (-1164.256) (-1161.353) (-1161.342) [-1167.301] -- 0:00:27
542500 -- (-1165.255) [-1163.036] (-1161.715) (-1164.249) * (-1162.452) (-1163.936) (-1163.072) [-1171.778] -- 0:00:27
543000 -- [-1164.795] (-1163.195) (-1161.752) (-1164.787) * [-1166.923] (-1162.416) (-1166.731) (-1162.363) -- 0:00:27
543500 -- (-1165.680) (-1167.716) [-1161.462] (-1166.322) * (-1162.048) (-1163.345) (-1166.638) [-1161.507] -- 0:00:27
544000 -- (-1162.177) (-1165.437) (-1162.280) [-1162.828] * (-1162.501) [-1161.164] (-1164.966) (-1164.879) -- 0:00:27
544500 -- [-1163.112] (-1162.977) (-1165.120) (-1162.251) * (-1167.024) (-1161.756) (-1164.075) [-1163.431] -- 0:00:27
545000 -- (-1163.152) (-1163.307) (-1161.056) [-1162.547] * (-1168.035) (-1162.629) (-1163.276) [-1162.658] -- 0:00:27
Average standard deviation of split frequencies: 0.008288
545500 -- (-1163.169) [-1163.594] (-1162.012) (-1162.311) * (-1169.583) (-1163.259) [-1166.306] (-1162.172) -- 0:00:27
546000 -- (-1162.775) [-1162.261] (-1163.033) (-1164.830) * (-1167.402) (-1162.188) [-1163.753] (-1162.136) -- 0:00:27
546500 -- [-1161.839] (-1162.574) (-1162.730) (-1163.798) * (-1164.546) (-1162.066) (-1168.115) [-1162.719] -- 0:00:27
547000 -- (-1163.598) [-1162.983] (-1162.898) (-1162.968) * (-1164.556) [-1161.166] (-1162.513) (-1162.269) -- 0:00:28
547500 -- (-1164.671) [-1162.801] (-1162.493) (-1165.500) * (-1163.987) (-1162.369) [-1161.310] (-1163.083) -- 0:00:28
548000 -- (-1163.695) [-1162.760] (-1164.763) (-1168.590) * (-1162.171) (-1162.587) [-1163.706] (-1162.606) -- 0:00:28
548500 -- (-1167.032) (-1162.866) [-1164.381] (-1163.679) * (-1162.776) [-1163.698] (-1164.303) (-1169.680) -- 0:00:27
549000 -- (-1166.973) (-1163.524) [-1162.442] (-1166.032) * [-1163.760] (-1162.091) (-1164.103) (-1167.400) -- 0:00:27
549500 -- (-1161.372) [-1162.275] (-1165.281) (-1160.883) * (-1166.898) (-1166.440) (-1164.874) [-1162.274] -- 0:00:27
550000 -- (-1161.655) (-1167.506) [-1162.755] (-1162.230) * [-1167.246] (-1162.736) (-1164.660) (-1163.802) -- 0:00:27
Average standard deviation of split frequencies: 0.008047
550500 -- [-1161.847] (-1164.575) (-1162.770) (-1165.004) * (-1162.642) (-1164.766) (-1162.095) [-1162.962] -- 0:00:27
551000 -- (-1163.270) [-1165.072] (-1161.082) (-1165.442) * (-1162.133) (-1162.831) (-1162.112) [-1165.426] -- 0:00:27
551500 -- (-1161.575) [-1163.478] (-1163.483) (-1164.684) * (-1162.616) (-1162.580) (-1163.111) [-1165.313] -- 0:00:27
552000 -- (-1161.643) [-1161.272] (-1162.871) (-1162.974) * (-1161.998) (-1163.196) [-1161.110] (-1162.066) -- 0:00:27
552500 -- (-1161.647) [-1161.870] (-1163.559) (-1162.542) * (-1164.107) (-1162.533) [-1164.696] (-1164.070) -- 0:00:27
553000 -- (-1163.646) [-1163.804] (-1161.446) (-1166.951) * (-1162.050) (-1166.059) [-1162.094] (-1165.113) -- 0:00:27
553500 -- (-1164.917) [-1164.518] (-1162.885) (-1165.204) * (-1162.927) (-1163.555) (-1162.569) [-1163.785] -- 0:00:27
554000 -- (-1163.157) (-1162.202) (-1166.271) [-1161.186] * (-1165.932) [-1163.364] (-1162.611) (-1163.582) -- 0:00:27
554500 -- [-1161.689] (-1161.300) (-1163.813) (-1164.002) * (-1168.282) (-1162.967) [-1165.962] (-1164.753) -- 0:00:27
555000 -- (-1162.016) [-1161.574] (-1163.495) (-1161.666) * [-1164.716] (-1164.411) (-1162.497) (-1162.645) -- 0:00:27
Average standard deviation of split frequencies: 0.007461
555500 -- (-1162.845) [-1163.247] (-1163.809) (-1166.756) * (-1163.173) (-1164.053) (-1165.956) [-1161.163] -- 0:00:27
556000 -- (-1164.288) [-1162.805] (-1164.222) (-1164.434) * (-1161.237) (-1162.394) [-1161.241] (-1162.327) -- 0:00:27
556500 -- [-1162.293] (-1164.232) (-1163.995) (-1164.759) * (-1161.228) (-1166.035) [-1161.745] (-1162.074) -- 0:00:27
557000 -- [-1162.204] (-1164.806) (-1160.911) (-1164.748) * [-1161.474] (-1164.196) (-1161.625) (-1161.610) -- 0:00:27
557500 -- (-1163.962) [-1161.125] (-1162.291) (-1164.368) * (-1161.500) (-1164.041) (-1164.858) [-1162.437] -- 0:00:26
558000 -- (-1164.824) [-1161.452] (-1161.724) (-1164.255) * (-1164.810) (-1163.823) (-1161.329) [-1166.787] -- 0:00:26
558500 -- (-1166.420) (-1164.358) (-1165.803) [-1161.755] * (-1162.276) [-1161.646] (-1163.376) (-1167.074) -- 0:00:26
559000 -- (-1165.791) (-1164.549) (-1163.739) [-1163.414] * (-1162.220) (-1165.592) [-1166.238] (-1164.804) -- 0:00:26
559500 -- (-1163.225) (-1164.374) (-1166.575) [-1161.069] * (-1163.607) (-1166.468) (-1163.930) [-1165.457] -- 0:00:26
560000 -- (-1164.847) (-1165.506) (-1163.935) [-1161.893] * (-1164.456) (-1162.815) (-1166.433) [-1162.866] -- 0:00:26
Average standard deviation of split frequencies: 0.007567
560500 -- [-1162.287] (-1164.938) (-1161.667) (-1161.732) * (-1167.194) (-1166.843) (-1162.961) [-1164.116] -- 0:00:26
561000 -- (-1165.099) (-1162.637) (-1161.711) [-1162.681] * [-1164.911] (-1164.483) (-1163.844) (-1163.134) -- 0:00:26
561500 -- (-1164.826) [-1164.098] (-1161.671) (-1162.173) * (-1165.728) (-1169.221) (-1163.345) [-1167.308] -- 0:00:26
562000 -- (-1163.081) [-1161.931] (-1161.986) (-1164.481) * (-1164.641) (-1162.492) [-1163.379] (-1165.043) -- 0:00:26
562500 -- (-1166.035) [-1162.360] (-1162.773) (-1162.898) * (-1162.849) (-1161.746) [-1162.475] (-1163.345) -- 0:00:26
563000 -- (-1161.021) [-1161.462] (-1164.838) (-1163.635) * (-1162.102) [-1163.485] (-1163.370) (-1165.157) -- 0:00:27
563500 -- (-1161.188) (-1162.386) (-1163.763) [-1162.978] * (-1161.459) [-1161.767] (-1162.684) (-1161.772) -- 0:00:27
564000 -- (-1162.348) (-1160.979) [-1164.324] (-1164.037) * (-1162.267) [-1161.710] (-1166.793) (-1162.519) -- 0:00:27
564500 -- (-1162.021) (-1161.791) (-1165.036) [-1163.172] * [-1162.948] (-1163.827) (-1165.166) (-1165.807) -- 0:00:27
565000 -- (-1162.163) (-1161.234) [-1164.345] (-1166.722) * (-1162.296) (-1167.053) (-1163.178) [-1163.679] -- 0:00:26
Average standard deviation of split frequencies: 0.007496
565500 -- (-1161.447) [-1161.199] (-1165.434) (-1162.297) * (-1162.053) (-1166.495) (-1164.476) [-1161.883] -- 0:00:26
566000 -- (-1161.335) (-1161.344) [-1165.104] (-1161.795) * (-1163.280) [-1163.462] (-1163.936) (-1162.933) -- 0:00:26
566500 -- (-1163.721) [-1161.424] (-1161.204) (-1163.017) * (-1164.187) (-1165.085) [-1162.150] (-1161.136) -- 0:00:26
567000 -- (-1170.071) (-1169.716) [-1161.080] (-1162.618) * (-1164.527) (-1169.376) (-1163.830) [-1161.156] -- 0:00:26
567500 -- (-1166.527) (-1164.196) (-1162.126) [-1162.922] * (-1164.831) (-1166.512) [-1161.547] (-1162.831) -- 0:00:26
568000 -- [-1163.224] (-1165.017) (-1163.277) (-1162.817) * [-1164.176] (-1165.669) (-1162.808) (-1162.233) -- 0:00:26
568500 -- (-1166.362) (-1162.802) (-1163.583) [-1162.334] * [-1161.481] (-1168.361) (-1162.924) (-1162.031) -- 0:00:26
569000 -- (-1161.976) [-1163.532] (-1161.846) (-1164.837) * (-1161.532) (-1162.738) [-1161.554] (-1166.074) -- 0:00:26
569500 -- (-1162.146) (-1163.721) [-1162.317] (-1161.549) * (-1165.881) (-1162.298) (-1161.543) [-1164.564] -- 0:00:26
570000 -- (-1164.056) (-1161.877) (-1162.724) [-1162.382] * (-1163.301) (-1165.217) [-1161.396] (-1163.734) -- 0:00:26
Average standard deviation of split frequencies: 0.007435
570500 -- [-1162.565] (-1167.015) (-1161.789) (-1162.491) * (-1161.607) (-1162.123) [-1163.781] (-1163.138) -- 0:00:26
571000 -- [-1164.316] (-1165.197) (-1162.943) (-1166.017) * (-1162.080) [-1162.088] (-1161.611) (-1163.929) -- 0:00:26
571500 -- (-1163.314) [-1163.043] (-1164.677) (-1161.736) * (-1165.005) [-1164.838] (-1162.301) (-1168.899) -- 0:00:26
572000 -- (-1162.398) (-1162.114) (-1166.283) [-1163.060] * [-1161.874] (-1164.154) (-1165.432) (-1164.362) -- 0:00:26
572500 -- (-1162.053) (-1163.264) [-1162.478] (-1163.033) * (-1162.116) [-1162.247] (-1164.438) (-1161.880) -- 0:00:26
573000 -- [-1164.476] (-1162.953) (-1161.750) (-1161.421) * (-1162.467) [-1162.304] (-1167.308) (-1162.334) -- 0:00:26
573500 -- (-1167.062) (-1162.567) (-1162.952) [-1163.538] * (-1162.385) [-1164.066] (-1164.527) (-1162.779) -- 0:00:26
574000 -- (-1162.025) (-1162.052) [-1165.959] (-1162.692) * (-1161.574) (-1162.217) (-1163.324) [-1161.622] -- 0:00:25
574500 -- (-1164.519) (-1162.291) [-1164.378] (-1163.029) * (-1162.638) [-1163.392] (-1162.887) (-1164.451) -- 0:00:25
575000 -- (-1163.700) (-1161.491) [-1162.402] (-1163.626) * (-1161.908) (-1163.181) (-1165.385) [-1163.328] -- 0:00:25
Average standard deviation of split frequencies: 0.008020
575500 -- (-1164.385) [-1162.030] (-1160.945) (-1163.436) * (-1162.579) [-1164.778] (-1164.288) (-1163.330) -- 0:00:25
576000 -- (-1167.715) [-1163.660] (-1162.271) (-1163.037) * (-1162.876) (-1164.052) [-1161.759] (-1165.471) -- 0:00:25
576500 -- (-1165.912) [-1167.229] (-1163.046) (-1162.656) * (-1165.187) (-1162.659) (-1163.050) [-1163.885] -- 0:00:25
577000 -- (-1162.987) (-1161.147) (-1161.595) [-1163.478] * (-1163.368) (-1164.702) (-1165.186) [-1165.892] -- 0:00:25
577500 -- [-1163.090] (-1161.243) (-1161.578) (-1162.172) * [-1162.301] (-1163.627) (-1161.644) (-1163.542) -- 0:00:25
578000 -- [-1164.312] (-1162.854) (-1161.603) (-1162.843) * (-1161.848) (-1161.649) (-1163.830) [-1164.293] -- 0:00:25
578500 -- (-1162.563) [-1162.118] (-1162.051) (-1163.342) * (-1161.719) [-1162.464] (-1163.747) (-1162.743) -- 0:00:25
579000 -- [-1164.146] (-1163.234) (-1164.414) (-1163.556) * (-1160.807) (-1162.378) [-1162.069] (-1163.360) -- 0:00:26
579500 -- (-1163.075) (-1161.429) [-1163.451] (-1161.472) * (-1161.865) (-1163.164) [-1163.058] (-1163.408) -- 0:00:26
580000 -- (-1161.879) [-1162.392] (-1166.063) (-1161.372) * (-1163.069) [-1161.819] (-1161.258) (-1162.426) -- 0:00:26
Average standard deviation of split frequencies: 0.008768
580500 -- (-1162.787) (-1161.569) [-1162.367] (-1161.094) * (-1164.534) (-1161.442) (-1162.554) [-1162.625] -- 0:00:26
581000 -- (-1164.653) [-1162.250] (-1164.766) (-1162.456) * (-1162.791) (-1162.824) [-1162.279] (-1162.302) -- 0:00:25
581500 -- (-1162.355) (-1164.518) [-1161.849] (-1168.020) * (-1164.554) [-1161.587] (-1163.608) (-1163.916) -- 0:00:25
582000 -- [-1162.311] (-1167.333) (-1164.585) (-1165.632) * (-1166.405) (-1162.371) (-1164.008) [-1162.239] -- 0:00:25
582500 -- (-1161.840) (-1163.301) [-1161.579] (-1166.411) * (-1162.372) (-1162.653) (-1165.397) [-1163.592] -- 0:00:25
583000 -- (-1161.820) (-1161.414) [-1165.264] (-1172.074) * (-1162.966) [-1162.734] (-1164.782) (-1164.924) -- 0:00:25
583500 -- (-1162.896) (-1161.486) [-1162.468] (-1167.582) * [-1162.884] (-1161.462) (-1166.867) (-1163.496) -- 0:00:25
584000 -- (-1163.063) (-1162.297) (-1163.037) [-1161.308] * (-1163.301) [-1161.373] (-1167.391) (-1161.040) -- 0:00:25
584500 -- [-1165.485] (-1164.435) (-1162.788) (-1162.361) * [-1164.398] (-1160.989) (-1164.344) (-1162.458) -- 0:00:25
585000 -- (-1163.369) [-1162.899] (-1164.816) (-1163.089) * (-1164.534) (-1162.104) [-1163.018] (-1162.771) -- 0:00:25
Average standard deviation of split frequencies: 0.008366
585500 -- (-1164.028) [-1162.458] (-1161.082) (-1162.018) * [-1165.094] (-1161.256) (-1168.438) (-1161.599) -- 0:00:25
586000 -- [-1163.273] (-1161.351) (-1164.703) (-1163.732) * (-1164.743) (-1161.699) [-1162.043] (-1163.936) -- 0:00:25
586500 -- [-1163.090] (-1161.272) (-1168.665) (-1161.676) * (-1165.470) [-1161.032] (-1161.642) (-1161.667) -- 0:00:25
587000 -- [-1163.865] (-1161.557) (-1161.986) (-1165.359) * (-1165.012) (-1161.299) (-1165.555) [-1161.217] -- 0:00:25
587500 -- (-1165.586) [-1161.946] (-1165.738) (-1170.477) * (-1161.578) [-1163.601] (-1160.960) (-1161.239) -- 0:00:25
588000 -- (-1163.338) (-1165.057) [-1164.577] (-1166.302) * (-1161.178) (-1163.870) [-1161.121] (-1162.743) -- 0:00:25
588500 -- (-1161.925) [-1162.960] (-1166.135) (-1163.491) * (-1162.767) (-1162.392) [-1162.653] (-1162.686) -- 0:00:25
589000 -- (-1162.311) (-1161.867) [-1162.952] (-1162.592) * (-1161.456) (-1161.416) (-1161.865) [-1161.982] -- 0:00:25
589500 -- (-1163.995) (-1164.725) [-1161.727] (-1162.404) * (-1161.209) [-1161.689] (-1161.817) (-1162.435) -- 0:00:25
590000 -- (-1161.216) [-1162.937] (-1165.209) (-1161.586) * (-1164.542) (-1163.026) [-1163.357] (-1163.527) -- 0:00:25
Average standard deviation of split frequencies: 0.008939
590500 -- [-1161.761] (-1162.108) (-1165.505) (-1164.794) * [-1162.727] (-1164.398) (-1163.426) (-1164.169) -- 0:00:24
591000 -- [-1162.751] (-1164.254) (-1165.732) (-1166.489) * (-1167.716) (-1161.495) [-1164.372] (-1161.571) -- 0:00:24
591500 -- (-1162.084) [-1163.150] (-1165.806) (-1164.902) * (-1165.378) (-1162.539) [-1162.998] (-1161.944) -- 0:00:24
592000 -- [-1163.085] (-1169.813) (-1167.234) (-1161.572) * (-1163.660) (-1161.843) (-1162.553) [-1161.339] -- 0:00:24
592500 -- (-1164.602) (-1162.630) [-1164.546] (-1163.269) * (-1163.988) [-1161.664] (-1162.612) (-1161.929) -- 0:00:24
593000 -- (-1165.738) (-1162.895) (-1162.966) [-1161.869] * (-1171.222) [-1162.309] (-1162.759) (-1163.271) -- 0:00:24
593500 -- (-1161.800) (-1162.368) [-1163.551] (-1162.908) * [-1161.354] (-1161.430) (-1162.879) (-1164.226) -- 0:00:24
594000 -- (-1165.459) (-1162.271) [-1163.900] (-1166.699) * (-1165.743) (-1162.056) [-1161.332] (-1162.426) -- 0:00:24
594500 -- [-1162.753] (-1163.381) (-1163.998) (-1164.989) * (-1167.211) (-1162.011) [-1161.176] (-1163.312) -- 0:00:24
595000 -- (-1165.879) (-1162.087) [-1164.100] (-1163.547) * (-1164.490) (-1162.346) [-1161.227] (-1162.536) -- 0:00:24
Average standard deviation of split frequencies: 0.008700
595500 -- (-1165.822) [-1164.436] (-1165.953) (-1162.899) * (-1164.913) (-1162.352) (-1162.072) [-1161.180] -- 0:00:25
596000 -- (-1169.772) (-1164.060) [-1162.365] (-1164.590) * (-1162.120) (-1163.465) [-1162.263] (-1166.658) -- 0:00:25
596500 -- (-1162.646) (-1164.069) (-1163.223) [-1161.318] * (-1163.974) (-1162.783) (-1162.824) [-1163.401] -- 0:00:25
597000 -- [-1164.138] (-1163.409) (-1165.892) (-1166.726) * (-1164.504) (-1168.701) (-1161.587) [-1161.595] -- 0:00:24
597500 -- [-1162.544] (-1162.454) (-1163.298) (-1162.268) * [-1168.925] (-1163.567) (-1161.877) (-1161.774) -- 0:00:24
598000 -- [-1162.986] (-1166.595) (-1163.510) (-1164.501) * (-1164.176) (-1165.647) (-1167.018) [-1161.768] -- 0:00:24
598500 -- (-1164.623) (-1162.656) [-1164.895] (-1164.514) * (-1163.801) (-1162.063) (-1165.181) [-1164.968] -- 0:00:24
599000 -- (-1169.831) [-1162.728] (-1170.560) (-1160.916) * [-1162.114] (-1162.330) (-1164.745) (-1162.072) -- 0:00:24
599500 -- [-1169.534] (-1162.938) (-1169.898) (-1161.502) * (-1163.687) (-1171.882) [-1164.117] (-1161.865) -- 0:00:24
600000 -- (-1169.624) [-1161.475] (-1161.377) (-1162.531) * (-1163.856) (-1165.260) [-1164.608] (-1165.295) -- 0:00:24
Average standard deviation of split frequencies: 0.008633
600500 -- [-1168.982] (-1167.259) (-1163.670) (-1162.395) * [-1163.261] (-1164.260) (-1162.767) (-1161.874) -- 0:00:24
601000 -- (-1162.849) (-1163.087) [-1166.441] (-1162.476) * [-1162.381] (-1162.635) (-1161.323) (-1162.267) -- 0:00:24
601500 -- (-1161.913) [-1162.182] (-1161.823) (-1162.890) * (-1162.688) (-1161.567) (-1162.494) [-1161.861] -- 0:00:24
602000 -- [-1162.165] (-1161.400) (-1162.508) (-1163.673) * (-1162.737) [-1164.283] (-1161.496) (-1163.717) -- 0:00:24
602500 -- (-1163.793) [-1164.878] (-1167.134) (-1167.398) * (-1162.195) (-1163.548) [-1162.452] (-1163.964) -- 0:00:24
603000 -- (-1163.019) (-1165.909) (-1165.335) [-1163.098] * (-1163.744) [-1162.134] (-1161.222) (-1164.195) -- 0:00:24
603500 -- [-1163.902] (-1163.914) (-1162.247) (-1162.287) * (-1162.495) [-1163.599] (-1161.027) (-1165.550) -- 0:00:24
604000 -- (-1163.459) (-1165.570) (-1164.145) [-1163.636] * (-1162.951) [-1162.904] (-1162.040) (-1162.461) -- 0:00:24
604500 -- [-1162.270] (-1163.035) (-1168.352) (-1163.532) * (-1162.297) [-1163.085] (-1162.824) (-1163.066) -- 0:00:24
605000 -- (-1164.180) [-1164.252] (-1164.867) (-1164.684) * (-1164.884) (-1163.949) (-1162.368) [-1162.274] -- 0:00:24
Average standard deviation of split frequencies: 0.008712
605500 -- [-1162.786] (-1162.552) (-1164.384) (-1163.108) * (-1163.403) [-1162.721] (-1162.293) (-1162.268) -- 0:00:24
606000 -- (-1162.368) [-1165.988] (-1166.213) (-1163.246) * (-1162.024) (-1164.470) [-1163.790] (-1163.141) -- 0:00:24
606500 -- (-1165.194) [-1162.133] (-1161.813) (-1163.715) * (-1161.332) (-1163.958) [-1164.980] (-1163.297) -- 0:00:24
607000 -- (-1164.911) (-1161.175) (-1162.335) [-1164.733] * (-1161.552) [-1163.609] (-1163.148) (-1168.428) -- 0:00:23
607500 -- [-1164.900] (-1162.339) (-1162.029) (-1162.121) * (-1164.570) [-1164.944] (-1165.000) (-1173.549) -- 0:00:23
608000 -- [-1162.861] (-1165.995) (-1162.407) (-1161.410) * (-1167.092) [-1169.026] (-1164.715) (-1173.779) -- 0:00:23
608500 -- (-1161.633) (-1162.388) (-1160.714) [-1161.492] * (-1163.620) (-1161.655) [-1161.930] (-1162.145) -- 0:00:23
609000 -- (-1165.824) (-1162.883) [-1161.741] (-1162.613) * [-1165.874] (-1161.704) (-1163.249) (-1163.450) -- 0:00:23
609500 -- [-1166.422] (-1162.318) (-1163.998) (-1161.184) * (-1163.785) (-1163.577) (-1161.184) [-1162.252] -- 0:00:23
610000 -- (-1165.260) (-1162.748) (-1166.302) [-1163.108] * (-1163.124) (-1166.548) (-1165.560) [-1162.341] -- 0:00:23
Average standard deviation of split frequencies: 0.007874
610500 -- (-1161.629) [-1162.307] (-1163.648) (-1162.069) * (-1161.732) [-1163.516] (-1164.315) (-1164.026) -- 0:00:23
611000 -- (-1162.363) (-1163.813) (-1164.633) [-1161.606] * (-1162.069) (-1162.953) (-1164.161) [-1161.856] -- 0:00:23
611500 -- (-1162.426) (-1162.532) [-1164.578] (-1161.959) * (-1161.043) (-1163.728) (-1163.968) [-1166.626] -- 0:00:24
612000 -- (-1163.464) (-1164.499) (-1161.623) [-1162.046] * [-1162.100] (-1162.253) (-1162.230) (-1164.136) -- 0:00:24
612500 -- (-1163.912) (-1164.615) [-1168.278] (-1164.260) * [-1165.938] (-1161.874) (-1163.760) (-1163.265) -- 0:00:24
613000 -- [-1163.491] (-1163.769) (-1161.836) (-1163.269) * (-1163.440) (-1161.709) (-1166.941) [-1161.980] -- 0:00:23
613500 -- (-1162.589) (-1162.963) (-1163.614) [-1162.532] * [-1162.332] (-1161.602) (-1165.202) (-1164.516) -- 0:00:23
614000 -- (-1163.482) [-1165.143] (-1163.631) (-1164.176) * [-1163.211] (-1169.506) (-1168.668) (-1162.624) -- 0:00:23
614500 -- (-1163.680) (-1162.815) [-1165.170] (-1166.007) * [-1163.229] (-1164.470) (-1168.683) (-1163.089) -- 0:00:23
615000 -- [-1163.327] (-1163.203) (-1163.871) (-1166.505) * [-1163.063] (-1162.055) (-1165.312) (-1162.714) -- 0:00:23
Average standard deviation of split frequencies: 0.008418
615500 -- [-1163.440] (-1162.255) (-1164.409) (-1163.903) * (-1164.614) [-1161.976] (-1163.027) (-1164.885) -- 0:00:23
616000 -- [-1163.886] (-1164.450) (-1162.335) (-1166.810) * [-1164.087] (-1163.571) (-1165.782) (-1163.534) -- 0:00:23
616500 -- [-1163.230] (-1161.385) (-1162.391) (-1163.225) * [-1165.268] (-1165.028) (-1163.857) (-1164.260) -- 0:00:23
617000 -- [-1164.186] (-1164.060) (-1165.253) (-1163.350) * (-1164.056) [-1166.045] (-1163.085) (-1164.797) -- 0:00:23
617500 -- [-1161.463] (-1162.477) (-1161.574) (-1163.390) * [-1165.341] (-1166.272) (-1165.774) (-1163.888) -- 0:00:23
618000 -- (-1160.966) [-1162.317] (-1161.904) (-1164.376) * (-1164.465) (-1164.373) [-1164.896] (-1164.975) -- 0:00:23
618500 -- (-1162.511) (-1162.021) [-1161.410] (-1162.797) * (-1168.964) (-1165.973) [-1163.808] (-1162.691) -- 0:00:23
619000 -- (-1163.398) (-1161.548) (-1164.416) [-1162.070] * (-1162.179) (-1163.783) (-1161.305) [-1163.967] -- 0:00:23
619500 -- [-1164.928] (-1161.920) (-1163.553) (-1161.408) * (-1161.234) (-1162.643) (-1162.625) [-1167.044] -- 0:00:23
620000 -- (-1166.751) (-1162.237) [-1163.977] (-1165.425) * (-1161.972) (-1162.767) [-1162.600] (-1165.482) -- 0:00:23
Average standard deviation of split frequencies: 0.008051
620500 -- (-1164.454) [-1162.186] (-1164.782) (-1164.160) * (-1161.648) (-1162.665) [-1160.886] (-1164.544) -- 0:00:23
621000 -- [-1164.208] (-1162.048) (-1163.433) (-1162.685) * (-1166.568) (-1163.167) (-1163.475) [-1164.367] -- 0:00:23
621500 -- (-1162.943) [-1165.375] (-1164.743) (-1161.253) * (-1162.738) (-1161.127) [-1161.701] (-1164.259) -- 0:00:23
622000 -- (-1162.913) (-1161.544) [-1163.811] (-1162.859) * (-1163.291) [-1161.713] (-1162.981) (-1161.652) -- 0:00:23
622500 -- [-1163.182] (-1165.879) (-1162.201) (-1163.727) * (-1164.790) (-1163.252) (-1161.322) [-1161.465] -- 0:00:23
623000 -- [-1161.978] (-1164.313) (-1163.318) (-1161.638) * (-1166.980) [-1164.474] (-1162.501) (-1161.776) -- 0:00:22
623500 -- (-1163.987) (-1163.033) (-1170.887) [-1161.375] * (-1165.151) (-1165.884) (-1162.106) [-1162.372] -- 0:00:22
624000 -- (-1166.648) (-1163.011) [-1166.827] (-1162.412) * (-1163.380) (-1163.882) [-1165.307] (-1163.293) -- 0:00:22
624500 -- [-1161.263] (-1162.576) (-1163.751) (-1163.414) * (-1162.110) (-1162.352) [-1162.612] (-1163.471) -- 0:00:22
625000 -- (-1161.767) (-1163.157) (-1163.337) [-1162.561] * [-1162.545] (-1162.987) (-1164.289) (-1166.005) -- 0:00:22
Average standard deviation of split frequencies: 0.008283
625500 -- (-1165.011) [-1161.926] (-1168.616) (-1164.258) * [-1161.818] (-1162.701) (-1164.330) (-1161.589) -- 0:00:22
626000 -- (-1161.776) (-1163.159) [-1166.311] (-1164.020) * (-1166.524) [-1161.797] (-1163.795) (-1164.650) -- 0:00:22
626500 -- (-1162.128) (-1161.029) [-1161.650] (-1161.543) * (-1162.328) [-1162.901] (-1164.793) (-1165.093) -- 0:00:22
627000 -- [-1163.554] (-1161.776) (-1164.796) (-1163.865) * (-1161.749) [-1162.476] (-1166.189) (-1161.163) -- 0:00:22
627500 -- (-1163.798) [-1162.331] (-1162.782) (-1163.411) * [-1162.115] (-1162.468) (-1162.964) (-1160.851) -- 0:00:22
628000 -- (-1161.286) (-1161.291) (-1166.368) [-1164.639] * (-1161.573) [-1163.325] (-1163.130) (-1160.817) -- 0:00:22
628500 -- (-1163.537) (-1162.589) [-1167.788] (-1165.161) * (-1162.421) (-1162.557) [-1166.616] (-1164.903) -- 0:00:23
629000 -- (-1164.300) [-1163.323] (-1165.976) (-1162.766) * [-1164.499] (-1162.109) (-1161.047) (-1167.946) -- 0:00:23
629500 -- (-1164.622) (-1163.061) (-1162.651) [-1161.403] * (-1165.945) (-1162.700) [-1161.261] (-1162.916) -- 0:00:22
630000 -- (-1166.744) (-1163.248) [-1163.549] (-1162.029) * (-1162.881) [-1162.360] (-1162.349) (-1163.054) -- 0:00:22
Average standard deviation of split frequencies: 0.008073
630500 -- (-1163.843) (-1164.066) (-1162.670) [-1162.391] * (-1164.224) [-1162.676] (-1165.058) (-1162.585) -- 0:00:22
631000 -- [-1162.130] (-1162.646) (-1163.744) (-1161.252) * (-1165.301) (-1164.609) (-1164.454) [-1161.861] -- 0:00:22
631500 -- (-1163.486) (-1162.024) [-1167.462] (-1163.219) * [-1163.056] (-1163.891) (-1166.696) (-1162.958) -- 0:00:22
632000 -- (-1164.275) (-1160.924) [-1165.321] (-1164.901) * (-1161.944) [-1163.087] (-1168.345) (-1162.488) -- 0:00:22
632500 -- (-1161.976) [-1164.193] (-1164.714) (-1162.254) * (-1163.210) (-1161.696) [-1162.014] (-1162.565) -- 0:00:22
633000 -- (-1162.012) (-1165.046) (-1167.374) [-1161.463] * (-1162.341) [-1161.429] (-1165.171) (-1163.655) -- 0:00:22
633500 -- (-1162.653) (-1162.185) (-1165.009) [-1162.437] * [-1163.414] (-1161.807) (-1163.581) (-1162.062) -- 0:00:22
634000 -- (-1162.949) [-1162.187] (-1171.171) (-1161.643) * (-1164.563) (-1165.268) [-1162.728] (-1161.394) -- 0:00:22
634500 -- [-1162.756] (-1163.918) (-1167.269) (-1164.758) * (-1162.259) [-1162.485] (-1162.434) (-1162.675) -- 0:00:22
635000 -- (-1161.407) (-1162.296) (-1163.890) [-1162.739] * [-1166.162] (-1161.832) (-1163.181) (-1165.407) -- 0:00:22
Average standard deviation of split frequencies: 0.009191
635500 -- (-1161.246) [-1161.464] (-1160.784) (-1166.016) * [-1162.888] (-1162.245) (-1162.966) (-1162.464) -- 0:00:22
636000 -- [-1168.940] (-1161.294) (-1164.414) (-1161.831) * (-1162.212) (-1164.723) [-1161.487] (-1160.911) -- 0:00:22
636500 -- (-1165.068) [-1161.356] (-1162.099) (-1161.325) * (-1163.855) (-1162.770) (-1162.096) [-1161.950] -- 0:00:22
637000 -- (-1167.442) (-1165.158) (-1170.237) [-1163.576] * (-1167.662) (-1162.996) [-1161.308] (-1163.959) -- 0:00:22
637500 -- (-1165.478) (-1165.298) [-1161.851] (-1163.653) * (-1163.083) (-1162.563) (-1164.251) [-1162.054] -- 0:00:22
638000 -- [-1164.787] (-1166.546) (-1164.718) (-1165.344) * (-1162.500) [-1165.561] (-1163.976) (-1163.728) -- 0:00:22
638500 -- (-1165.126) (-1169.249) [-1163.579] (-1165.537) * (-1164.905) [-1162.536] (-1161.844) (-1164.913) -- 0:00:22
639000 -- (-1166.361) (-1164.312) (-1162.443) [-1163.032] * (-1161.986) (-1164.630) (-1166.244) [-1160.838] -- 0:00:22
639500 -- [-1167.995] (-1163.312) (-1163.957) (-1162.701) * (-1164.987) (-1168.044) (-1163.520) [-1160.854] -- 0:00:21
640000 -- [-1161.532] (-1162.357) (-1170.531) (-1161.847) * [-1162.574] (-1166.429) (-1162.397) (-1164.242) -- 0:00:21
Average standard deviation of split frequencies: 0.009713
640500 -- [-1161.499] (-1162.838) (-1167.873) (-1164.992) * [-1162.261] (-1167.710) (-1162.828) (-1163.449) -- 0:00:21
641000 -- (-1161.217) [-1161.460] (-1164.839) (-1162.253) * (-1164.332) (-1170.450) (-1166.542) [-1162.373] -- 0:00:21
641500 -- (-1161.854) (-1162.971) [-1162.696] (-1162.823) * (-1163.232) (-1166.661) [-1162.845] (-1164.065) -- 0:00:21
642000 -- (-1162.614) (-1162.645) (-1162.355) [-1162.389] * (-1165.161) [-1162.503] (-1161.953) (-1161.996) -- 0:00:21
642500 -- [-1164.166] (-1162.637) (-1163.498) (-1162.998) * (-1166.105) (-1169.113) (-1163.422) [-1163.727] -- 0:00:21
643000 -- (-1161.335) (-1162.644) [-1162.039] (-1163.520) * [-1164.273] (-1163.452) (-1162.771) (-1162.451) -- 0:00:21
643500 -- (-1161.798) [-1161.074] (-1165.257) (-1162.517) * (-1165.982) (-1165.864) [-1164.611] (-1164.992) -- 0:00:21
644000 -- [-1162.929] (-1163.173) (-1163.928) (-1164.213) * (-1164.636) (-1164.050) [-1162.259] (-1165.187) -- 0:00:21
644500 -- (-1162.599) (-1164.154) [-1165.389] (-1167.855) * [-1163.271] (-1165.193) (-1166.803) (-1167.944) -- 0:00:21
645000 -- (-1163.945) (-1164.247) (-1163.233) [-1161.345] * [-1162.457] (-1164.031) (-1166.489) (-1165.392) -- 0:00:21
Average standard deviation of split frequencies: 0.010362
645500 -- (-1165.560) (-1166.990) [-1162.704] (-1161.018) * (-1168.530) (-1164.074) (-1163.609) [-1163.031] -- 0:00:21
646000 -- [-1162.733] (-1165.659) (-1162.920) (-1161.673) * (-1166.610) (-1163.657) (-1163.589) [-1162.040] -- 0:00:21
646500 -- (-1167.619) [-1165.748] (-1166.657) (-1162.861) * (-1162.154) (-1163.630) (-1164.092) [-1163.054] -- 0:00:21
647000 -- (-1161.637) (-1165.870) (-1161.839) [-1161.927] * [-1161.335] (-1165.599) (-1162.538) (-1162.257) -- 0:00:21
647500 -- (-1163.665) (-1166.246) (-1162.503) [-1161.766] * [-1161.476] (-1167.777) (-1163.311) (-1162.681) -- 0:00:21
648000 -- (-1165.888) (-1165.229) (-1163.502) [-1162.018] * (-1164.483) (-1165.766) [-1162.640] (-1163.550) -- 0:00:21
648500 -- (-1162.863) (-1162.924) [-1166.505] (-1164.221) * (-1165.914) (-1163.147) [-1162.421] (-1161.971) -- 0:00:21
649000 -- (-1164.994) (-1163.727) [-1161.727] (-1162.104) * (-1162.484) (-1162.444) (-1162.498) [-1160.911] -- 0:00:21
649500 -- (-1164.344) (-1164.646) [-1161.418] (-1162.817) * (-1165.436) (-1165.083) (-1161.925) [-1162.782] -- 0:00:21
650000 -- (-1161.707) [-1162.645] (-1162.064) (-1163.073) * (-1173.547) (-1162.490) (-1162.625) [-1162.142] -- 0:00:21
Average standard deviation of split frequencies: 0.009418
650500 -- (-1161.592) (-1170.416) [-1162.708] (-1163.383) * (-1166.030) (-1166.648) [-1163.336] (-1163.353) -- 0:00:21
651000 -- (-1169.173) (-1164.589) (-1162.093) [-1161.684] * (-1163.767) (-1162.731) [-1162.417] (-1163.097) -- 0:00:21
651500 -- (-1164.819) [-1163.687] (-1163.339) (-1161.320) * (-1161.833) [-1162.548] (-1162.979) (-1164.382) -- 0:00:21
652000 -- [-1162.702] (-1163.698) (-1162.548) (-1161.204) * [-1165.537] (-1163.689) (-1165.927) (-1164.100) -- 0:00:21
652500 -- (-1161.410) (-1162.629) (-1161.788) [-1160.906] * (-1162.674) (-1163.968) (-1162.614) [-1163.531] -- 0:00:21
653000 -- [-1161.176] (-1164.797) (-1163.892) (-1161.687) * (-1164.321) [-1163.252] (-1165.506) (-1164.458) -- 0:00:21
653500 -- (-1162.132) (-1160.956) [-1164.229] (-1162.242) * (-1165.263) [-1161.592] (-1163.078) (-1166.786) -- 0:00:21
654000 -- (-1164.305) (-1167.342) (-1162.915) [-1164.009] * (-1164.935) (-1167.239) (-1162.671) [-1161.514] -- 0:00:21
654500 -- [-1163.421] (-1163.988) (-1163.806) (-1165.830) * (-1165.689) (-1164.156) [-1166.393] (-1161.632) -- 0:00:21
655000 -- (-1162.587) [-1163.481] (-1166.711) (-1166.805) * (-1165.911) (-1166.493) (-1163.069) [-1163.487] -- 0:00:21
Average standard deviation of split frequencies: 0.009629
655500 -- (-1161.724) (-1164.093) (-1163.266) [-1163.098] * [-1164.915] (-1161.922) (-1163.324) (-1162.898) -- 0:00:21
656000 -- (-1163.187) [-1163.836] (-1162.142) (-1161.914) * (-1166.428) (-1161.419) [-1166.559] (-1166.887) -- 0:00:20
656500 -- (-1161.837) [-1162.055] (-1165.058) (-1162.520) * (-1162.515) (-1162.126) (-1163.696) [-1161.341] -- 0:00:20
657000 -- (-1163.266) [-1161.430] (-1161.881) (-1163.008) * (-1161.516) (-1161.322) (-1161.470) [-1164.201] -- 0:00:20
657500 -- (-1164.450) [-1164.460] (-1164.063) (-1163.031) * (-1162.907) [-1162.001] (-1162.138) (-1162.973) -- 0:00:20
658000 -- [-1162.749] (-1162.927) (-1167.087) (-1172.127) * (-1170.220) (-1161.856) [-1163.649] (-1161.754) -- 0:00:20
658500 -- [-1162.977] (-1163.283) (-1162.606) (-1168.228) * (-1165.834) [-1164.152] (-1164.506) (-1162.319) -- 0:00:20
659000 -- (-1161.736) (-1162.988) (-1163.771) [-1165.682] * (-1166.326) (-1164.328) (-1162.779) [-1162.408] -- 0:00:20
659500 -- (-1163.202) (-1161.523) (-1166.291) [-1161.814] * [-1162.874] (-1165.902) (-1163.679) (-1164.261) -- 0:00:20
660000 -- (-1162.344) (-1162.120) (-1163.938) [-1162.115] * (-1162.483) (-1162.646) (-1161.958) [-1165.927] -- 0:00:20
Average standard deviation of split frequencies: 0.010275
660500 -- (-1167.114) (-1164.426) (-1162.032) [-1163.275] * (-1162.757) (-1163.877) [-1161.548] (-1163.399) -- 0:00:20
661000 -- [-1168.671] (-1165.819) (-1165.199) (-1165.884) * (-1165.898) [-1161.215] (-1163.188) (-1164.685) -- 0:00:21
661500 -- [-1163.508] (-1163.358) (-1165.047) (-1163.767) * [-1167.120] (-1161.788) (-1166.409) (-1163.975) -- 0:00:20
662000 -- (-1162.544) (-1163.151) (-1162.675) [-1167.060] * [-1161.294] (-1165.567) (-1164.501) (-1163.169) -- 0:00:20
662500 -- (-1163.417) (-1162.137) [-1163.825] (-1163.637) * (-1161.972) (-1164.118) [-1161.812] (-1164.179) -- 0:00:20
663000 -- (-1163.377) [-1163.125] (-1164.627) (-1165.240) * (-1162.445) (-1163.426) [-1162.004] (-1162.083) -- 0:00:20
663500 -- (-1163.703) [-1162.609] (-1165.236) (-1164.616) * (-1166.063) (-1162.269) (-1162.503) [-1162.083] -- 0:00:20
664000 -- [-1162.477] (-1162.453) (-1166.110) (-1162.279) * (-1161.860) (-1161.346) (-1164.407) [-1165.129] -- 0:00:20
664500 -- (-1161.314) (-1163.837) [-1161.717] (-1165.506) * (-1162.122) (-1164.585) [-1162.403] (-1164.199) -- 0:00:20
665000 -- (-1161.337) [-1162.324] (-1161.307) (-1168.896) * (-1162.247) [-1166.288] (-1162.402) (-1163.017) -- 0:00:20
Average standard deviation of split frequencies: 0.009485
665500 -- (-1163.242) (-1163.074) [-1163.157] (-1164.998) * (-1162.171) (-1163.224) (-1162.699) [-1164.309] -- 0:00:20
666000 -- (-1165.623) [-1161.682] (-1163.595) (-1164.229) * [-1161.782] (-1162.841) (-1162.837) (-1164.209) -- 0:00:20
666500 -- (-1164.727) (-1163.122) [-1162.919] (-1164.012) * (-1161.658) (-1163.544) (-1162.572) [-1162.995] -- 0:00:20
667000 -- [-1164.748] (-1161.537) (-1162.898) (-1163.586) * [-1161.743] (-1163.085) (-1165.394) (-1161.431) -- 0:00:20
667500 -- (-1165.259) [-1163.150] (-1163.120) (-1162.895) * (-1161.153) (-1165.542) (-1170.446) [-1162.138] -- 0:00:20
668000 -- (-1161.770) [-1161.905] (-1161.970) (-1165.961) * (-1162.928) (-1165.356) (-1168.008) [-1164.647] -- 0:00:20
668500 -- (-1162.087) (-1162.181) [-1161.968] (-1164.378) * (-1165.437) [-1162.724] (-1163.036) (-1163.711) -- 0:00:20
669000 -- (-1163.346) [-1163.311] (-1162.339) (-1161.441) * (-1161.627) [-1162.331] (-1163.709) (-1162.015) -- 0:00:20
669500 -- (-1163.573) (-1161.923) (-1162.037) [-1161.600] * (-1164.755) (-1163.649) [-1161.577] (-1162.511) -- 0:00:20
670000 -- (-1162.737) [-1162.139] (-1162.163) (-1162.917) * (-1165.581) (-1161.705) [-1161.540] (-1166.041) -- 0:00:20
Average standard deviation of split frequencies: 0.009559
670500 -- (-1165.069) [-1164.166] (-1161.662) (-1162.024) * (-1162.732) [-1161.166] (-1165.338) (-1162.058) -- 0:00:20
671000 -- (-1167.340) (-1163.228) [-1162.846] (-1162.209) * (-1160.921) (-1162.556) (-1161.428) [-1164.472] -- 0:00:20
671500 -- (-1162.133) (-1164.973) (-1165.279) [-1162.093] * [-1162.885] (-1169.697) (-1161.477) (-1164.340) -- 0:00:20
672000 -- (-1161.969) (-1163.460) [-1166.449] (-1162.168) * (-1163.632) (-1164.175) [-1163.213] (-1162.991) -- 0:00:20
672500 -- (-1161.546) (-1162.271) [-1160.936] (-1165.309) * (-1162.770) (-1161.898) (-1161.947) [-1161.399] -- 0:00:19
673000 -- (-1164.902) (-1161.211) (-1165.620) [-1161.378] * (-1164.322) (-1161.824) [-1162.213] (-1165.281) -- 0:00:19
673500 -- (-1164.608) (-1163.827) (-1169.150) [-1162.628] * (-1163.439) (-1160.993) [-1161.573] (-1164.784) -- 0:00:19
674000 -- (-1163.919) (-1163.265) (-1166.218) [-1162.418] * [-1161.559] (-1161.626) (-1162.350) (-1162.608) -- 0:00:19
674500 -- (-1166.050) (-1161.886) (-1167.117) [-1161.785] * (-1163.280) (-1164.987) (-1164.164) [-1166.555] -- 0:00:19
675000 -- [-1162.678] (-1166.876) (-1162.773) (-1165.480) * (-1165.853) (-1164.828) (-1163.152) [-1163.818] -- 0:00:19
Average standard deviation of split frequencies: 0.008647
675500 -- (-1163.879) (-1163.090) (-1162.684) [-1163.747] * (-1163.519) [-1167.890] (-1161.875) (-1166.375) -- 0:00:19
676000 -- (-1163.243) (-1163.891) (-1165.164) [-1165.126] * (-1162.060) (-1163.958) (-1161.154) [-1167.413] -- 0:00:19
676500 -- (-1161.043) (-1163.000) (-1161.036) [-1162.551] * (-1164.716) [-1163.360] (-1164.667) (-1163.381) -- 0:00:19
677000 -- (-1163.793) [-1162.421] (-1161.221) (-1165.961) * (-1162.372) (-1162.674) (-1163.021) [-1163.197] -- 0:00:19
677500 -- (-1166.530) [-1163.492] (-1167.333) (-1161.944) * (-1167.454) (-1163.168) (-1161.826) [-1164.191] -- 0:00:19
678000 -- (-1161.067) (-1162.416) (-1161.242) [-1162.965] * (-1166.259) (-1164.327) [-1162.123] (-1162.615) -- 0:00:19
678500 -- (-1161.370) [-1162.966] (-1169.541) (-1164.631) * [-1162.256] (-1162.874) (-1161.291) (-1163.764) -- 0:00:19
679000 -- (-1161.930) (-1163.711) (-1163.422) [-1164.472] * (-1165.222) (-1161.701) (-1161.531) [-1162.049] -- 0:00:19
679500 -- [-1163.665] (-1162.648) (-1161.367) (-1161.604) * (-1163.862) [-1161.404] (-1164.398) (-1162.581) -- 0:00:19
680000 -- (-1162.083) (-1161.160) (-1161.888) [-1164.702] * [-1161.036] (-1167.918) (-1163.745) (-1164.331) -- 0:00:19
Average standard deviation of split frequencies: 0.009003
680500 -- [-1162.765] (-1162.174) (-1165.794) (-1162.886) * [-1163.463] (-1165.179) (-1163.522) (-1163.315) -- 0:00:19
681000 -- [-1162.100] (-1168.090) (-1162.172) (-1162.152) * (-1166.588) (-1163.652) (-1163.407) [-1164.456] -- 0:00:19
681500 -- [-1165.092] (-1165.851) (-1163.251) (-1163.538) * (-1162.007) (-1163.696) (-1161.829) [-1163.986] -- 0:00:19
682000 -- [-1164.526] (-1162.603) (-1164.418) (-1161.892) * (-1163.570) (-1161.394) [-1166.844] (-1163.381) -- 0:00:19
682500 -- [-1162.492] (-1167.628) (-1164.008) (-1163.719) * [-1162.992] (-1165.874) (-1165.802) (-1163.255) -- 0:00:19
683000 -- (-1161.658) (-1164.497) [-1166.170] (-1163.532) * (-1162.139) (-1162.370) (-1165.911) [-1161.804] -- 0:00:19
683500 -- (-1161.970) (-1165.833) (-1162.933) [-1161.248] * (-1164.125) [-1162.112] (-1161.936) (-1163.450) -- 0:00:19
684000 -- (-1162.135) (-1167.336) (-1162.973) [-1164.200] * [-1165.592] (-1164.298) (-1162.654) (-1164.416) -- 0:00:19
684500 -- (-1162.163) (-1165.227) [-1161.840] (-1166.575) * (-1163.741) (-1165.496) [-1161.894] (-1165.962) -- 0:00:19
685000 -- [-1162.018] (-1161.826) (-1162.524) (-1162.684) * (-1164.923) (-1162.244) (-1162.544) [-1162.533] -- 0:00:19
Average standard deviation of split frequencies: 0.009071
685500 -- (-1162.650) (-1162.877) [-1162.412] (-1163.450) * [-1161.886] (-1161.637) (-1165.133) (-1163.264) -- 0:00:19
686000 -- (-1166.077) [-1164.788] (-1164.161) (-1165.497) * [-1163.837] (-1161.651) (-1165.670) (-1164.204) -- 0:00:19
686500 -- (-1165.161) (-1164.198) [-1161.362] (-1166.316) * [-1164.745] (-1163.533) (-1162.330) (-1169.221) -- 0:00:19
687000 -- (-1162.502) (-1163.337) (-1161.028) [-1163.389] * [-1164.895] (-1161.983) (-1164.221) (-1162.810) -- 0:00:19
687500 -- (-1161.217) (-1163.195) [-1161.529] (-1163.162) * (-1162.479) (-1166.088) (-1165.084) [-1162.047] -- 0:00:19
688000 -- (-1161.447) (-1161.547) [-1166.079] (-1163.663) * (-1166.338) (-1161.346) [-1165.394] (-1165.229) -- 0:00:19
688500 -- (-1162.657) [-1161.028] (-1162.609) (-1162.632) * (-1162.540) [-1162.682] (-1162.099) (-1162.830) -- 0:00:19
689000 -- [-1162.002] (-1161.097) (-1162.121) (-1162.098) * (-1165.110) [-1161.884] (-1162.634) (-1163.244) -- 0:00:18
689500 -- (-1165.214) [-1162.540] (-1161.608) (-1161.280) * (-1165.678) (-1161.788) (-1163.220) [-1165.273] -- 0:00:18
690000 -- [-1164.178] (-1163.941) (-1171.009) (-1162.153) * (-1164.359) [-1162.759] (-1164.108) (-1164.406) -- 0:00:18
Average standard deviation of split frequencies: 0.010238
690500 -- (-1163.245) (-1162.863) (-1161.960) [-1163.377] * (-1161.455) (-1162.415) [-1163.077] (-1163.176) -- 0:00:18
691000 -- (-1162.617) (-1163.115) (-1164.319) [-1160.860] * (-1163.118) (-1163.409) [-1161.040] (-1161.287) -- 0:00:18
691500 -- (-1163.358) (-1164.415) [-1162.091] (-1166.129) * (-1163.207) (-1166.277) (-1161.555) [-1161.741] -- 0:00:18
692000 -- (-1163.524) (-1163.440) [-1162.565] (-1162.438) * (-1163.960) (-1163.220) (-1163.608) [-1161.659] -- 0:00:18
692500 -- (-1162.295) [-1162.859] (-1167.344) (-1161.968) * [-1163.107] (-1163.440) (-1161.534) (-1163.107) -- 0:00:18
693000 -- (-1163.275) (-1161.722) (-1164.215) [-1162.021] * (-1161.903) [-1162.920] (-1161.537) (-1162.613) -- 0:00:18
693500 -- (-1163.336) (-1162.466) [-1164.276] (-1161.728) * (-1164.680) (-1161.679) [-1162.781] (-1163.446) -- 0:00:18
694000 -- (-1163.223) (-1161.747) (-1166.146) [-1165.002] * (-1163.014) [-1161.812] (-1164.227) (-1161.865) -- 0:00:18
694500 -- (-1162.074) [-1161.764] (-1165.944) (-1162.654) * (-1161.958) (-1170.741) [-1164.929] (-1166.945) -- 0:00:18
695000 -- [-1161.218] (-1161.857) (-1162.795) (-1164.536) * [-1164.940] (-1165.722) (-1163.042) (-1164.473) -- 0:00:18
Average standard deviation of split frequencies: 0.010701
695500 -- (-1162.525) [-1162.954] (-1163.987) (-1165.856) * (-1164.293) [-1161.111] (-1161.514) (-1163.035) -- 0:00:18
696000 -- (-1163.960) (-1166.455) [-1161.833] (-1166.095) * (-1166.943) (-1161.647) [-1163.331] (-1161.954) -- 0:00:18
696500 -- (-1164.713) [-1163.603] (-1161.693) (-1167.925) * (-1166.424) (-1163.138) (-1161.193) [-1165.615] -- 0:00:18
697000 -- [-1162.902] (-1163.302) (-1161.711) (-1166.007) * [-1163.006] (-1162.462) (-1162.306) (-1164.163) -- 0:00:18
697500 -- [-1163.570] (-1160.980) (-1162.429) (-1162.994) * (-1163.230) [-1163.343] (-1163.158) (-1161.354) -- 0:00:18
698000 -- [-1162.949] (-1161.326) (-1162.136) (-1162.384) * [-1161.821] (-1162.660) (-1165.670) (-1164.647) -- 0:00:18
698500 -- (-1165.295) (-1161.945) [-1162.390] (-1164.938) * [-1161.423] (-1162.682) (-1163.742) (-1161.940) -- 0:00:18
699000 -- [-1166.156] (-1163.403) (-1164.293) (-1165.744) * (-1161.465) [-1161.937] (-1162.825) (-1165.701) -- 0:00:18
699500 -- [-1161.232] (-1166.196) (-1163.040) (-1166.131) * [-1162.179] (-1161.949) (-1167.702) (-1163.701) -- 0:00:18
700000 -- (-1164.364) (-1162.466) [-1162.509] (-1161.919) * (-1163.882) [-1161.554] (-1165.711) (-1161.447) -- 0:00:18
Average standard deviation of split frequencies: 0.010226
700500 -- (-1163.413) (-1161.318) [-1164.156] (-1161.804) * (-1165.885) (-1164.269) [-1163.804] (-1163.028) -- 0:00:18
701000 -- (-1165.411) [-1161.871] (-1163.767) (-1163.666) * [-1164.835] (-1162.063) (-1164.832) (-1164.056) -- 0:00:18
701500 -- (-1165.429) [-1162.482] (-1162.535) (-1164.728) * (-1162.293) (-1164.184) [-1163.770] (-1161.744) -- 0:00:18
702000 -- (-1163.807) [-1165.194] (-1164.485) (-1161.895) * (-1167.663) (-1162.243) [-1162.475] (-1161.586) -- 0:00:18
702500 -- [-1161.808] (-1163.110) (-1165.303) (-1163.496) * (-1164.580) [-1161.892] (-1161.736) (-1163.392) -- 0:00:18
703000 -- (-1162.044) (-1161.382) [-1161.905] (-1164.835) * (-1170.939) (-1164.314) [-1163.691] (-1163.002) -- 0:00:18
703500 -- (-1162.354) (-1164.045) [-1162.527] (-1164.557) * (-1166.865) [-1164.248] (-1163.919) (-1162.753) -- 0:00:18
704000 -- (-1162.702) [-1162.185] (-1164.359) (-1164.850) * [-1166.573] (-1162.279) (-1163.641) (-1166.888) -- 0:00:18
704500 -- (-1163.636) (-1163.614) (-1162.773) [-1164.018] * (-1165.813) (-1162.927) (-1162.499) [-1164.975] -- 0:00:18
705000 -- (-1163.783) (-1164.561) (-1163.834) [-1162.154] * (-1166.558) (-1164.805) [-1166.722] (-1165.508) -- 0:00:17
Average standard deviation of split frequencies: 0.009615
705500 -- [-1164.984] (-1165.041) (-1164.310) (-1161.831) * (-1163.390) (-1162.401) (-1163.986) [-1161.313] -- 0:00:17
706000 -- (-1165.418) [-1163.588] (-1167.606) (-1163.595) * (-1163.926) (-1164.990) [-1162.963] (-1161.349) -- 0:00:17
706500 -- (-1163.610) (-1164.900) [-1162.245] (-1161.556) * (-1163.196) (-1162.853) [-1163.316] (-1161.214) -- 0:00:17
707000 -- (-1165.006) (-1162.386) [-1163.173] (-1162.808) * (-1161.685) (-1161.528) (-1168.727) [-1161.420] -- 0:00:17
707500 -- (-1165.259) (-1162.385) (-1163.761) [-1161.822] * (-1161.051) (-1162.865) [-1161.647] (-1165.146) -- 0:00:17
708000 -- [-1162.779] (-1163.428) (-1166.689) (-1166.156) * (-1161.139) (-1165.965) (-1162.316) [-1165.409] -- 0:00:17
708500 -- (-1164.306) (-1161.788) (-1165.468) [-1164.889] * (-1165.702) [-1163.402] (-1161.516) (-1162.709) -- 0:00:17
709000 -- (-1162.954) [-1161.843] (-1161.412) (-1165.063) * (-1166.157) (-1164.724) [-1161.241] (-1162.097) -- 0:00:17
709500 -- (-1163.064) (-1163.429) (-1162.227) [-1164.159] * [-1162.295] (-1162.384) (-1163.867) (-1162.603) -- 0:00:17
710000 -- (-1168.020) (-1164.033) [-1162.490] (-1169.087) * (-1163.556) [-1161.973] (-1163.547) (-1161.619) -- 0:00:17
Average standard deviation of split frequencies: 0.009950
710500 -- (-1163.778) (-1168.412) (-1162.128) [-1164.338] * (-1163.275) (-1163.013) [-1162.545] (-1167.035) -- 0:00:17
711000 -- [-1161.966] (-1170.152) (-1162.978) (-1163.283) * [-1162.975] (-1165.402) (-1163.519) (-1163.372) -- 0:00:17
711500 -- (-1161.872) [-1161.643] (-1161.875) (-1162.453) * (-1164.024) (-1165.403) (-1164.618) [-1162.415] -- 0:00:17
712000 -- (-1165.117) (-1162.071) (-1162.650) [-1161.540] * (-1163.757) (-1162.370) [-1162.410] (-1161.757) -- 0:00:17
712500 -- (-1162.676) (-1162.575) [-1161.743] (-1164.771) * (-1162.357) (-1161.376) (-1161.177) [-1162.804] -- 0:00:17
713000 -- (-1162.527) (-1163.623) (-1161.474) [-1162.274] * [-1163.336] (-1162.281) (-1161.141) (-1162.863) -- 0:00:17
713500 -- (-1162.927) [-1163.591] (-1163.695) (-1161.413) * (-1165.264) [-1162.526] (-1161.333) (-1164.210) -- 0:00:17
714000 -- [-1162.236] (-1165.791) (-1161.719) (-1163.848) * (-1162.744) (-1163.475) [-1162.486] (-1162.190) -- 0:00:17
714500 -- (-1163.019) (-1166.586) (-1161.453) [-1162.791] * [-1163.267] (-1161.663) (-1162.526) (-1161.891) -- 0:00:17
715000 -- [-1161.816] (-1167.955) (-1165.956) (-1162.254) * [-1160.995] (-1161.744) (-1164.068) (-1162.643) -- 0:00:17
Average standard deviation of split frequencies: 0.009744
715500 -- (-1165.548) [-1163.234] (-1161.840) (-1165.439) * (-1164.355) (-1164.099) (-1163.267) [-1163.794] -- 0:00:17
716000 -- (-1162.839) (-1161.820) [-1165.511] (-1161.939) * (-1161.838) [-1163.326] (-1165.040) (-1161.473) -- 0:00:17
716500 -- (-1161.583) (-1162.129) (-1168.021) [-1164.428] * (-1161.968) (-1167.281) (-1163.019) [-1161.443] -- 0:00:17
717000 -- (-1162.373) [-1161.236] (-1163.644) (-1163.470) * (-1163.524) (-1164.941) (-1163.518) [-1164.626] -- 0:00:17
717500 -- (-1162.759) (-1164.605) (-1165.757) [-1163.144] * (-1165.033) (-1161.374) [-1164.761] (-1162.604) -- 0:00:17
718000 -- (-1165.018) (-1163.816) [-1161.937] (-1161.146) * [-1165.776] (-1165.703) (-1162.692) (-1163.184) -- 0:00:17
718500 -- (-1163.152) (-1170.760) (-1163.938) [-1163.594] * (-1163.652) (-1163.175) [-1165.215] (-1166.408) -- 0:00:17
719000 -- (-1163.527) (-1163.110) [-1163.642] (-1163.291) * (-1165.938) (-1161.685) (-1165.848) [-1163.585] -- 0:00:17
719500 -- [-1162.575] (-1162.175) (-1162.378) (-1161.426) * [-1162.156] (-1161.435) (-1165.462) (-1161.305) -- 0:00:17
720000 -- (-1161.761) (-1165.635) [-1162.967] (-1166.745) * (-1162.236) (-1162.379) (-1164.311) [-1162.320] -- 0:00:17
Average standard deviation of split frequencies: 0.009289
720500 -- (-1164.967) (-1163.923) [-1162.951] (-1161.693) * (-1163.266) (-1161.051) [-1163.567] (-1162.910) -- 0:00:17
721000 -- (-1164.713) (-1165.660) (-1164.232) [-1164.383] * (-1165.213) [-1162.324] (-1161.630) (-1163.404) -- 0:00:17
721500 -- (-1165.281) (-1167.481) (-1163.461) [-1162.827] * (-1161.769) (-1164.876) (-1161.557) [-1163.257] -- 0:00:16
722000 -- (-1162.026) (-1168.731) [-1161.529] (-1162.194) * (-1166.152) (-1162.354) [-1162.848] (-1163.437) -- 0:00:16
722500 -- (-1161.761) (-1166.264) [-1161.302] (-1166.827) * (-1161.709) [-1160.971] (-1162.200) (-1170.461) -- 0:00:16
723000 -- [-1162.104] (-1164.226) (-1161.581) (-1161.759) * (-1161.400) (-1166.234) (-1161.899) [-1164.946] -- 0:00:16
723500 -- (-1163.751) [-1162.534] (-1160.903) (-1164.577) * [-1167.806] (-1162.274) (-1161.625) (-1163.109) -- 0:00:16
724000 -- [-1162.657] (-1163.930) (-1163.237) (-1165.182) * (-1162.523) (-1161.876) (-1167.305) [-1162.115] -- 0:00:16
724500 -- (-1164.018) (-1164.085) (-1162.475) [-1164.316] * [-1161.172] (-1162.801) (-1163.133) (-1164.066) -- 0:00:16
725000 -- (-1167.595) (-1165.923) [-1165.266] (-1166.054) * (-1161.172) (-1164.479) (-1161.929) [-1162.013] -- 0:00:16
Average standard deviation of split frequencies: 0.008831
725500 -- (-1163.513) (-1164.880) (-1164.511) [-1162.138] * (-1162.301) (-1164.727) [-1161.977] (-1161.311) -- 0:00:16
726000 -- (-1162.379) [-1163.481] (-1163.296) (-1163.072) * [-1162.042] (-1163.673) (-1163.650) (-1161.642) -- 0:00:16
726500 -- (-1163.803) [-1164.477] (-1164.005) (-1163.196) * (-1161.754) (-1165.753) [-1161.345] (-1162.348) -- 0:00:16
727000 -- (-1161.252) [-1161.324] (-1164.005) (-1162.257) * (-1170.939) [-1163.255] (-1161.237) (-1162.545) -- 0:00:16
727500 -- (-1161.535) (-1161.871) (-1162.896) [-1165.902] * [-1164.626] (-1166.028) (-1163.253) (-1169.887) -- 0:00:16
728000 -- (-1166.212) (-1163.179) [-1162.515] (-1161.471) * (-1162.573) (-1163.156) (-1163.845) [-1163.467] -- 0:00:16
728500 -- (-1163.217) [-1164.962] (-1162.201) (-1163.291) * [-1162.447] (-1163.224) (-1166.015) (-1163.254) -- 0:00:16
729000 -- (-1163.339) (-1162.151) [-1165.575] (-1163.463) * (-1161.553) (-1164.523) (-1162.745) [-1165.477] -- 0:00:16
729500 -- [-1166.084] (-1161.551) (-1161.998) (-1164.316) * (-1161.968) [-1161.526] (-1163.586) (-1164.451) -- 0:00:16
730000 -- (-1163.013) (-1161.555) (-1170.022) [-1162.615] * (-1165.226) (-1163.521) (-1161.949) [-1162.030] -- 0:00:16
Average standard deviation of split frequencies: 0.009419
730500 -- (-1165.752) (-1161.818) (-1164.115) [-1161.183] * (-1162.906) [-1161.999] (-1164.565) (-1161.820) -- 0:00:16
731000 -- (-1165.757) (-1166.523) [-1164.319] (-1163.570) * (-1166.294) (-1164.385) [-1161.803] (-1161.834) -- 0:00:16
731500 -- (-1162.599) (-1163.893) [-1165.559] (-1162.986) * (-1164.576) [-1167.908] (-1163.211) (-1162.163) -- 0:00:16
732000 -- (-1163.045) (-1166.843) [-1164.603] (-1161.691) * (-1164.830) [-1162.524] (-1162.965) (-1161.326) -- 0:00:16
732500 -- [-1163.055] (-1161.727) (-1162.145) (-1162.152) * (-1161.916) (-1162.542) (-1163.242) [-1161.310] -- 0:00:16
733000 -- (-1163.233) (-1162.184) (-1162.481) [-1163.848] * (-1166.240) [-1161.971] (-1164.312) (-1163.345) -- 0:00:16
733500 -- (-1164.713) (-1161.286) [-1165.184] (-1165.675) * [-1161.407] (-1165.285) (-1167.581) (-1167.193) -- 0:00:16
734000 -- (-1166.798) [-1162.170] (-1163.305) (-1167.321) * [-1161.182] (-1163.890) (-1165.073) (-1164.262) -- 0:00:16
734500 -- (-1161.914) (-1165.765) [-1162.194] (-1167.749) * (-1165.356) (-1164.032) (-1164.788) [-1163.533] -- 0:00:16
735000 -- (-1167.285) (-1163.413) [-1161.897] (-1167.493) * (-1165.581) (-1164.849) (-1164.831) [-1164.094] -- 0:00:16
Average standard deviation of split frequencies: 0.008839
735500 -- (-1164.820) (-1164.906) [-1161.748] (-1163.403) * (-1165.289) [-1161.255] (-1166.357) (-1164.208) -- 0:00:16
736000 -- (-1163.473) (-1164.277) [-1160.731] (-1166.641) * (-1165.123) (-1162.059) (-1165.662) [-1166.946] -- 0:00:16
736500 -- [-1165.659] (-1161.940) (-1161.942) (-1164.980) * (-1161.936) [-1161.713] (-1163.817) (-1168.968) -- 0:00:16
737000 -- [-1163.201] (-1164.500) (-1162.721) (-1161.623) * (-1166.680) (-1162.834) (-1163.265) [-1162.513] -- 0:00:16
737500 -- (-1165.707) (-1164.736) (-1162.192) [-1164.217] * (-1163.119) (-1162.398) [-1160.922] (-1161.079) -- 0:00:16
738000 -- (-1165.431) (-1163.127) (-1164.510) [-1161.963] * (-1162.922) (-1163.155) [-1161.841] (-1162.147) -- 0:00:15
738500 -- (-1165.543) [-1164.431] (-1163.923) (-1161.817) * (-1161.965) [-1163.118] (-1166.244) (-1162.393) -- 0:00:15
739000 -- [-1163.527] (-1162.597) (-1160.937) (-1163.717) * (-1164.313) (-1164.355) [-1165.346] (-1165.360) -- 0:00:15
739500 -- (-1164.691) (-1169.406) (-1165.438) [-1161.808] * (-1167.294) (-1163.286) [-1163.407] (-1162.463) -- 0:00:15
740000 -- [-1163.730] (-1166.237) (-1162.483) (-1161.822) * (-1169.083) [-1165.539] (-1164.029) (-1163.092) -- 0:00:15
Average standard deviation of split frequencies: 0.008019
740500 -- [-1162.191] (-1161.262) (-1163.995) (-1162.570) * (-1161.562) (-1162.896) (-1164.049) [-1162.511] -- 0:00:15
741000 -- (-1162.482) [-1160.908] (-1164.806) (-1160.952) * (-1167.368) (-1161.723) (-1163.076) [-1161.810] -- 0:00:15
741500 -- (-1161.706) [-1161.978] (-1163.223) (-1162.739) * [-1166.618] (-1165.234) (-1163.150) (-1162.350) -- 0:00:15
742000 -- (-1161.421) (-1161.919) [-1162.970] (-1162.548) * (-1164.633) (-1163.176) (-1164.113) [-1163.817] -- 0:00:15
742500 -- (-1163.292) [-1163.269] (-1164.181) (-1162.724) * [-1163.154] (-1163.153) (-1163.933) (-1162.146) -- 0:00:15
743000 -- (-1162.514) [-1161.466] (-1169.078) (-1162.321) * (-1162.733) [-1162.428] (-1165.762) (-1161.939) -- 0:00:15
743500 -- (-1165.493) [-1162.034] (-1165.179) (-1160.951) * (-1163.686) (-1163.598) [-1165.490] (-1163.817) -- 0:00:15
744000 -- (-1162.572) [-1161.051] (-1161.684) (-1161.024) * [-1164.836] (-1161.553) (-1163.985) (-1163.434) -- 0:00:15
744500 -- (-1163.038) [-1160.806] (-1167.425) (-1162.564) * (-1164.806) (-1161.153) (-1162.971) [-1161.708] -- 0:00:15
745000 -- (-1163.897) (-1161.493) [-1164.935] (-1164.901) * (-1163.258) (-1161.830) [-1162.637] (-1161.551) -- 0:00:15
Average standard deviation of split frequencies: 0.007836
745500 -- (-1168.463) (-1163.399) (-1161.343) [-1163.438] * [-1165.466] (-1164.204) (-1163.161) (-1162.336) -- 0:00:15
746000 -- (-1166.215) (-1161.827) [-1162.230] (-1163.654) * (-1161.362) [-1162.624] (-1163.125) (-1161.240) -- 0:00:15
746500 -- (-1163.502) [-1163.067] (-1166.120) (-1161.782) * (-1161.128) (-1163.667) (-1164.294) [-1162.851] -- 0:00:15
747000 -- (-1162.288) [-1163.323] (-1164.079) (-1162.340) * (-1161.095) (-1161.870) [-1167.247] (-1161.209) -- 0:00:15
747500 -- [-1161.601] (-1162.256) (-1168.146) (-1162.276) * [-1163.616] (-1163.973) (-1163.395) (-1165.151) -- 0:00:15
748000 -- [-1163.003] (-1161.488) (-1166.303) (-1162.669) * [-1164.775] (-1165.590) (-1161.737) (-1164.547) -- 0:00:15
748500 -- (-1162.181) [-1161.540] (-1164.610) (-1162.587) * [-1161.245] (-1168.075) (-1164.992) (-1164.547) -- 0:00:15
749000 -- (-1163.520) (-1162.447) (-1163.839) [-1161.777] * [-1166.808] (-1165.556) (-1164.274) (-1164.784) -- 0:00:15
749500 -- (-1173.911) (-1161.187) (-1166.121) [-1161.347] * (-1165.697) (-1164.759) (-1162.109) [-1163.881] -- 0:00:15
750000 -- (-1165.324) [-1163.137] (-1162.499) (-1163.821) * (-1161.855) [-1163.659] (-1164.105) (-1162.489) -- 0:00:15
Average standard deviation of split frequencies: 0.008038
750500 -- [-1166.150] (-1163.294) (-1162.429) (-1163.875) * (-1162.389) (-1162.307) (-1172.031) [-1166.555] -- 0:00:15
751000 -- [-1166.923] (-1161.000) (-1166.314) (-1161.867) * (-1161.778) (-1165.634) [-1164.289] (-1162.198) -- 0:00:15
751500 -- (-1166.447) [-1162.103] (-1162.334) (-1162.079) * (-1161.065) [-1162.033] (-1162.818) (-1162.578) -- 0:00:15
752000 -- (-1164.159) [-1162.474] (-1161.936) (-1163.607) * [-1160.885] (-1162.024) (-1162.224) (-1162.491) -- 0:00:15
752500 -- (-1163.996) (-1162.422) (-1161.572) [-1164.451] * (-1161.945) (-1163.485) (-1163.102) [-1161.954] -- 0:00:15
753000 -- (-1162.907) (-1160.788) (-1165.586) [-1162.364] * (-1161.929) [-1163.821] (-1162.903) (-1161.954) -- 0:00:15
753500 -- (-1161.885) (-1160.802) (-1162.198) [-1163.141] * [-1164.812] (-1162.218) (-1168.693) (-1162.729) -- 0:00:15
754000 -- (-1162.096) (-1160.775) [-1161.625] (-1163.961) * (-1162.856) (-1163.229) (-1170.219) [-1163.630] -- 0:00:15
754500 -- (-1161.471) (-1162.507) [-1161.719] (-1162.333) * (-1162.146) (-1162.176) (-1162.515) [-1162.177] -- 0:00:14
755000 -- (-1165.190) (-1162.716) [-1163.362] (-1163.466) * (-1165.965) (-1161.496) (-1162.391) [-1161.646] -- 0:00:14
Average standard deviation of split frequencies: 0.008730
755500 -- (-1164.869) [-1162.844] (-1162.481) (-1163.158) * (-1162.470) (-1163.630) (-1162.983) [-1163.358] -- 0:00:14
756000 -- (-1163.569) (-1167.753) (-1162.434) [-1165.654] * (-1161.335) (-1165.941) (-1161.710) [-1163.132] -- 0:00:14
756500 -- (-1164.255) (-1163.234) (-1166.534) [-1161.599] * (-1161.667) [-1165.345] (-1165.652) (-1163.002) -- 0:00:14
757000 -- (-1164.493) (-1163.528) [-1162.656] (-1164.648) * (-1164.078) (-1167.768) [-1162.883] (-1162.649) -- 0:00:14
757500 -- (-1163.464) (-1161.525) [-1162.728] (-1163.941) * (-1163.351) (-1163.110) (-1164.878) [-1162.459] -- 0:00:14
758000 -- (-1164.748) (-1162.626) [-1164.254] (-1161.888) * (-1163.252) (-1165.712) [-1161.731] (-1163.243) -- 0:00:14
758500 -- (-1163.319) (-1162.731) [-1162.814] (-1161.618) * [-1162.208] (-1163.437) (-1168.911) (-1164.197) -- 0:00:14
759000 -- (-1166.395) [-1162.064] (-1164.047) (-1162.774) * [-1163.467] (-1165.269) (-1169.279) (-1162.634) -- 0:00:14
759500 -- (-1163.594) (-1166.783) (-1162.632) [-1162.935] * (-1165.143) [-1161.406] (-1166.247) (-1165.091) -- 0:00:14
760000 -- [-1162.924] (-1163.003) (-1167.708) (-1162.828) * (-1167.111) (-1162.501) (-1168.611) [-1164.894] -- 0:00:14
Average standard deviation of split frequencies: 0.008056
760500 -- (-1164.039) (-1162.820) [-1166.446] (-1165.326) * [-1163.417] (-1162.058) (-1161.763) (-1169.811) -- 0:00:14
761000 -- (-1163.603) [-1162.923] (-1165.042) (-1163.662) * (-1164.594) (-1164.895) (-1164.242) [-1162.935] -- 0:00:14
761500 -- [-1165.957] (-1166.899) (-1164.887) (-1163.313) * (-1164.514) [-1161.814] (-1164.244) (-1168.359) -- 0:00:14
762000 -- (-1163.357) [-1162.565] (-1164.473) (-1162.349) * [-1161.682] (-1162.397) (-1163.732) (-1161.854) -- 0:00:14
762500 -- (-1168.751) [-1163.012] (-1164.558) (-1162.067) * (-1161.787) (-1162.322) (-1163.312) [-1165.579] -- 0:00:14
763000 -- (-1166.536) [-1161.460] (-1163.488) (-1163.824) * (-1167.730) (-1163.129) [-1161.495] (-1168.301) -- 0:00:14
763500 -- (-1162.278) (-1163.275) [-1163.523] (-1164.214) * [-1161.955] (-1164.301) (-1161.347) (-1163.209) -- 0:00:14
764000 -- (-1165.531) (-1167.198) (-1162.461) [-1163.355] * [-1161.848] (-1163.219) (-1161.580) (-1162.815) -- 0:00:14
764500 -- [-1165.096] (-1163.743) (-1161.524) (-1163.192) * [-1162.597] (-1169.316) (-1161.727) (-1161.451) -- 0:00:14
765000 -- [-1160.977] (-1163.779) (-1162.594) (-1162.321) * (-1163.644) (-1163.027) (-1163.742) [-1163.923] -- 0:00:14
Average standard deviation of split frequencies: 0.008123
765500 -- (-1165.048) (-1162.041) [-1161.511] (-1163.185) * (-1163.040) (-1164.579) (-1164.655) [-1167.683] -- 0:00:14
766000 -- (-1169.555) (-1162.927) (-1162.965) [-1163.124] * (-1163.537) (-1163.483) (-1162.428) [-1163.261] -- 0:00:14
766500 -- (-1165.280) (-1162.262) (-1165.578) [-1162.467] * (-1164.960) (-1165.275) (-1161.575) [-1164.306] -- 0:00:14
767000 -- [-1164.408] (-1164.491) (-1162.657) (-1164.188) * (-1164.294) (-1166.024) (-1164.014) [-1164.213] -- 0:00:14
767500 -- [-1165.201] (-1163.754) (-1162.337) (-1163.984) * (-1164.233) (-1165.849) (-1170.455) [-1163.318] -- 0:00:14
768000 -- [-1167.362] (-1162.457) (-1163.553) (-1165.046) * (-1162.839) (-1164.504) (-1162.584) [-1163.603] -- 0:00:14
768500 -- (-1164.221) (-1166.423) (-1162.476) [-1162.873] * [-1162.215] (-1161.196) (-1163.655) (-1162.330) -- 0:00:14
769000 -- (-1165.537) (-1166.148) (-1162.340) [-1161.647] * (-1161.207) (-1161.838) [-1164.510] (-1162.676) -- 0:00:14
769500 -- (-1164.612) (-1161.980) [-1165.613] (-1164.962) * (-1161.455) (-1163.063) [-1166.030] (-1164.142) -- 0:00:14
770000 -- (-1166.043) (-1161.806) (-1163.447) [-1164.944] * [-1165.130] (-1161.340) (-1165.634) (-1168.862) -- 0:00:14
Average standard deviation of split frequencies: 0.008319
770500 -- (-1165.587) (-1162.430) [-1164.585] (-1164.342) * (-1163.526) [-1161.300] (-1163.772) (-1165.019) -- 0:00:13
771000 -- (-1162.320) (-1164.164) (-1168.985) [-1163.735] * [-1164.196] (-1161.498) (-1164.787) (-1163.097) -- 0:00:13
771500 -- (-1168.405) (-1162.129) [-1164.336] (-1162.825) * (-1163.273) (-1163.808) [-1163.346] (-1163.642) -- 0:00:13
772000 -- [-1162.498] (-1162.289) (-1163.610) (-1163.092) * (-1165.814) (-1163.211) [-1162.869] (-1163.539) -- 0:00:13
772500 -- (-1161.673) [-1168.180] (-1161.661) (-1164.496) * [-1163.481] (-1164.249) (-1162.319) (-1163.243) -- 0:00:13
773000 -- (-1163.662) [-1162.737] (-1161.810) (-1162.678) * [-1161.581] (-1163.863) (-1162.030) (-1162.165) -- 0:00:13
773500 -- (-1162.194) (-1161.422) [-1164.375] (-1161.255) * [-1161.365] (-1164.314) (-1161.964) (-1163.634) -- 0:00:13
774000 -- (-1165.316) (-1161.215) [-1166.888] (-1165.903) * (-1164.588) (-1162.578) (-1164.755) [-1161.155] -- 0:00:13
774500 -- (-1162.003) (-1161.661) (-1164.087) [-1161.705] * (-1164.418) [-1161.256] (-1164.305) (-1161.910) -- 0:00:13
775000 -- (-1163.485) (-1163.615) (-1164.331) [-1161.290] * (-1161.548) (-1163.955) [-1162.627] (-1163.077) -- 0:00:13
Average standard deviation of split frequencies: 0.008262
775500 -- (-1165.878) [-1162.404] (-1161.463) (-1164.982) * [-1162.479] (-1164.496) (-1162.197) (-1163.959) -- 0:00:13
776000 -- (-1163.926) (-1163.506) (-1161.449) [-1164.162] * (-1162.936) (-1166.039) [-1162.766] (-1165.786) -- 0:00:13
776500 -- (-1163.284) (-1161.159) (-1163.739) [-1163.576] * [-1162.698] (-1162.489) (-1163.190) (-1165.582) -- 0:00:13
777000 -- [-1165.864] (-1161.219) (-1162.048) (-1162.021) * [-1164.435] (-1162.280) (-1162.658) (-1166.622) -- 0:00:13
777500 -- [-1162.119] (-1162.077) (-1162.043) (-1165.394) * (-1164.718) (-1162.311) (-1171.457) [-1162.062] -- 0:00:13
778000 -- (-1167.472) (-1162.703) [-1161.421] (-1164.092) * [-1165.450] (-1163.372) (-1163.651) (-1164.703) -- 0:00:13
778500 -- (-1170.108) (-1164.355) [-1162.356] (-1163.380) * (-1162.235) (-1163.409) (-1165.998) [-1162.087] -- 0:00:13
779000 -- (-1164.042) [-1161.881] (-1161.971) (-1161.817) * (-1167.891) (-1162.991) [-1163.880] (-1172.732) -- 0:00:13
779500 -- (-1163.199) (-1162.376) [-1161.213] (-1163.208) * (-1169.577) (-1162.658) [-1165.453] (-1163.699) -- 0:00:13
780000 -- (-1164.283) (-1161.962) [-1161.213] (-1164.636) * [-1163.884] (-1165.300) (-1162.638) (-1164.301) -- 0:00:13
Average standard deviation of split frequencies: 0.008695
780500 -- (-1164.726) (-1165.027) (-1161.684) [-1164.166] * (-1164.323) (-1163.665) [-1161.535] (-1161.310) -- 0:00:13
781000 -- (-1167.059) [-1164.494] (-1161.896) (-1166.603) * (-1166.345) (-1169.534) [-1162.605] (-1162.547) -- 0:00:13
781500 -- (-1162.615) (-1165.865) (-1164.802) [-1163.546] * (-1164.950) (-1161.396) (-1161.403) [-1162.086] -- 0:00:13
782000 -- (-1164.156) (-1162.980) [-1160.772] (-1164.244) * (-1164.508) [-1163.080] (-1163.261) (-1164.212) -- 0:00:13
782500 -- [-1166.483] (-1163.996) (-1164.430) (-1163.881) * (-1161.645) [-1164.992] (-1162.605) (-1161.917) -- 0:00:13
783000 -- (-1163.486) [-1168.528] (-1163.425) (-1166.501) * (-1162.862) (-1164.123) [-1160.841] (-1162.553) -- 0:00:13
783500 -- (-1162.447) [-1163.352] (-1165.132) (-1162.090) * (-1162.208) (-1164.149) [-1161.782] (-1163.052) -- 0:00:13
784000 -- [-1162.441] (-1162.811) (-1163.175) (-1163.677) * (-1163.861) [-1167.260] (-1163.684) (-1168.841) -- 0:00:13
784500 -- (-1164.035) [-1163.849] (-1164.762) (-1162.385) * [-1163.122] (-1164.654) (-1165.471) (-1164.250) -- 0:00:13
785000 -- (-1164.168) [-1162.523] (-1162.858) (-1162.567) * [-1161.841] (-1164.312) (-1164.051) (-1162.576) -- 0:00:13
Average standard deviation of split frequencies: 0.008996
785500 -- (-1161.980) (-1164.519) [-1163.207] (-1163.449) * [-1161.541] (-1164.040) (-1162.736) (-1168.481) -- 0:00:13
786000 -- (-1162.333) (-1162.805) [-1163.183] (-1162.767) * (-1164.565) (-1163.032) (-1161.754) [-1163.907] -- 0:00:13
786500 -- (-1163.076) (-1163.589) [-1164.606] (-1161.679) * (-1165.563) (-1162.573) [-1161.989] (-1167.278) -- 0:00:13
787000 -- (-1162.606) (-1162.130) (-1161.325) [-1168.179] * (-1164.758) (-1166.241) [-1161.689] (-1165.312) -- 0:00:12
787500 -- (-1162.491) (-1163.864) [-1162.017] (-1162.707) * (-1166.943) (-1163.138) (-1163.053) [-1164.183] -- 0:00:12
788000 -- (-1164.808) [-1163.163] (-1161.803) (-1162.980) * (-1163.226) (-1162.798) (-1163.876) [-1165.029] -- 0:00:12
788500 -- (-1163.150) (-1166.638) [-1162.260] (-1161.282) * (-1163.363) [-1165.090] (-1169.968) (-1165.603) -- 0:00:12
789000 -- (-1164.681) (-1166.635) (-1161.723) [-1162.901] * (-1163.336) [-1163.280] (-1169.068) (-1162.175) -- 0:00:12
789500 -- (-1163.570) (-1166.509) [-1168.986] (-1162.485) * (-1161.448) (-1162.885) (-1166.094) [-1162.057] -- 0:00:12
790000 -- (-1162.300) (-1163.118) [-1168.780] (-1162.808) * (-1162.850) (-1164.016) (-1165.942) [-1164.258] -- 0:00:12
Average standard deviation of split frequencies: 0.008347
790500 -- (-1164.918) (-1163.258) [-1163.806] (-1165.493) * (-1161.968) (-1163.282) (-1163.786) [-1163.134] -- 0:00:12
791000 -- (-1165.816) [-1162.501] (-1163.746) (-1163.618) * (-1166.513) [-1161.782] (-1162.844) (-1161.573) -- 0:00:12
791500 -- [-1163.886] (-1161.917) (-1162.144) (-1165.655) * (-1162.675) (-1164.689) (-1164.951) [-1165.925] -- 0:00:12
792000 -- (-1164.148) (-1164.459) (-1162.345) [-1164.749] * (-1164.325) (-1162.391) (-1163.237) [-1163.518] -- 0:00:12
792500 -- [-1161.613] (-1162.245) (-1160.971) (-1161.553) * [-1163.111] (-1163.928) (-1163.754) (-1163.321) -- 0:00:12
793000 -- (-1169.816) (-1161.463) (-1161.216) [-1160.892] * [-1165.308] (-1163.915) (-1163.806) (-1164.762) -- 0:00:12
793500 -- (-1169.997) [-1163.091] (-1161.258) (-1161.710) * (-1161.638) (-1161.581) [-1161.106] (-1164.271) -- 0:00:12
794000 -- (-1162.960) (-1163.799) (-1163.222) [-1161.338] * (-1161.402) (-1165.716) (-1163.636) [-1165.059] -- 0:00:12
794500 -- [-1162.656] (-1166.367) (-1167.866) (-1161.398) * [-1161.002] (-1162.769) (-1164.863) (-1161.750) -- 0:00:12
795000 -- (-1162.568) (-1165.820) [-1161.898] (-1161.168) * (-1163.179) (-1161.592) (-1161.353) [-1167.674] -- 0:00:12
Average standard deviation of split frequencies: 0.008173
795500 -- [-1163.331] (-1163.649) (-1164.538) (-1163.157) * [-1162.596] (-1163.253) (-1162.469) (-1172.240) -- 0:00:12
796000 -- (-1162.383) (-1162.099) (-1163.173) [-1164.260] * (-1162.703) [-1161.320] (-1161.458) (-1164.694) -- 0:00:12
796500 -- (-1162.767) [-1162.186] (-1161.613) (-1162.522) * (-1161.674) (-1162.400) (-1163.087) [-1164.535] -- 0:00:12
797000 -- (-1163.191) [-1162.457] (-1171.553) (-1162.649) * (-1162.025) [-1166.012] (-1162.264) (-1163.258) -- 0:00:12
797500 -- [-1163.418] (-1162.678) (-1165.967) (-1163.925) * (-1165.400) (-1163.905) (-1167.556) [-1162.673] -- 0:00:12
798000 -- (-1162.983) [-1161.782] (-1164.417) (-1161.914) * (-1162.585) [-1165.269] (-1166.675) (-1164.056) -- 0:00:12
798500 -- [-1164.159] (-1162.194) (-1169.171) (-1166.635) * (-1164.307) (-1163.634) [-1167.605] (-1165.186) -- 0:00:12
799000 -- (-1166.208) [-1161.689] (-1165.754) (-1164.093) * (-1162.524) (-1165.723) (-1165.391) [-1161.993] -- 0:00:12
799500 -- (-1161.572) [-1162.242] (-1165.234) (-1162.680) * (-1165.401) [-1162.134] (-1161.762) (-1161.777) -- 0:00:12
800000 -- (-1161.442) [-1161.839] (-1164.076) (-1162.935) * (-1168.778) (-1165.464) [-1161.895] (-1164.274) -- 0:00:12
Average standard deviation of split frequencies: 0.008360
800500 -- (-1162.586) (-1166.055) [-1164.040] (-1161.485) * (-1163.101) (-1165.363) [-1165.857] (-1163.048) -- 0:00:12
801000 -- [-1164.416] (-1167.031) (-1163.942) (-1161.485) * [-1164.210] (-1164.523) (-1167.117) (-1161.917) -- 0:00:12
801500 -- (-1170.550) (-1165.872) [-1166.595] (-1161.924) * (-1165.160) (-1167.486) (-1162.593) [-1163.548] -- 0:00:12
802000 -- (-1163.066) (-1161.061) [-1163.249] (-1163.782) * (-1161.681) (-1168.674) (-1164.709) [-1161.872] -- 0:00:12
802500 -- (-1162.227) (-1163.447) [-1163.552] (-1162.274) * (-1161.437) (-1166.002) (-1164.308) [-1161.498] -- 0:00:12
803000 -- (-1163.009) (-1162.905) (-1164.792) [-1162.876] * [-1163.089] (-1168.510) (-1163.817) (-1163.777) -- 0:00:12
803500 -- (-1162.369) (-1166.733) (-1165.142) [-1162.638] * [-1161.889] (-1162.221) (-1166.469) (-1168.405) -- 0:00:11
804000 -- (-1164.035) (-1161.941) [-1162.891] (-1162.942) * [-1161.710] (-1163.399) (-1168.201) (-1164.288) -- 0:00:11
804500 -- (-1162.931) [-1161.139] (-1164.081) (-1163.953) * (-1162.346) [-1162.183] (-1161.935) (-1164.477) -- 0:00:11
805000 -- [-1161.982] (-1163.539) (-1163.015) (-1164.910) * [-1162.037] (-1162.771) (-1162.192) (-1163.449) -- 0:00:11
Average standard deviation of split frequencies: 0.008656
805500 -- (-1165.215) [-1163.682] (-1161.798) (-1163.574) * (-1162.568) [-1164.633] (-1163.529) (-1163.119) -- 0:00:11
806000 -- (-1162.204) (-1164.505) (-1161.466) [-1163.980] * [-1161.993] (-1163.985) (-1162.771) (-1169.881) -- 0:00:11
806500 -- (-1162.095) (-1163.020) (-1166.678) [-1162.141] * (-1162.840) [-1165.398] (-1164.721) (-1163.305) -- 0:00:11
807000 -- (-1163.100) (-1161.909) (-1162.369) [-1162.291] * (-1163.151) [-1165.326] (-1165.437) (-1162.370) -- 0:00:11
807500 -- (-1162.743) (-1161.829) (-1163.494) [-1162.783] * (-1163.538) [-1161.712] (-1166.609) (-1163.206) -- 0:00:11
808000 -- (-1162.789) [-1161.491] (-1163.114) (-1163.317) * (-1162.934) [-1161.842] (-1161.751) (-1164.101) -- 0:00:11
808500 -- [-1164.651] (-1163.495) (-1167.375) (-1164.503) * [-1163.308] (-1161.313) (-1161.481) (-1162.418) -- 0:00:11
809000 -- (-1164.748) [-1162.103] (-1166.119) (-1169.473) * (-1163.406) (-1161.352) [-1170.504] (-1162.814) -- 0:00:11
809500 -- (-1161.197) [-1161.998] (-1162.776) (-1162.139) * [-1161.767] (-1161.689) (-1164.329) (-1162.892) -- 0:00:11
810000 -- (-1162.129) (-1166.162) (-1164.962) [-1162.389] * (-1165.539) [-1162.166] (-1163.458) (-1163.968) -- 0:00:11
Average standard deviation of split frequencies: 0.008490
810500 -- [-1163.056] (-1164.818) (-1161.669) (-1164.150) * [-1163.014] (-1162.409) (-1161.329) (-1164.608) -- 0:00:11
811000 -- [-1162.298] (-1162.282) (-1163.322) (-1163.002) * (-1165.959) (-1162.737) (-1165.292) [-1163.674] -- 0:00:11
811500 -- (-1164.206) [-1166.154] (-1166.629) (-1162.215) * (-1168.780) (-1165.708) (-1162.611) [-1162.992] -- 0:00:11
812000 -- [-1163.989] (-1163.121) (-1162.558) (-1162.494) * (-1168.864) (-1163.053) [-1163.867] (-1163.231) -- 0:00:11
812500 -- (-1161.740) [-1163.061] (-1161.861) (-1163.547) * (-1162.582) [-1170.695] (-1162.621) (-1164.812) -- 0:00:11
813000 -- (-1162.763) [-1162.139] (-1161.568) (-1162.707) * (-1162.747) (-1163.874) [-1161.746] (-1162.433) -- 0:00:11
813500 -- (-1161.394) (-1162.077) [-1162.453] (-1163.987) * (-1162.867) (-1163.176) [-1161.798] (-1163.479) -- 0:00:11
814000 -- (-1162.000) (-1161.916) (-1163.048) [-1164.860] * [-1163.115] (-1166.072) (-1162.098) (-1163.095) -- 0:00:11
814500 -- (-1164.184) (-1162.212) [-1162.212] (-1167.807) * (-1165.756) (-1162.374) [-1161.975] (-1161.856) -- 0:00:11
815000 -- (-1163.499) (-1162.427) [-1161.694] (-1161.566) * (-1164.214) (-1161.450) [-1162.943] (-1161.435) -- 0:00:11
Average standard deviation of split frequencies: 0.008897
815500 -- (-1165.112) (-1162.847) [-1161.757] (-1164.267) * (-1163.791) (-1164.569) [-1163.368] (-1161.367) -- 0:00:11
816000 -- [-1163.130] (-1162.337) (-1162.018) (-1163.559) * [-1163.775] (-1161.981) (-1166.636) (-1165.855) -- 0:00:11
816500 -- (-1163.535) (-1164.375) [-1160.898] (-1162.382) * (-1161.776) (-1163.002) (-1162.850) [-1162.654] -- 0:00:11
817000 -- [-1161.340] (-1165.879) (-1162.435) (-1162.801) * (-1162.648) (-1163.501) (-1161.842) [-1162.690] -- 0:00:11
817500 -- (-1166.145) (-1163.883) [-1161.381] (-1162.757) * (-1165.010) (-1165.353) [-1162.201] (-1163.568) -- 0:00:11
818000 -- (-1165.873) (-1163.020) (-1161.902) [-1162.089] * (-1162.376) [-1162.675] (-1162.299) (-1161.283) -- 0:00:11
818500 -- (-1162.095) (-1164.322) [-1161.792] (-1164.516) * (-1162.768) (-1162.954) (-1161.336) [-1161.652] -- 0:00:11
819000 -- (-1163.560) [-1164.673] (-1161.315) (-1161.361) * (-1165.101) (-1162.465) [-1162.669] (-1161.614) -- 0:00:11
819500 -- [-1165.089] (-1166.826) (-1161.667) (-1165.027) * (-1166.313) (-1165.806) [-1163.414] (-1161.946) -- 0:00:11
820000 -- (-1164.229) [-1162.489] (-1162.403) (-1166.030) * (-1163.782) (-1167.992) [-1164.042] (-1164.104) -- 0:00:10
Average standard deviation of split frequencies: 0.008616
820500 -- [-1160.856] (-1162.489) (-1166.348) (-1163.907) * (-1162.427) [-1166.566] (-1162.704) (-1163.350) -- 0:00:10
821000 -- (-1163.694) (-1160.921) [-1165.495] (-1163.851) * (-1162.409) (-1167.600) (-1163.468) [-1164.044] -- 0:00:10
821500 -- (-1165.177) (-1161.547) [-1166.253] (-1164.345) * (-1166.933) (-1164.212) [-1161.981] (-1164.792) -- 0:00:10
822000 -- (-1163.445) (-1161.213) (-1165.579) [-1161.903] * (-1163.421) (-1163.070) [-1163.740] (-1162.259) -- 0:00:10
822500 -- (-1164.251) [-1161.285] (-1163.614) (-1166.741) * (-1163.047) (-1163.973) (-1165.279) [-1163.359] -- 0:00:10
823000 -- (-1162.853) [-1163.256] (-1163.346) (-1162.179) * (-1161.992) [-1165.459] (-1162.694) (-1162.713) -- 0:00:10
823500 -- [-1161.838] (-1161.942) (-1163.773) (-1163.392) * [-1162.188] (-1163.877) (-1165.863) (-1161.766) -- 0:00:10
824000 -- (-1163.648) [-1161.160] (-1163.937) (-1164.155) * (-1162.983) (-1162.992) [-1161.467] (-1162.904) -- 0:00:10
824500 -- (-1165.475) (-1161.740) [-1164.370] (-1162.209) * (-1165.088) [-1160.969] (-1162.976) (-1164.664) -- 0:00:10
825000 -- [-1166.595] (-1164.935) (-1165.707) (-1167.219) * [-1161.063] (-1162.312) (-1163.516) (-1162.638) -- 0:00:10
Average standard deviation of split frequencies: 0.009474
825500 -- (-1170.946) [-1161.738] (-1163.199) (-1166.669) * (-1160.916) (-1163.084) [-1161.501] (-1164.840) -- 0:00:10
826000 -- (-1169.646) (-1161.652) (-1166.574) [-1162.302] * (-1164.243) (-1164.635) (-1162.626) [-1162.696] -- 0:00:10
826500 -- (-1167.621) (-1163.537) [-1165.373] (-1164.852) * [-1162.074] (-1166.810) (-1163.489) (-1162.854) -- 0:00:10
827000 -- (-1167.588) (-1161.223) (-1166.434) [-1161.346] * (-1164.819) (-1164.148) (-1162.683) [-1163.305] -- 0:00:10
827500 -- (-1164.666) (-1163.289) [-1164.883] (-1170.344) * (-1163.967) (-1165.395) [-1163.055] (-1162.545) -- 0:00:10
828000 -- [-1161.969] (-1165.782) (-1162.311) (-1161.580) * (-1162.902) [-1169.964] (-1162.536) (-1165.374) -- 0:00:10
828500 -- (-1163.338) (-1163.326) [-1161.591] (-1162.448) * (-1162.942) (-1164.290) [-1162.859] (-1165.401) -- 0:00:10
829000 -- (-1162.820) [-1162.574] (-1162.018) (-1163.109) * [-1162.801] (-1162.768) (-1164.887) (-1161.082) -- 0:00:10
829500 -- (-1162.237) (-1162.357) (-1164.024) [-1166.993] * [-1161.924] (-1163.687) (-1165.981) (-1163.588) -- 0:00:10
830000 -- (-1161.502) (-1162.823) (-1162.721) [-1161.798] * (-1162.387) [-1161.560] (-1164.218) (-1161.287) -- 0:00:10
Average standard deviation of split frequencies: 0.009421
830500 -- (-1163.166) (-1163.930) (-1166.692) [-1162.352] * (-1162.734) (-1163.694) (-1164.037) [-1163.536] -- 0:00:10
831000 -- (-1163.822) (-1162.655) [-1161.941] (-1163.745) * (-1163.368) [-1162.295] (-1163.180) (-1163.246) -- 0:00:10
831500 -- (-1163.658) (-1163.469) [-1162.518] (-1161.590) * (-1163.766) (-1164.835) (-1161.894) [-1163.955] -- 0:00:10
832000 -- (-1163.955) (-1162.278) (-1161.323) [-1162.151] * (-1164.108) [-1163.721] (-1162.022) (-1162.452) -- 0:00:10
832500 -- (-1164.128) (-1165.608) [-1161.662] (-1163.611) * (-1164.425) (-1161.796) (-1166.578) [-1165.169] -- 0:00:10
833000 -- (-1168.171) [-1163.712] (-1162.887) (-1166.842) * (-1162.928) (-1167.763) [-1166.536] (-1164.437) -- 0:00:10
833500 -- (-1165.368) (-1162.580) [-1160.822] (-1164.705) * (-1163.414) (-1161.909) [-1161.043] (-1163.786) -- 0:00:10
834000 -- (-1161.937) (-1164.747) [-1162.896] (-1163.778) * (-1163.904) (-1162.823) [-1161.501] (-1166.943) -- 0:00:10
834500 -- (-1162.698) (-1163.415) [-1163.846] (-1161.823) * [-1164.136] (-1162.087) (-1162.802) (-1163.283) -- 0:00:10
835000 -- (-1162.179) [-1163.447] (-1168.730) (-1161.959) * [-1164.377] (-1164.328) (-1163.765) (-1164.336) -- 0:00:10
Average standard deviation of split frequencies: 0.009699
835500 -- (-1164.263) (-1162.018) (-1162.429) [-1164.612] * (-1162.008) [-1161.138] (-1168.355) (-1162.711) -- 0:00:10
836000 -- (-1163.504) [-1162.377] (-1163.892) (-1163.544) * (-1163.232) [-1165.031] (-1164.579) (-1163.156) -- 0:00:10
836500 -- (-1162.485) (-1162.406) [-1165.386] (-1168.340) * (-1164.176) (-1162.294) [-1163.757] (-1163.759) -- 0:00:09
837000 -- [-1162.476] (-1164.733) (-1167.185) (-1170.372) * (-1162.276) (-1163.318) [-1161.434] (-1163.444) -- 0:00:09
837500 -- [-1162.825] (-1164.124) (-1162.625) (-1162.089) * (-1163.587) [-1161.002] (-1163.015) (-1164.065) -- 0:00:09
838000 -- (-1163.375) (-1164.070) [-1162.078] (-1165.048) * (-1163.902) (-1162.115) [-1165.278] (-1161.742) -- 0:00:09
838500 -- (-1161.815) (-1164.407) [-1163.069] (-1164.289) * (-1167.387) (-1164.951) [-1163.600] (-1161.655) -- 0:00:09
839000 -- (-1163.122) (-1166.104) (-1163.276) [-1164.901] * (-1163.484) (-1163.107) [-1161.076] (-1169.747) -- 0:00:09
839500 -- [-1162.050] (-1162.700) (-1168.333) (-1163.888) * [-1162.592] (-1160.887) (-1161.091) (-1166.270) -- 0:00:09
840000 -- (-1164.801) (-1162.125) [-1162.922] (-1162.714) * (-1165.931) (-1162.606) [-1161.796] (-1164.819) -- 0:00:09
Average standard deviation of split frequencies: 0.010430
840500 -- (-1163.858) [-1163.466] (-1163.911) (-1162.678) * (-1161.305) (-1161.992) (-1161.340) [-1164.927] -- 0:00:09
841000 -- [-1163.561] (-1161.665) (-1162.596) (-1162.526) * (-1162.220) (-1160.783) [-1163.302] (-1161.527) -- 0:00:09
841500 -- (-1163.180) (-1162.175) (-1160.908) [-1164.724] * [-1162.355] (-1162.129) (-1161.323) (-1161.637) -- 0:00:09
842000 -- (-1167.874) (-1164.133) (-1164.960) [-1167.705] * (-1163.720) (-1164.094) [-1162.318] (-1163.425) -- 0:00:09
842500 -- (-1166.079) [-1164.423] (-1162.873) (-1163.268) * [-1162.115] (-1162.804) (-1162.018) (-1162.878) -- 0:00:09
843000 -- [-1162.645] (-1166.697) (-1162.285) (-1161.673) * [-1166.192] (-1161.787) (-1169.541) (-1162.841) -- 0:00:09
843500 -- (-1163.024) [-1163.408] (-1161.131) (-1165.157) * (-1161.934) (-1163.160) (-1163.098) [-1162.043] -- 0:00:09
844000 -- (-1162.611) (-1165.071) (-1163.081) [-1161.857] * (-1162.646) (-1165.114) [-1162.908] (-1166.423) -- 0:00:09
844500 -- (-1164.684) (-1162.524) (-1165.170) [-1161.439] * (-1162.931) (-1162.461) (-1166.170) [-1162.929] -- 0:00:09
845000 -- (-1166.196) [-1162.621] (-1164.928) (-1163.512) * [-1162.257] (-1162.365) (-1161.718) (-1160.863) -- 0:00:09
Average standard deviation of split frequencies: 0.010476
845500 -- (-1164.438) [-1164.458] (-1162.619) (-1162.572) * [-1162.794] (-1163.801) (-1161.323) (-1162.277) -- 0:00:09
846000 -- (-1161.930) (-1165.568) (-1163.208) [-1163.121] * (-1165.445) [-1162.464] (-1163.421) (-1161.654) -- 0:00:09
846500 -- (-1162.421) [-1163.946] (-1161.292) (-1168.989) * (-1166.728) (-1161.648) [-1163.054] (-1162.069) -- 0:00:09
847000 -- [-1162.357] (-1165.712) (-1161.318) (-1165.260) * (-1161.318) (-1162.018) (-1163.583) [-1161.122] -- 0:00:09
847500 -- (-1164.449) (-1163.631) (-1162.700) [-1163.277] * (-1162.623) [-1167.105] (-1164.020) (-1162.367) -- 0:00:09
848000 -- (-1162.500) [-1162.837] (-1163.819) (-1161.396) * (-1161.618) [-1163.453] (-1161.971) (-1161.647) -- 0:00:09
848500 -- (-1161.802) [-1163.588] (-1161.486) (-1166.108) * (-1160.972) (-1164.722) [-1161.776] (-1165.762) -- 0:00:09
849000 -- (-1163.512) (-1166.129) (-1162.314) [-1165.013] * (-1160.961) (-1165.541) [-1163.346] (-1162.822) -- 0:00:09
849500 -- (-1164.194) (-1162.714) (-1161.391) [-1161.176] * (-1164.751) (-1165.957) (-1162.987) [-1161.116] -- 0:00:09
850000 -- [-1163.953] (-1163.433) (-1163.222) (-1161.516) * (-1167.886) (-1162.343) (-1163.445) [-1165.649] -- 0:00:09
Average standard deviation of split frequencies: 0.010640
850500 -- (-1164.699) (-1165.846) (-1163.987) [-1161.112] * (-1168.965) (-1162.561) [-1163.451] (-1161.556) -- 0:00:09
851000 -- (-1163.119) (-1166.988) (-1163.142) [-1161.809] * (-1164.322) (-1163.400) [-1167.053] (-1162.037) -- 0:00:09
851500 -- (-1162.027) (-1166.379) [-1166.460] (-1160.902) * [-1163.652] (-1161.851) (-1162.599) (-1161.862) -- 0:00:09
852000 -- (-1162.791) (-1164.546) (-1163.987) [-1162.290] * [-1162.443] (-1161.259) (-1164.895) (-1162.525) -- 0:00:09
852500 -- (-1165.147) (-1163.309) [-1161.956] (-1163.032) * [-1162.323] (-1162.498) (-1165.101) (-1163.590) -- 0:00:08
853000 -- (-1165.118) [-1163.560] (-1167.591) (-1164.719) * (-1161.949) (-1165.922) [-1166.289] (-1163.026) -- 0:00:08
853500 -- [-1162.213] (-1166.325) (-1161.438) (-1166.789) * (-1164.853) [-1165.126] (-1166.152) (-1163.498) -- 0:00:08
854000 -- (-1165.519) [-1161.056] (-1166.090) (-1162.542) * (-1162.010) (-1164.801) [-1163.782] (-1163.944) -- 0:00:08
854500 -- (-1163.900) (-1163.715) [-1166.729] (-1162.345) * [-1162.359] (-1163.729) (-1162.558) (-1162.891) -- 0:00:08
855000 -- [-1163.007] (-1161.250) (-1166.821) (-1163.221) * (-1162.584) [-1162.514] (-1161.335) (-1161.263) -- 0:00:08
Average standard deviation of split frequencies: 0.010574
855500 -- (-1163.764) [-1161.832] (-1162.773) (-1166.024) * (-1165.955) (-1165.484) [-1163.021] (-1164.590) -- 0:00:08
856000 -- [-1161.646] (-1162.861) (-1164.461) (-1165.494) * [-1164.572] (-1170.167) (-1162.409) (-1167.319) -- 0:00:08
856500 -- (-1161.169) (-1163.176) (-1163.555) [-1161.823] * (-1162.596) [-1167.589] (-1163.665) (-1164.912) -- 0:00:08
857000 -- (-1162.323) (-1162.678) [-1164.246] (-1164.325) * (-1162.532) (-1166.232) (-1164.486) [-1163.534] -- 0:00:08
857500 -- (-1162.700) (-1164.032) (-1161.945) [-1168.034] * (-1163.700) (-1163.703) (-1164.937) [-1165.761] -- 0:00:08
858000 -- (-1164.551) [-1161.584] (-1162.126) (-1162.278) * (-1161.689) (-1164.274) (-1167.217) [-1163.543] -- 0:00:08
858500 -- (-1163.957) (-1161.963) (-1165.839) [-1162.090] * [-1162.736] (-1164.655) (-1165.495) (-1162.036) -- 0:00:08
859000 -- (-1162.417) (-1161.734) (-1164.928) [-1163.861] * (-1164.611) (-1161.603) (-1163.615) [-1169.688] -- 0:00:08
859500 -- (-1163.392) (-1161.487) (-1162.493) [-1162.918] * (-1163.218) [-1167.487] (-1162.067) (-1164.598) -- 0:00:08
860000 -- (-1163.726) [-1164.400] (-1162.444) (-1163.072) * (-1161.694) [-1162.195] (-1166.014) (-1163.364) -- 0:00:08
Average standard deviation of split frequencies: 0.011393
860500 -- (-1164.016) [-1161.757] (-1162.368) (-1162.692) * (-1161.264) (-1164.083) [-1163.998] (-1163.611) -- 0:00:08
861000 -- (-1163.222) (-1165.439) [-1161.065] (-1161.321) * (-1162.521) (-1161.662) (-1165.036) [-1161.888] -- 0:00:08
861500 -- (-1162.904) (-1164.874) (-1161.188) [-1160.918] * [-1161.653] (-1162.235) (-1164.953) (-1165.211) -- 0:00:08
862000 -- (-1162.614) (-1164.843) (-1167.666) [-1161.680] * (-1162.350) (-1162.159) [-1165.136] (-1162.869) -- 0:00:08
862500 -- (-1163.325) (-1163.933) [-1163.681] (-1163.995) * [-1161.311] (-1162.577) (-1162.712) (-1163.443) -- 0:00:08
863000 -- (-1164.969) (-1162.252) [-1164.811] (-1163.220) * (-1163.688) (-1161.491) (-1168.048) [-1162.099] -- 0:00:08
863500 -- (-1170.788) (-1162.089) (-1163.780) [-1163.817] * (-1163.292) [-1161.292] (-1162.724) (-1164.622) -- 0:00:08
864000 -- [-1168.865] (-1163.319) (-1164.457) (-1167.132) * (-1161.415) (-1162.404) [-1162.194] (-1164.850) -- 0:00:08
864500 -- (-1165.384) (-1162.632) [-1163.232] (-1164.962) * [-1162.394] (-1162.766) (-1162.216) (-1161.830) -- 0:00:08
865000 -- [-1163.788] (-1161.380) (-1162.390) (-1164.305) * (-1163.716) (-1164.085) [-1161.572] (-1163.038) -- 0:00:08
Average standard deviation of split frequencies: 0.011758
865500 -- [-1162.973] (-1163.557) (-1165.433) (-1162.135) * (-1164.076) (-1164.854) [-1164.063] (-1162.333) -- 0:00:08
866000 -- (-1163.569) (-1164.681) (-1166.541) [-1164.646] * (-1166.047) (-1162.811) (-1166.208) [-1164.157] -- 0:00:08
866500 -- (-1163.247) (-1162.387) (-1164.433) [-1162.923] * (-1167.946) (-1165.282) [-1162.632] (-1165.041) -- 0:00:08
867000 -- (-1164.357) (-1162.065) [-1163.537] (-1163.927) * (-1161.362) (-1162.422) (-1163.519) [-1161.250] -- 0:00:08
867500 -- [-1162.430] (-1163.903) (-1164.643) (-1163.281) * (-1162.474) (-1169.919) [-1162.950] (-1163.793) -- 0:00:08
868000 -- [-1164.102] (-1162.300) (-1162.318) (-1164.187) * (-1162.270) (-1170.791) [-1163.511] (-1163.577) -- 0:00:08
868500 -- [-1162.445] (-1164.073) (-1163.892) (-1166.300) * (-1161.133) (-1163.501) [-1162.824] (-1163.582) -- 0:00:08
869000 -- (-1161.685) (-1165.736) (-1163.852) [-1164.116] * (-1161.238) (-1162.159) (-1163.093) [-1163.324] -- 0:00:07
869500 -- [-1164.246] (-1163.684) (-1163.030) (-1164.016) * [-1162.238] (-1161.526) (-1164.459) (-1163.456) -- 0:00:07
870000 -- (-1162.032) [-1161.618] (-1161.213) (-1162.423) * (-1162.296) [-1162.525] (-1163.368) (-1167.562) -- 0:00:07
Average standard deviation of split frequencies: 0.011478
870500 -- [-1163.559] (-1161.042) (-1161.984) (-1165.572) * [-1164.793] (-1163.938) (-1162.352) (-1164.265) -- 0:00:07
871000 -- (-1165.135) (-1161.122) [-1162.855] (-1162.200) * [-1164.790] (-1163.946) (-1165.084) (-1163.851) -- 0:00:07
871500 -- (-1161.323) (-1161.174) (-1162.595) [-1161.720] * (-1165.993) (-1162.093) [-1163.364] (-1163.946) -- 0:00:07
872000 -- (-1162.472) [-1160.962] (-1163.409) (-1161.758) * [-1162.409] (-1165.197) (-1167.906) (-1162.402) -- 0:00:07
872500 -- (-1165.666) (-1162.834) (-1163.504) [-1163.511] * [-1161.428] (-1165.116) (-1164.667) (-1164.853) -- 0:00:07
873000 -- (-1165.704) (-1162.543) [-1164.246] (-1164.217) * [-1164.279] (-1161.715) (-1170.307) (-1168.022) -- 0:00:07
873500 -- (-1165.649) [-1163.040] (-1162.576) (-1162.227) * (-1165.652) (-1161.279) [-1161.680] (-1171.906) -- 0:00:07
874000 -- (-1161.648) (-1163.043) (-1163.598) [-1163.853] * [-1163.637] (-1162.610) (-1162.445) (-1168.768) -- 0:00:07
874500 -- (-1162.033) (-1161.809) [-1163.687] (-1161.343) * [-1161.088] (-1164.354) (-1161.730) (-1164.070) -- 0:00:07
875000 -- [-1163.018] (-1162.207) (-1166.949) (-1167.023) * [-1161.973] (-1162.556) (-1161.700) (-1163.615) -- 0:00:07
Average standard deviation of split frequencies: 0.010547
875500 -- (-1163.127) (-1162.065) (-1161.986) [-1165.914] * (-1161.741) (-1164.993) (-1162.767) [-1164.527] -- 0:00:07
876000 -- [-1162.703] (-1162.074) (-1161.661) (-1164.457) * (-1162.695) (-1162.547) (-1161.996) [-1161.564] -- 0:00:07
876500 -- (-1163.816) (-1163.937) [-1162.067] (-1162.744) * (-1163.014) (-1163.933) (-1165.070) [-1161.624] -- 0:00:07
877000 -- (-1165.441) (-1166.560) [-1161.849] (-1161.915) * [-1160.831] (-1161.202) (-1164.907) (-1165.355) -- 0:00:07
877500 -- [-1161.756] (-1165.274) (-1164.953) (-1162.306) * [-1162.265] (-1161.178) (-1165.289) (-1163.980) -- 0:00:07
878000 -- (-1161.073) [-1163.615] (-1161.741) (-1165.857) * (-1164.390) [-1160.881] (-1167.126) (-1162.172) -- 0:00:07
878500 -- (-1168.336) (-1162.630) [-1163.596] (-1163.233) * [-1163.086] (-1161.855) (-1166.756) (-1163.439) -- 0:00:07
879000 -- (-1165.065) [-1162.302] (-1163.211) (-1162.625) * (-1162.933) (-1164.876) [-1167.021] (-1162.092) -- 0:00:07
879500 -- [-1164.713] (-1165.436) (-1164.586) (-1162.850) * (-1164.105) (-1167.099) (-1167.187) [-1161.872] -- 0:00:07
880000 -- (-1162.366) (-1164.626) [-1162.502] (-1162.831) * (-1164.304) [-1164.969] (-1165.436) (-1162.986) -- 0:00:07
Average standard deviation of split frequencies: 0.011562
880500 -- (-1167.716) (-1162.531) [-1162.684] (-1166.015) * (-1162.248) (-1166.668) (-1165.529) [-1162.302] -- 0:00:07
881000 -- (-1166.097) (-1167.341) [-1164.343] (-1163.785) * (-1161.934) [-1165.106] (-1162.469) (-1165.734) -- 0:00:07
881500 -- (-1162.503) (-1164.818) (-1168.175) [-1164.443] * [-1162.416] (-1164.686) (-1163.075) (-1165.563) -- 0:00:07
882000 -- (-1164.063) (-1164.916) [-1164.696] (-1162.425) * (-1165.428) [-1162.714] (-1162.833) (-1162.184) -- 0:00:07
882500 -- (-1161.769) (-1167.522) [-1162.168] (-1165.756) * (-1162.258) (-1164.051) (-1162.332) [-1161.158] -- 0:00:07
883000 -- [-1163.653] (-1164.330) (-1162.330) (-1162.310) * (-1161.502) (-1161.359) (-1162.135) [-1161.211] -- 0:00:07
883500 -- [-1161.018] (-1166.029) (-1164.848) (-1161.501) * (-1162.237) [-1162.152] (-1162.031) (-1164.871) -- 0:00:07
884000 -- [-1161.255] (-1161.441) (-1163.761) (-1161.329) * (-1163.261) [-1163.844] (-1160.874) (-1165.551) -- 0:00:07
884500 -- (-1164.828) (-1162.571) (-1163.334) [-1163.277] * (-1165.330) (-1163.618) (-1166.373) [-1162.254] -- 0:00:07
885000 -- (-1163.442) (-1162.814) [-1162.993] (-1162.618) * [-1163.318] (-1163.260) (-1161.474) (-1165.093) -- 0:00:07
Average standard deviation of split frequencies: 0.011067
885500 -- [-1162.659] (-1163.160) (-1163.648) (-1161.962) * [-1162.871] (-1163.996) (-1164.430) (-1163.464) -- 0:00:06
886000 -- (-1165.570) (-1163.338) (-1162.599) [-1162.467] * (-1161.450) (-1162.033) (-1163.830) [-1164.460] -- 0:00:06
886500 -- (-1164.276) (-1162.212) [-1161.054] (-1163.734) * [-1165.718] (-1169.143) (-1160.921) (-1161.665) -- 0:00:06
887000 -- (-1163.724) [-1162.388] (-1165.013) (-1162.315) * [-1162.979] (-1165.242) (-1161.206) (-1164.833) -- 0:00:06
887500 -- (-1163.402) [-1163.147] (-1163.091) (-1162.435) * (-1162.706) (-1164.834) [-1162.954] (-1166.394) -- 0:00:06
888000 -- (-1161.457) (-1163.243) (-1163.145) [-1162.680] * [-1163.266] (-1164.662) (-1163.667) (-1165.777) -- 0:00:06
888500 -- (-1161.849) (-1165.417) (-1163.999) [-1161.814] * (-1162.545) [-1162.505] (-1162.854) (-1164.108) -- 0:00:06
889000 -- [-1163.234] (-1165.813) (-1163.821) (-1165.744) * (-1162.107) [-1163.455] (-1162.304) (-1163.022) -- 0:00:06
889500 -- (-1165.140) (-1163.369) (-1162.266) [-1161.831] * (-1162.257) [-1163.319] (-1164.519) (-1161.621) -- 0:00:06
890000 -- (-1163.278) (-1163.346) (-1162.838) [-1163.331] * (-1161.971) [-1161.304] (-1164.709) (-1165.211) -- 0:00:06
Average standard deviation of split frequencies: 0.011221
890500 -- (-1161.889) (-1163.682) [-1163.562] (-1163.328) * (-1161.971) [-1162.826] (-1163.517) (-1161.703) -- 0:00:06
891000 -- [-1163.898] (-1163.006) (-1165.053) (-1162.128) * [-1161.252] (-1161.451) (-1163.539) (-1161.385) -- 0:00:06
891500 -- [-1162.685] (-1161.548) (-1167.879) (-1162.231) * [-1161.323] (-1162.524) (-1164.024) (-1164.393) -- 0:00:06
892000 -- (-1161.838) (-1162.238) (-1162.904) [-1162.856] * (-1162.661) (-1161.879) [-1162.321] (-1164.487) -- 0:00:06
892500 -- (-1162.669) (-1163.149) [-1161.553] (-1163.676) * (-1163.390) (-1161.812) [-1162.576] (-1168.055) -- 0:00:06
893000 -- (-1161.394) (-1161.860) (-1167.212) [-1164.537] * (-1164.169) (-1166.648) [-1163.124] (-1168.013) -- 0:00:06
893500 -- (-1161.538) (-1162.983) (-1167.174) [-1164.819] * [-1162.448] (-1168.689) (-1164.384) (-1169.006) -- 0:00:06
894000 -- (-1161.402) [-1163.016] (-1167.387) (-1164.193) * [-1161.009] (-1168.163) (-1164.611) (-1166.387) -- 0:00:06
894500 -- (-1164.514) [-1161.601] (-1168.381) (-1165.410) * (-1163.521) [-1162.352] (-1162.794) (-1165.738) -- 0:00:06
895000 -- (-1163.864) [-1162.594] (-1163.370) (-1167.939) * (-1163.552) (-1162.911) (-1162.847) [-1165.659] -- 0:00:06
Average standard deviation of split frequencies: 0.011575
895500 -- (-1161.603) [-1161.799] (-1161.685) (-1167.744) * (-1166.814) [-1161.476] (-1161.416) (-1161.074) -- 0:00:06
896000 -- (-1162.480) [-1162.275] (-1161.725) (-1162.555) * [-1164.067] (-1162.164) (-1161.843) (-1163.796) -- 0:00:06
896500 -- [-1162.589] (-1162.645) (-1161.495) (-1164.276) * (-1162.338) (-1161.192) (-1161.656) [-1163.676] -- 0:00:06
897000 -- (-1161.124) (-1163.093) (-1167.586) [-1162.477] * (-1161.928) (-1162.192) [-1162.436] (-1162.395) -- 0:00:06
897500 -- [-1161.153] (-1164.086) (-1165.007) (-1161.819) * (-1163.906) (-1161.148) [-1164.629] (-1164.450) -- 0:00:06
898000 -- (-1162.365) [-1162.344] (-1161.653) (-1162.323) * (-1164.040) (-1162.009) [-1163.815] (-1163.657) -- 0:00:06
898500 -- (-1168.516) (-1164.092) (-1167.554) [-1163.874] * (-1163.672) (-1161.335) [-1162.857] (-1167.301) -- 0:00:06
899000 -- (-1163.250) [-1162.410] (-1167.952) (-1166.164) * (-1162.423) [-1161.565] (-1162.626) (-1165.196) -- 0:00:06
899500 -- (-1163.056) (-1162.681) [-1161.768] (-1162.290) * (-1163.420) (-1165.865) [-1162.090] (-1162.710) -- 0:00:06
900000 -- (-1167.640) (-1162.384) [-1162.929] (-1162.114) * (-1164.444) (-1162.582) [-1161.445] (-1163.599) -- 0:00:06
Average standard deviation of split frequencies: 0.010677
900500 -- (-1165.462) (-1162.261) (-1163.249) [-1163.573] * (-1161.704) [-1162.331] (-1162.135) (-1165.218) -- 0:00:06
901000 -- (-1162.877) (-1163.223) (-1161.915) [-1163.066] * (-1162.105) (-1165.107) [-1162.613] (-1162.957) -- 0:00:06
901500 -- (-1164.206) [-1161.245] (-1162.279) (-1164.444) * (-1161.029) [-1165.376] (-1163.143) (-1165.039) -- 0:00:06
902000 -- (-1164.358) (-1164.060) (-1163.562) [-1162.793] * (-1165.420) [-1161.883] (-1162.307) (-1163.137) -- 0:00:05
902500 -- (-1162.256) [-1165.773] (-1167.090) (-1164.588) * [-1161.843] (-1162.400) (-1161.577) (-1163.083) -- 0:00:05
903000 -- [-1162.630] (-1166.027) (-1163.193) (-1164.552) * (-1163.453) (-1164.516) [-1163.091] (-1165.847) -- 0:00:05
903500 -- (-1166.798) [-1166.753] (-1162.030) (-1162.820) * [-1165.593] (-1164.929) (-1169.857) (-1165.819) -- 0:00:05
904000 -- (-1164.213) (-1163.198) [-1162.174] (-1163.737) * (-1166.514) (-1165.354) [-1161.592] (-1165.534) -- 0:00:05
904500 -- [-1162.687] (-1162.050) (-1161.736) (-1163.929) * (-1162.810) [-1162.964] (-1161.471) (-1164.974) -- 0:00:05
905000 -- (-1165.662) (-1163.576) [-1163.330] (-1165.111) * (-1163.188) (-1162.054) (-1161.771) [-1163.408] -- 0:00:05
Average standard deviation of split frequencies: 0.010406
905500 -- (-1164.006) [-1168.448] (-1163.883) (-1167.902) * (-1162.993) [-1163.017] (-1161.812) (-1168.362) -- 0:00:05
906000 -- [-1167.951] (-1163.103) (-1163.341) (-1162.772) * (-1162.788) (-1163.676) [-1161.285] (-1164.009) -- 0:00:05
906500 -- (-1168.569) (-1164.556) (-1165.581) [-1162.144] * (-1163.545) (-1161.297) (-1161.266) [-1162.372] -- 0:00:05
907000 -- [-1162.055] (-1162.634) (-1164.622) (-1164.556) * (-1161.234) (-1161.414) (-1163.381) [-1162.097] -- 0:00:05
907500 -- (-1164.808) (-1163.630) [-1161.945] (-1161.142) * [-1162.632] (-1162.936) (-1162.088) (-1161.060) -- 0:00:05
908000 -- (-1164.573) (-1164.942) [-1162.142] (-1162.114) * (-1163.490) (-1161.349) [-1161.322] (-1161.823) -- 0:00:05
908500 -- [-1163.840] (-1162.813) (-1162.774) (-1162.728) * (-1165.909) (-1162.706) (-1162.939) [-1162.638] -- 0:00:05
909000 -- (-1165.122) [-1161.530] (-1165.133) (-1164.179) * (-1164.065) [-1163.172] (-1168.332) (-1162.266) -- 0:00:05
909500 -- (-1165.623) (-1163.575) (-1166.391) [-1161.817] * (-1164.683) (-1163.550) (-1168.380) [-1164.910] -- 0:00:05
910000 -- (-1165.221) (-1167.987) [-1163.477] (-1162.334) * (-1162.921) (-1163.847) [-1163.760] (-1164.208) -- 0:00:05
Average standard deviation of split frequencies: 0.010560
910500 -- (-1163.528) (-1166.576) (-1161.590) [-1162.948] * (-1163.044) [-1162.559] (-1163.784) (-1162.778) -- 0:00:05
911000 -- (-1162.670) (-1164.681) [-1161.474] (-1163.388) * (-1163.674) (-1168.494) [-1166.803] (-1166.543) -- 0:00:05
911500 -- (-1166.004) [-1165.270] (-1163.579) (-1162.210) * (-1161.706) (-1164.531) [-1161.517] (-1163.287) -- 0:00:05
912000 -- (-1162.632) (-1162.700) (-1162.308) [-1167.349] * (-1162.714) (-1165.560) (-1161.306) [-1161.831] -- 0:00:05
912500 -- (-1162.991) (-1166.306) (-1163.886) [-1165.347] * (-1160.973) (-1161.744) [-1163.649] (-1164.404) -- 0:00:05
913000 -- (-1161.771) (-1165.662) [-1165.343] (-1172.965) * (-1165.854) [-1162.294] (-1161.664) (-1163.232) -- 0:00:05
913500 -- (-1161.908) [-1162.428] (-1165.068) (-1163.289) * (-1162.883) (-1163.257) [-1162.624] (-1165.667) -- 0:00:05
914000 -- (-1163.419) (-1163.061) (-1161.940) [-1162.817] * (-1167.796) [-1161.860] (-1162.422) (-1163.618) -- 0:00:05
914500 -- [-1161.392] (-1165.959) (-1161.798) (-1164.557) * (-1164.201) (-1169.861) (-1162.315) [-1164.286] -- 0:00:05
915000 -- (-1161.303) (-1163.578) (-1163.668) [-1164.371] * (-1161.107) [-1162.156] (-1161.925) (-1163.525) -- 0:00:05
Average standard deviation of split frequencies: 0.009881
915500 -- (-1162.834) (-1161.914) [-1165.188] (-1161.940) * (-1167.961) (-1168.242) (-1161.409) [-1162.416] -- 0:00:05
916000 -- (-1161.943) [-1160.829] (-1162.353) (-1161.650) * (-1164.718) (-1161.719) (-1165.868) [-1162.412] -- 0:00:05
916500 -- (-1164.604) (-1162.028) [-1162.045] (-1162.942) * (-1161.552) (-1162.212) (-1165.140) [-1162.953] -- 0:00:05
917000 -- (-1166.519) [-1161.526] (-1162.400) (-1162.469) * (-1164.087) [-1163.434] (-1164.383) (-1162.371) -- 0:00:05
917500 -- (-1164.435) [-1164.571] (-1164.219) (-1165.842) * (-1161.715) (-1163.421) [-1160.816] (-1164.329) -- 0:00:05
918000 -- (-1162.625) (-1161.925) (-1161.451) [-1165.813] * (-1163.520) (-1165.406) (-1167.734) [-1163.398] -- 0:00:05
918500 -- [-1161.852] (-1161.925) (-1161.998) (-1165.243) * [-1162.424] (-1162.795) (-1166.054) (-1163.885) -- 0:00:04
919000 -- (-1161.757) [-1161.687] (-1162.102) (-1162.975) * (-1178.288) [-1162.555] (-1164.788) (-1165.200) -- 0:00:04
919500 -- (-1161.285) [-1162.358] (-1163.292) (-1165.688) * (-1162.903) (-1161.625) (-1162.659) [-1164.898] -- 0:00:04
920000 -- (-1164.193) (-1163.567) [-1162.574] (-1164.994) * [-1161.838] (-1167.290) (-1163.155) (-1162.552) -- 0:00:04
Average standard deviation of split frequencies: 0.010138
920500 -- (-1163.722) (-1161.931) (-1164.032) [-1160.797] * (-1166.527) [-1161.797] (-1165.951) (-1165.690) -- 0:00:04
921000 -- (-1162.718) (-1166.997) [-1163.856] (-1162.936) * (-1162.431) (-1162.740) [-1166.588] (-1166.762) -- 0:00:04
921500 -- (-1163.362) (-1164.008) [-1163.522] (-1165.463) * [-1162.436] (-1164.987) (-1169.217) (-1164.879) -- 0:00:04
922000 -- [-1161.956] (-1162.143) (-1164.246) (-1164.700) * (-1162.270) (-1166.152) [-1166.484] (-1164.211) -- 0:00:04
922500 -- (-1164.162) [-1165.205] (-1162.441) (-1163.223) * (-1161.979) (-1163.563) [-1164.656] (-1163.145) -- 0:00:04
923000 -- (-1163.517) (-1161.261) (-1168.695) [-1167.278] * (-1162.184) (-1162.999) [-1162.338] (-1163.004) -- 0:00:04
923500 -- (-1163.569) [-1162.153] (-1163.834) (-1163.147) * (-1161.358) (-1160.881) [-1162.189] (-1164.006) -- 0:00:04
924000 -- [-1164.716] (-1162.166) (-1163.784) (-1161.900) * (-1162.147) [-1162.222] (-1162.743) (-1166.932) -- 0:00:04
924500 -- (-1161.492) (-1161.938) (-1162.048) [-1162.514] * [-1163.045] (-1162.902) (-1162.752) (-1165.197) -- 0:00:04
925000 -- [-1164.561] (-1161.782) (-1170.130) (-1162.642) * [-1162.503] (-1163.735) (-1164.533) (-1167.651) -- 0:00:04
Average standard deviation of split frequencies: 0.010283
925500 -- (-1165.775) (-1161.029) (-1162.403) [-1163.301] * (-1161.736) [-1166.194] (-1165.768) (-1166.217) -- 0:00:04
926000 -- (-1163.228) (-1164.134) (-1162.875) [-1164.275] * [-1165.255] (-1167.171) (-1162.979) (-1164.812) -- 0:00:04
926500 -- (-1163.566) (-1163.730) [-1162.673] (-1162.605) * [-1163.945] (-1166.532) (-1161.416) (-1162.110) -- 0:00:04
927000 -- (-1161.297) [-1161.812] (-1164.049) (-1164.627) * (-1163.199) (-1161.428) [-1162.953] (-1161.564) -- 0:00:04
927500 -- (-1163.853) [-1161.874] (-1163.494) (-1161.973) * (-1163.045) (-1163.665) (-1171.099) [-1162.722] -- 0:00:04
928000 -- (-1161.538) [-1164.638] (-1164.841) (-1161.160) * (-1164.883) (-1163.546) [-1165.155] (-1162.473) -- 0:00:04
928500 -- (-1161.518) [-1161.621] (-1167.071) (-1161.160) * [-1162.590] (-1163.481) (-1162.860) (-1161.486) -- 0:00:04
929000 -- [-1161.102] (-1161.358) (-1165.652) (-1163.752) * (-1161.950) (-1162.795) [-1164.388] (-1163.320) -- 0:00:04
929500 -- (-1162.270) (-1162.787) (-1162.300) [-1162.984] * (-1162.049) (-1164.432) [-1162.147] (-1161.421) -- 0:00:04
930000 -- (-1162.096) [-1171.345] (-1164.425) (-1162.964) * (-1164.442) [-1161.869] (-1164.400) (-1166.641) -- 0:00:04
Average standard deviation of split frequencies: 0.009827
930500 -- (-1162.053) (-1162.133) (-1164.133) [-1162.524] * (-1164.880) [-1162.829] (-1165.937) (-1163.534) -- 0:00:04
931000 -- [-1162.830] (-1164.867) (-1163.393) (-1162.639) * (-1163.956) (-1165.799) [-1165.034] (-1164.651) -- 0:00:04
931500 -- [-1164.609] (-1162.973) (-1162.752) (-1164.292) * (-1165.786) (-1164.181) [-1164.650] (-1162.825) -- 0:00:04
932000 -- (-1160.985) (-1164.745) (-1161.529) [-1166.765] * [-1162.243] (-1163.048) (-1165.042) (-1162.860) -- 0:00:04
932500 -- (-1162.746) (-1164.765) (-1164.732) [-1168.688] * (-1162.491) [-1162.997] (-1163.214) (-1162.031) -- 0:00:04
933000 -- (-1162.761) (-1164.838) [-1164.891] (-1162.858) * (-1163.544) (-1164.237) [-1164.024] (-1164.448) -- 0:00:04
933500 -- (-1162.702) [-1165.475] (-1164.916) (-1164.067) * (-1164.803) (-1166.879) [-1168.279] (-1163.056) -- 0:00:04
934000 -- [-1161.841] (-1164.395) (-1161.843) (-1162.131) * (-1164.086) [-1162.451] (-1163.741) (-1161.196) -- 0:00:04
934500 -- (-1161.945) (-1164.046) [-1162.569] (-1161.119) * [-1165.578] (-1161.047) (-1164.069) (-1163.015) -- 0:00:03
935000 -- [-1168.546] (-1163.829) (-1163.180) (-1165.306) * (-1165.455) (-1166.003) (-1162.807) [-1163.814] -- 0:00:03
Average standard deviation of split frequencies: 0.009771
935500 -- [-1161.628] (-1163.690) (-1166.953) (-1161.542) * (-1164.244) (-1161.918) (-1170.563) [-1161.218] -- 0:00:03
936000 -- [-1161.659] (-1164.184) (-1162.074) (-1161.624) * (-1162.562) (-1163.559) (-1165.911) [-1161.443] -- 0:00:03
936500 -- (-1162.459) [-1164.283] (-1161.732) (-1162.589) * (-1164.733) [-1162.934] (-1162.662) (-1162.846) -- 0:00:03
937000 -- (-1163.884) (-1163.690) (-1164.128) [-1161.522] * [-1161.444] (-1162.784) (-1164.085) (-1164.708) -- 0:00:03
937500 -- (-1163.505) (-1163.294) (-1165.238) [-1162.803] * (-1161.627) (-1162.301) [-1163.530] (-1164.533) -- 0:00:03
938000 -- [-1164.758] (-1161.934) (-1163.708) (-1163.025) * (-1164.725) (-1162.627) [-1162.430] (-1165.680) -- 0:00:03
938500 -- (-1168.856) (-1162.883) [-1161.683] (-1161.830) * [-1164.662] (-1161.822) (-1164.979) (-1162.074) -- 0:00:03
939000 -- (-1163.432) (-1168.267) [-1161.130] (-1162.438) * [-1164.893] (-1164.464) (-1163.517) (-1161.840) -- 0:00:03
939500 -- (-1163.418) (-1167.444) (-1165.548) [-1162.940] * [-1167.593] (-1161.601) (-1163.151) (-1162.641) -- 0:00:03
940000 -- (-1163.068) [-1162.861] (-1165.831) (-1163.034) * (-1164.208) [-1163.194] (-1162.230) (-1162.840) -- 0:00:03
Average standard deviation of split frequencies: 0.009321
940500 -- [-1161.046] (-1161.913) (-1164.728) (-1163.008) * (-1164.597) (-1164.229) [-1162.441] (-1162.225) -- 0:00:03
941000 -- (-1167.604) [-1161.137] (-1165.914) (-1163.703) * [-1163.671] (-1162.742) (-1160.967) (-1161.412) -- 0:00:03
941500 -- [-1161.771] (-1162.527) (-1165.580) (-1165.926) * (-1163.860) (-1161.169) [-1161.781] (-1162.539) -- 0:00:03
942000 -- (-1162.867) (-1163.308) [-1163.280] (-1167.730) * [-1164.057] (-1167.799) (-1162.898) (-1163.229) -- 0:00:03
942500 -- (-1161.664) [-1163.544] (-1161.696) (-1163.872) * (-1168.278) (-1162.236) [-1162.741] (-1163.381) -- 0:00:03
943000 -- [-1162.625] (-1165.581) (-1161.709) (-1164.885) * (-1168.364) [-1162.239] (-1165.901) (-1161.421) -- 0:00:03
943500 -- [-1165.173] (-1165.781) (-1162.881) (-1163.341) * [-1161.904] (-1163.236) (-1167.145) (-1163.501) -- 0:00:03
944000 -- (-1164.399) (-1162.969) (-1163.318) [-1161.360] * (-1161.903) (-1166.627) (-1165.291) [-1161.769] -- 0:00:03
944500 -- (-1162.804) [-1161.320] (-1161.993) (-1164.770) * [-1162.362] (-1164.994) (-1165.900) (-1164.610) -- 0:00:03
945000 -- (-1164.751) (-1164.432) (-1164.392) [-1162.046] * (-1162.163) (-1162.187) [-1163.737] (-1164.521) -- 0:00:03
Average standard deviation of split frequencies: 0.009667
945500 -- [-1161.811] (-1165.419) (-1164.226) (-1163.391) * (-1161.760) [-1164.871] (-1162.837) (-1162.603) -- 0:00:03
946000 -- (-1162.601) [-1166.091] (-1162.745) (-1163.340) * (-1168.956) [-1160.976] (-1161.105) (-1161.556) -- 0:00:03
946500 -- (-1165.171) [-1163.317] (-1164.932) (-1162.796) * (-1163.142) (-1164.294) [-1161.120] (-1165.114) -- 0:00:03
947000 -- (-1163.776) [-1161.985] (-1166.333) (-1163.116) * (-1165.926) (-1167.388) [-1160.911] (-1165.277) -- 0:00:03
947500 -- (-1162.797) (-1165.413) [-1163.768] (-1170.680) * (-1164.827) [-1162.915] (-1162.048) (-1163.905) -- 0:00:03
948000 -- (-1167.735) (-1163.949) (-1163.609) [-1162.915] * (-1163.912) (-1163.262) (-1162.507) [-1161.663] -- 0:00:03
948500 -- [-1161.686] (-1164.516) (-1161.663) (-1161.532) * (-1164.826) [-1163.383] (-1165.490) (-1161.824) -- 0:00:03
949000 -- [-1161.595] (-1161.724) (-1166.139) (-1162.944) * (-1163.441) [-1168.335] (-1161.996) (-1161.231) -- 0:00:03
949500 -- (-1162.675) (-1162.383) (-1163.184) [-1162.975] * [-1161.393] (-1166.352) (-1170.545) (-1165.427) -- 0:00:03
950000 -- (-1162.268) [-1161.466] (-1161.623) (-1163.781) * [-1163.367] (-1163.897) (-1163.116) (-1164.180) -- 0:00:03
Average standard deviation of split frequencies: 0.009124
950500 -- (-1168.272) (-1163.332) [-1162.037] (-1162.707) * (-1163.749) (-1163.361) (-1163.191) [-1165.768] -- 0:00:03
951000 -- (-1166.770) [-1161.397] (-1162.140) (-1162.792) * (-1163.145) (-1161.503) (-1162.868) [-1164.842] -- 0:00:02
951500 -- (-1161.846) [-1161.420] (-1162.531) (-1163.640) * (-1163.549) [-1162.678] (-1163.120) (-1163.255) -- 0:00:02
952000 -- (-1162.339) [-1161.479] (-1162.173) (-1167.281) * (-1163.921) (-1164.295) [-1161.973] (-1163.579) -- 0:00:02
952500 -- (-1162.673) (-1162.466) [-1165.347] (-1169.158) * (-1164.276) (-1163.984) (-1162.845) [-1166.168] -- 0:00:02
953000 -- (-1163.118) (-1163.054) [-1162.618] (-1165.135) * (-1165.300) (-1163.073) [-1165.239] (-1165.866) -- 0:00:02
953500 -- (-1162.585) (-1164.085) (-1168.669) [-1161.649] * (-1165.064) [-1167.632] (-1162.693) (-1169.483) -- 0:00:02
954000 -- (-1161.469) [-1161.488] (-1163.153) (-1162.027) * (-1162.869) (-1162.834) [-1163.308] (-1165.521) -- 0:00:02
954500 -- [-1161.020] (-1161.164) (-1162.550) (-1161.236) * (-1165.051) (-1163.597) [-1164.513] (-1162.892) -- 0:00:02
955000 -- (-1163.151) (-1165.183) (-1166.749) [-1162.398] * (-1162.072) [-1164.419] (-1162.238) (-1164.253) -- 0:00:02
Average standard deviation of split frequencies: 0.009073
955500 -- (-1162.541) (-1162.793) (-1163.316) [-1162.160] * [-1161.555] (-1164.126) (-1162.217) (-1162.260) -- 0:00:02
956000 -- (-1164.519) (-1162.965) (-1164.068) [-1160.977] * (-1162.293) [-1162.535] (-1161.446) (-1161.347) -- 0:00:02
956500 -- (-1161.515) [-1163.103] (-1161.143) (-1167.403) * (-1163.913) (-1161.223) [-1163.230] (-1161.577) -- 0:00:02
957000 -- (-1167.023) (-1162.492) [-1161.850] (-1164.694) * (-1162.602) (-1163.376) [-1164.424] (-1163.614) -- 0:00:02
957500 -- [-1162.709] (-1164.018) (-1168.473) (-1164.135) * [-1161.028] (-1161.918) (-1162.106) (-1162.746) -- 0:00:02
958000 -- [-1161.597] (-1161.165) (-1163.307) (-1163.198) * (-1161.020) [-1163.127] (-1167.270) (-1162.233) -- 0:00:02
958500 -- (-1164.472) (-1161.786) (-1165.038) [-1161.663] * (-1161.979) [-1161.636] (-1163.237) (-1164.301) -- 0:00:02
959000 -- (-1164.473) [-1164.846] (-1161.793) (-1161.709) * (-1162.446) [-1162.795] (-1162.335) (-1162.694) -- 0:00:02
959500 -- (-1165.346) (-1165.318) (-1166.055) [-1162.962] * (-1162.410) (-1165.021) (-1162.335) [-1163.151] -- 0:00:02
960000 -- [-1161.402] (-1164.035) (-1163.306) (-1161.927) * (-1162.270) (-1166.570) (-1166.354) [-1161.547] -- 0:00:02
Average standard deviation of split frequencies: 0.008636
960500 -- (-1163.390) (-1162.724) (-1165.361) [-1162.282] * (-1163.061) (-1165.679) [-1161.978] (-1164.120) -- 0:00:02
961000 -- (-1164.898) [-1162.476] (-1171.700) (-1162.522) * (-1162.681) (-1165.129) [-1161.499] (-1163.441) -- 0:00:02
961500 -- (-1164.783) (-1166.510) (-1162.250) [-1168.042] * [-1161.795] (-1163.260) (-1162.526) (-1162.040) -- 0:00:02
962000 -- (-1164.131) (-1165.204) [-1163.540] (-1166.391) * (-1161.316) [-1161.663] (-1161.156) (-1163.266) -- 0:00:02
962500 -- (-1162.284) (-1161.373) [-1163.169] (-1162.692) * (-1162.696) [-1161.678] (-1164.095) (-1161.307) -- 0:00:02
963000 -- (-1161.987) (-1162.448) [-1164.167] (-1162.132) * [-1166.584] (-1161.969) (-1162.656) (-1161.831) -- 0:00:02
963500 -- [-1161.955] (-1161.427) (-1165.695) (-1164.918) * [-1164.251] (-1164.431) (-1163.780) (-1161.761) -- 0:00:02
964000 -- (-1164.914) (-1166.208) (-1163.364) [-1161.598] * (-1163.228) (-1168.561) (-1165.345) [-1162.053] -- 0:00:02
964500 -- (-1163.869) (-1162.883) (-1164.518) [-1161.193] * (-1162.765) (-1164.642) [-1163.890] (-1162.822) -- 0:00:02
965000 -- [-1163.671] (-1163.349) (-1161.673) (-1163.113) * (-1169.031) (-1164.737) (-1161.345) [-1163.348] -- 0:00:02
Average standard deviation of split frequencies: 0.009370
965500 -- (-1165.733) (-1163.395) (-1162.223) [-1163.060] * [-1164.424] (-1163.566) (-1161.399) (-1164.689) -- 0:00:02
966000 -- (-1164.832) (-1164.513) (-1162.265) [-1167.945] * [-1164.229] (-1164.915) (-1166.505) (-1161.958) -- 0:00:02
966500 -- (-1162.787) (-1168.652) (-1162.310) [-1165.587] * (-1161.697) (-1163.105) (-1163.958) [-1161.936] -- 0:00:02
967000 -- (-1163.925) [-1161.652] (-1161.700) (-1166.113) * (-1165.752) (-1163.750) (-1162.690) [-1163.113] -- 0:00:02
967500 -- (-1162.235) [-1161.099] (-1161.914) (-1166.524) * [-1166.300] (-1165.641) (-1166.867) (-1161.832) -- 0:00:01
968000 -- (-1163.519) [-1162.622] (-1161.419) (-1162.327) * (-1167.444) (-1162.139) (-1161.910) [-1161.722] -- 0:00:01
968500 -- (-1163.127) (-1161.127) [-1163.861] (-1164.277) * (-1164.412) (-1164.808) [-1162.076] (-1163.485) -- 0:00:01
969000 -- (-1167.552) (-1163.256) (-1162.770) [-1163.459] * (-1163.094) [-1162.326] (-1165.175) (-1162.195) -- 0:00:01
969500 -- [-1161.588] (-1164.006) (-1161.953) (-1162.587) * [-1163.209] (-1161.013) (-1163.804) (-1161.806) -- 0:00:01
970000 -- [-1161.648] (-1162.160) (-1163.341) (-1161.368) * (-1163.481) (-1161.705) (-1162.702) [-1161.983] -- 0:00:01
Average standard deviation of split frequencies: 0.009713
970500 -- [-1162.801] (-1163.428) (-1161.841) (-1162.500) * (-1163.730) (-1166.739) (-1163.057) [-1162.615] -- 0:00:01
971000 -- (-1162.960) (-1164.477) [-1163.238] (-1164.328) * (-1164.865) [-1164.333] (-1164.611) (-1161.850) -- 0:00:01
971500 -- (-1162.253) (-1167.311) [-1161.334] (-1163.006) * (-1166.541) [-1162.042] (-1161.576) (-1162.394) -- 0:00:01
972000 -- (-1163.361) (-1162.708) (-1161.873) [-1162.603] * (-1166.383) (-1161.662) (-1162.875) [-1161.976] -- 0:00:01
972500 -- [-1162.168] (-1162.638) (-1162.651) (-1163.182) * (-1165.669) (-1162.728) (-1163.730) [-1161.931] -- 0:00:01
973000 -- (-1162.562) (-1163.661) (-1163.180) [-1163.223] * (-1165.022) (-1163.980) (-1164.443) [-1161.944] -- 0:00:01
973500 -- (-1164.909) [-1161.204] (-1170.103) (-1161.493) * (-1161.069) (-1162.848) (-1164.301) [-1162.118] -- 0:00:01
974000 -- (-1164.813) (-1165.611) (-1162.693) [-1161.211] * (-1161.686) (-1162.321) [-1161.782] (-1163.150) -- 0:00:01
974500 -- (-1161.140) (-1162.376) [-1166.942] (-1161.513) * [-1161.504] (-1163.853) (-1162.150) (-1166.481) -- 0:00:01
975000 -- (-1162.592) (-1162.687) [-1162.784] (-1166.430) * (-1162.059) [-1162.809] (-1162.240) (-1164.539) -- 0:00:01
Average standard deviation of split frequencies: 0.009274
975500 -- (-1164.258) [-1162.038] (-1166.365) (-1161.653) * (-1172.217) [-1163.478] (-1161.871) (-1163.000) -- 0:00:01
976000 -- (-1163.727) (-1162.438) [-1164.713] (-1160.862) * (-1164.935) [-1161.196] (-1164.451) (-1163.158) -- 0:00:01
976500 -- (-1163.606) (-1161.545) (-1162.603) [-1161.859] * (-1166.446) (-1163.011) (-1164.832) [-1163.258] -- 0:00:01
977000 -- (-1164.773) (-1161.665) (-1161.194) [-1162.808] * (-1168.203) (-1163.848) (-1162.970) [-1166.665] -- 0:00:01
977500 -- [-1164.010] (-1161.787) (-1161.639) (-1164.632) * (-1162.595) (-1164.468) [-1163.092] (-1163.939) -- 0:00:01
978000 -- (-1162.583) (-1162.140) [-1162.505] (-1161.486) * (-1162.977) (-1162.271) [-1161.705] (-1162.192) -- 0:00:01
978500 -- (-1163.319) [-1162.388] (-1162.762) (-1162.133) * (-1163.064) (-1162.560) [-1161.608] (-1161.145) -- 0:00:01
979000 -- (-1163.608) (-1165.780) [-1163.707] (-1164.222) * (-1162.705) (-1162.247) (-1163.050) [-1162.100] -- 0:00:01
979500 -- (-1163.945) [-1165.479] (-1165.234) (-1162.427) * (-1165.798) (-1162.088) [-1166.502] (-1161.927) -- 0:00:01
980000 -- (-1162.702) (-1165.536) [-1161.311] (-1162.461) * (-1162.370) [-1162.245] (-1163.055) (-1161.557) -- 0:00:01
Average standard deviation of split frequencies: 0.009614
980500 -- (-1167.227) [-1163.589] (-1162.114) (-1165.072) * [-1163.426] (-1163.797) (-1162.523) (-1164.513) -- 0:00:01
981000 -- [-1162.500] (-1161.486) (-1162.947) (-1163.035) * (-1163.514) [-1165.579] (-1162.172) (-1165.512) -- 0:00:01
981500 -- (-1163.072) [-1161.938] (-1161.215) (-1162.994) * (-1162.897) [-1165.565] (-1161.664) (-1165.631) -- 0:00:01
982000 -- [-1161.492] (-1161.074) (-1163.414) (-1163.796) * [-1161.472] (-1164.260) (-1162.440) (-1164.449) -- 0:00:01
982500 -- (-1162.843) (-1162.478) (-1163.117) [-1163.410] * (-1163.505) [-1167.314] (-1161.696) (-1163.377) -- 0:00:01
983000 -- (-1161.189) [-1162.792] (-1165.054) (-1161.621) * [-1162.543] (-1163.623) (-1162.906) (-1163.454) -- 0:00:01
983500 -- (-1162.158) [-1164.090] (-1162.049) (-1163.396) * (-1161.817) (-1164.435) [-1162.544] (-1164.141) -- 0:00:01
984000 -- (-1161.940) (-1165.627) [-1163.782] (-1163.952) * (-1164.472) [-1163.561] (-1160.999) (-1164.079) -- 0:00:00
984500 -- [-1161.142] (-1161.432) (-1164.790) (-1162.825) * (-1161.860) (-1166.355) [-1161.460] (-1167.037) -- 0:00:00
985000 -- (-1161.142) [-1164.959] (-1162.102) (-1164.671) * (-1168.077) (-1161.776) [-1164.786] (-1165.182) -- 0:00:00
Average standard deviation of split frequencies: 0.009371
985500 -- (-1169.330) (-1164.588) [-1160.935] (-1164.204) * (-1165.607) [-1162.434] (-1163.545) (-1162.752) -- 0:00:00
986000 -- (-1161.731) (-1161.474) (-1162.095) [-1163.389] * [-1162.965] (-1162.743) (-1161.829) (-1161.856) -- 0:00:00
986500 -- (-1163.195) (-1162.940) [-1163.288] (-1167.089) * [-1161.393] (-1163.096) (-1168.164) (-1165.000) -- 0:00:00
987000 -- (-1164.529) (-1165.352) [-1161.330] (-1162.094) * [-1161.120] (-1162.110) (-1162.831) (-1162.121) -- 0:00:00
987500 -- (-1165.846) [-1162.531] (-1162.604) (-1163.573) * (-1162.667) (-1165.094) [-1164.244] (-1162.321) -- 0:00:00
988000 -- (-1166.993) [-1161.742] (-1167.575) (-1164.078) * (-1164.552) (-1163.829) [-1161.903] (-1164.026) -- 0:00:00
988500 -- (-1163.757) [-1162.702] (-1163.343) (-1167.267) * (-1163.209) (-1162.677) [-1162.311] (-1162.908) -- 0:00:00
989000 -- (-1162.339) [-1165.031] (-1165.779) (-1162.499) * [-1161.395] (-1161.936) (-1165.728) (-1162.820) -- 0:00:00
989500 -- (-1165.812) (-1164.920) [-1161.474] (-1160.871) * (-1163.349) (-1162.459) [-1165.721] (-1163.407) -- 0:00:00
990000 -- (-1162.757) (-1165.235) (-1170.665) [-1163.942] * (-1164.825) [-1164.775] (-1165.252) (-1166.116) -- 0:00:00
Average standard deviation of split frequencies: 0.008565
990500 -- (-1164.407) (-1161.978) (-1175.140) [-1162.516] * (-1171.325) (-1165.042) (-1165.603) [-1162.093] -- 0:00:00
991000 -- (-1161.772) [-1161.527] (-1162.829) (-1162.888) * (-1169.412) [-1163.580] (-1162.993) (-1164.728) -- 0:00:00
991500 -- [-1161.331] (-1162.076) (-1161.456) (-1162.992) * [-1164.041] (-1161.354) (-1162.558) (-1164.930) -- 0:00:00
992000 -- (-1164.117) [-1162.138] (-1162.863) (-1162.786) * (-1161.840) (-1162.850) (-1162.505) [-1163.955] -- 0:00:00
992500 -- (-1163.257) [-1164.118] (-1163.314) (-1165.772) * (-1164.120) (-1165.907) (-1164.001) [-1162.691] -- 0:00:00
993000 -- (-1165.211) (-1162.980) (-1162.121) [-1162.764] * [-1163.001] (-1166.889) (-1161.498) (-1163.327) -- 0:00:00
993500 -- (-1162.771) (-1162.739) [-1161.319] (-1165.867) * (-1167.535) (-1165.252) [-1162.652] (-1162.375) -- 0:00:00
994000 -- (-1163.616) [-1163.318] (-1163.458) (-1163.180) * (-1162.146) (-1161.831) (-1162.867) [-1165.121] -- 0:00:00
994500 -- (-1165.171) (-1162.380) [-1165.637] (-1163.207) * (-1162.967) (-1163.593) (-1164.781) [-1163.700] -- 0:00:00
995000 -- [-1163.618] (-1164.671) (-1162.775) (-1161.891) * (-1164.242) (-1162.243) (-1162.046) [-1162.500] -- 0:00:00
Average standard deviation of split frequencies: 0.008519
995500 -- (-1163.362) (-1163.647) (-1161.340) [-1161.668] * (-1165.749) [-1161.647] (-1166.778) (-1163.399) -- 0:00:00
996000 -- (-1162.228) (-1169.476) (-1163.238) [-1167.125] * [-1164.498] (-1162.446) (-1163.505) (-1165.061) -- 0:00:00
996500 -- (-1166.262) (-1162.610) (-1161.536) [-1162.579] * (-1165.600) [-1162.146] (-1161.984) (-1163.538) -- 0:00:00
997000 -- (-1162.229) (-1161.722) [-1161.519] (-1162.107) * (-1161.376) [-1162.102] (-1164.549) (-1166.508) -- 0:00:00
997500 -- (-1163.419) (-1161.898) [-1161.100] (-1163.480) * (-1161.221) (-1161.895) [-1162.430] (-1166.665) -- 0:00:00
998000 -- (-1162.553) (-1165.503) [-1162.791] (-1161.718) * [-1163.025] (-1163.268) (-1162.465) (-1162.966) -- 0:00:00
998500 -- [-1162.094] (-1162.345) (-1163.830) (-1165.985) * [-1162.099] (-1162.299) (-1162.589) (-1162.211) -- 0:00:00
999000 -- [-1162.433] (-1162.179) (-1162.527) (-1162.819) * (-1163.264) (-1162.411) (-1163.819) [-1162.829] -- 0:00:00
999500 -- (-1162.267) [-1161.838] (-1164.155) (-1163.649) * [-1170.374] (-1162.491) (-1164.620) (-1164.562) -- 0:00:00
1000000 -- (-1161.669) [-1162.578] (-1162.072) (-1165.219) * [-1164.008] (-1165.457) (-1164.180) (-1164.855) -- 0:00:00
Average standard deviation of split frequencies: 0.008291
Analysis completed in 1 mins 1 seconds
Analysis used 59.62 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1160.69
Likelihood of best state for "cold" chain of run 2 was -1160.69
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 73 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
27.0 % ( 21 %) Dirichlet(Pi{all})
28.1 % ( 30 %) Slider(Pi{all})
78.2 % ( 47 %) Multiplier(Alpha{1,2})
78.6 % ( 52 %) Multiplier(Alpha{3})
19.8 % ( 22 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
98.3 % ( 97 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
85.2 % ( 76 %) ParsSPR(Tau{all},V{all})
28.1 % ( 17 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
31.5 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 61 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.4 % ( 25 %) Dirichlet(Pi{all})
28.8 % ( 28 %) Slider(Pi{all})
78.8 % ( 52 %) Multiplier(Alpha{1,2})
77.1 % ( 59 %) Multiplier(Alpha{3})
19.1 % ( 27 %) Slider(Pinvar{all})
98.7 % (100 %) ExtSPR(Tau{all},V{all})
98.2 % (100 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
85.1 % ( 84 %) ParsSPR(Tau{all},V{all})
28.1 % ( 35 %) Multiplier(V{all})
97.5 % ( 96 %) Nodeslider(V{all})
31.7 % ( 22 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.82 0.66 0.54
2 | 167194 0.83 0.69
3 | 166983 166707 0.85
4 | 166045 166441 166630
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.82 0.67 0.53
2 | 167240 0.84 0.69
3 | 166263 166210 0.85
4 | 166425 166200 167662
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1162.35
| 2 1 1 |
| 1 2 2 1 |
| 1 1 2 2 1 1 2 * 1 |
| 1 1 2 2 1 12 1|
| 2 1 1 2 2 11 1 21 21 * 2 *1 |
| *11 2 1 2 1 2 2 1 1 2 |
|1 22 12 1 111 1 22 1 22 2 2 |
| 1 2 1 1 2 1 1 1 1 2 2 1 1 2 |
| 22 2 2 2 1 2 1 1 2|
|2 2 1 2 ** 2 1 1 1 2 |
| 2 2 2 |
| 2 2 1 2 |
| 1 |
| |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1164.30
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1162.33 -1165.52
2 -1162.40 -1166.03
--------------------------------------
TOTAL -1162.37 -1165.81
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.688187 0.066248 0.230123 1.178556 0.657702 1306.22 1339.51 1.000
r(A<->C){all} 0.159915 0.019770 0.000044 0.456160 0.119830 104.29 149.12 1.000
r(A<->G){all} 0.165381 0.019143 0.000034 0.444742 0.129477 103.16 164.05 1.000
r(A<->T){all} 0.180801 0.023559 0.000234 0.493286 0.141023 180.98 212.59 1.000
r(C<->G){all} 0.167121 0.019787 0.000063 0.460460 0.130817 278.81 366.05 1.000
r(C<->T){all} 0.154248 0.017093 0.000229 0.420404 0.120064 167.80 196.69 1.000
r(G<->T){all} 0.172535 0.020277 0.000009 0.460672 0.133226 253.36 268.53 1.001
pi(A){all} 0.145984 0.000140 0.122438 0.169045 0.145779 1237.34 1297.96 1.000
pi(C){all} 0.279837 0.000236 0.249343 0.309717 0.279996 1233.80 1296.59 1.000
pi(G){all} 0.369117 0.000262 0.337559 0.401649 0.369124 816.17 1118.97 1.000
pi(T){all} 0.205063 0.000189 0.178691 0.232946 0.204807 972.59 1120.29 1.002
alpha{1,2} 0.411966 0.220457 0.000125 1.334582 0.256751 1182.93 1255.77 1.000
alpha{3} 0.454690 0.229474 0.000398 1.377105 0.285155 1279.47 1373.18 1.000
pinvar{all} 0.998262 0.000004 0.994455 0.999999 0.998934 1002.75 1191.29 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
Key to taxon bipartitions (saved to file "/data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------
1 -- .****
2 -- .*...
3 -- ..*..
4 -- ...*.
5 -- ....*
6 -- .*..*
7 -- ..**.
8 -- .*.**
9 -- .**..
10 -- .**.*
11 -- ..*.*
12 -- ...**
13 -- ..***
14 -- .***.
15 -- .*.*.
-----------
Summary statistics for informative taxon bipartitions
(saved to file "/data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
6 655 0.218188 0.010835 0.210526 0.225849 2
7 616 0.205197 0.001884 0.203864 0.206529 2
8 609 0.202865 0.009893 0.195869 0.209860 2
9 606 0.201865 0.001884 0.200533 0.203198 2
10 605 0.201532 0.008009 0.195869 0.207195 2
11 598 0.199201 0.007537 0.193871 0.204530 2
12 587 0.195536 0.013662 0.185876 0.205197 2
13 581 0.193538 0.005182 0.189873 0.197202 2
14 578 0.192538 0.014133 0.182545 0.202532 2
15 569 0.189540 0.009893 0.182545 0.196536 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098963 0.010200 0.000002 0.290887 0.069974 1.000 2
length{all}[2] 0.097070 0.009142 0.000004 0.291968 0.066653 1.000 2
length{all}[3] 0.097519 0.009915 0.000033 0.298732 0.066337 1.000 2
length{all}[4] 0.098105 0.009485 0.000018 0.297944 0.067117 1.000 2
length{all}[5] 0.098444 0.010181 0.000002 0.310658 0.066611 1.000 2
length{all}[6] 0.101092 0.008850 0.000204 0.293114 0.072474 0.999 2
length{all}[7] 0.102022 0.010331 0.000003 0.319043 0.069469 0.998 2
length{all}[8] 0.101566 0.010713 0.000437 0.303958 0.069112 1.004 2
length{all}[9] 0.096289 0.009431 0.000177 0.313318 0.062805 1.000 2
length{all}[10] 0.098187 0.010975 0.000157 0.297729 0.071047 0.999 2
length{all}[11] 0.099368 0.010043 0.000213 0.296349 0.066728 0.999 2
length{all}[12] 0.097131 0.009360 0.000083 0.294192 0.063023 1.002 2
length{all}[13] 0.099182 0.009008 0.000010 0.302657 0.071337 1.003 2
length{all}[14] 0.100302 0.010799 0.000307 0.312605 0.063135 0.999 2
length{all}[15] 0.094804 0.009020 0.000523 0.286749 0.066892 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008291
Maximum standard deviation of split frequencies = 0.014133
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
+------------------------------------------------------------------------ C3 (3)
|
|------------------------------------------------------------------------ C4 (4)
|
\------------------------------------------------------------------------ C5 (5)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
+-------------------------------------------------------------------- C3 (3)
|
|--------------------------------------------------------------------- C4 (4)
|
\--------------------------------------------------------------------- C5 (5)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (15 trees sampled):
50 % credible set contains 8 trees
90 % credible set contains 14 trees
95 % credible set contains 15 trees
99 % credible set contains 15 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 5 ls = 873
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Sequences read..
Counting site patterns.. 0:00
Compressing, 53 patterns at 291 / 291 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 53 patterns at 291 / 291 sites (100.0%), 0:00
Counting codons..
80 bytes for distance
51728 bytes for conP
4664 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5); MP score: 0
0.031073 0.101847 0.093310 0.030137 0.063190 0.300000 1.300000
ntime & nrate & np: 5 2 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 7
lnL0 = -1207.766985
Iterating by ming2
Initial: fx= 1207.766985
x= 0.03107 0.10185 0.09331 0.03014 0.06319 0.30000 1.30000
1 h-m-p 0.0000 0.0001 634.4001 ++ 1165.188305 m 0.0001 12 | 1/7
2 h-m-p 0.0017 0.0099 34.9853 ------------.. | 1/7
3 h-m-p 0.0000 0.0000 569.9726 ++ 1164.123881 m 0.0000 42 | 2/7
4 h-m-p 0.0001 0.0149 24.8501 ---------.. | 2/7
5 h-m-p 0.0000 0.0001 492.2829 ++ 1136.602352 m 0.0001 69 | 3/7
6 h-m-p 0.0025 0.0214 17.9755 ------------.. | 3/7
7 h-m-p 0.0000 0.0001 403.6729 ++ 1119.140052 m 0.0001 99 | 4/7
8 h-m-p 0.0034 0.0870 8.8526 ------------.. | 4/7
9 h-m-p 0.0000 0.0000 286.9822 ++ 1116.639399 m 0.0000 129 | 5/7
10 h-m-p 0.1442 8.0000 0.0000 +++ 1116.639399 m 8.0000 140 | 5/7
11 h-m-p 0.5076 8.0000 0.0000 --C 1116.639399 0 0.0079 154 | 5/7
12 h-m-p 0.0160 8.0000 0.0001 +++++ 1116.639399 m 8.0000 169 | 5/7
13 h-m-p 0.0035 1.2239 0.2497 ------C 1116.639399 0 0.0000 187 | 5/7
14 h-m-p 0.0160 8.0000 0.0000 Y 1116.639399 0 0.0040 199 | 5/7
15 h-m-p 0.0160 8.0000 0.0000 -------------.. | 5/7
16 h-m-p 0.0160 8.0000 0.0000 +++++ 1116.639399 m 8.0000 237 | 5/7
17 h-m-p 0.0052 2.5978 0.5341 +++++ 1116.639388 m 2.5978 252 | 6/7
18 h-m-p 0.3398 1.6988 0.4627 ++ 1116.639265 m 1.6988 264 | 7/7
19 h-m-p 0.0160 8.0000 0.0000 Y 1116.639265 0 0.0160 275
Out..
lnL = -1116.639265
276 lfun, 276 eigenQcodon, 1380 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5); MP score: 0
0.083287 0.075664 0.078222 0.102847 0.059258 0.000100 0.780040 0.174086
ntime & nrate & np: 5 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 13.684894
np = 8
lnL0 = -1223.844178
Iterating by ming2
Initial: fx= 1223.844178
x= 0.08329 0.07566 0.07822 0.10285 0.05926 0.00011 0.78004 0.17409
1 h-m-p 0.0000 0.0000 568.7714 ++ 1223.454773 m 0.0000 13 | 1/8
2 h-m-p 0.0000 0.0003 619.2879 +++ 1145.251508 m 0.0003 25 | 2/8
3 h-m-p 0.0000 0.0000 9071.8954 ++ 1142.450946 m 0.0000 36 | 3/8
4 h-m-p 0.0002 0.0046 24.2977 +++ 1142.094897 m 0.0046 48 | 4/8
5 h-m-p 0.0000 0.0001 1266.2745 ++ 1130.979020 m 0.0001 59 | 5/8
6 h-m-p 0.0004 0.0020 68.0877 ++ 1130.007717 m 0.0020 70 | 6/8
7 h-m-p 0.0013 0.0064 90.0838 -----------.. | 6/8
8 h-m-p 0.0000 0.0002 273.8115 +++ 1116.639355 m 0.0002 102 | 7/8
9 h-m-p 1.6000 8.0000 0.0000 ++ 1116.639355 m 8.0000 113 | 7/8
10 h-m-p 0.0160 8.0000 0.0000 +++++ 1116.639355 m 8.0000 128 | 7/8
11 h-m-p 0.0032 1.6200 0.3550 ---------Y 1116.639355 0 0.0000 149 | 7/8
12 h-m-p 0.0160 8.0000 0.0000 ----Y 1116.639355 0 0.0000 165 | 7/8
13 h-m-p 0.0160 8.0000 0.0000 ----Y 1116.639355 0 0.0000 181
Out..
lnL = -1116.639355
182 lfun, 546 eigenQcodon, 1820 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5); MP score: 0
initial w for M2:NSpselection reset.
0.018728 0.057117 0.037730 0.102821 0.045424 0.000100 0.983235 0.541060 0.165465 2.647954
ntime & nrate & np: 5 3 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 8.079546
np = 10
lnL0 = -1185.718446
Iterating by ming2
Initial: fx= 1185.718446
x= 0.01873 0.05712 0.03773 0.10282 0.04542 0.00011 0.98324 0.54106 0.16546 2.64795
1 h-m-p 0.0000 0.0000 547.6321 ++ 1184.826883 m 0.0000 15 | 1/10
2 h-m-p 0.0000 0.0013 133.6637 ++++ 1162.780732 m 0.0013 30 | 2/10
3 h-m-p 0.0001 0.0007 353.9191 ++ 1127.895709 m 0.0007 43 | 3/10
4 h-m-p 0.0002 0.0009 303.4510 ++ 1122.125875 m 0.0009 56 | 4/10
5 h-m-p 0.0000 0.0000 54249.5013 ++ 1120.855904 m 0.0000 69 | 5/10
6 h-m-p 0.0000 0.0000 23549.1933 ++ 1119.811258 m 0.0000 82 | 6/10
7 h-m-p 0.0000 0.0000 11262.4084 ++ 1116.639381 m 0.0000 95 | 7/10
8 h-m-p 1.6000 8.0000 0.0000 ++ 1116.639381 m 8.0000 108 | 7/10
9 h-m-p 0.0237 8.0000 0.0159 +++++ 1116.639379 m 8.0000 127 | 7/10
10 h-m-p 0.0597 2.7715 2.1308 -------------Y 1116.639379 0 0.0000 156 | 7/10
11 h-m-p 0.0160 8.0000 0.0001 +++++ 1116.639379 m 8.0000 172 | 7/10
12 h-m-p 0.0122 6.1217 1.1960 -------------.. | 7/10
13 h-m-p 0.0160 8.0000 0.0000 +++++ 1116.639379 m 8.0000 215 | 7/10
14 h-m-p 0.0160 8.0000 0.0228 +++++ 1116.639373 m 8.0000 234 | 7/10
15 h-m-p 0.0743 8.0000 2.4524 -------------Y 1116.639373 0 0.0000 263 | 7/10
16 h-m-p 0.0160 8.0000 0.0010 +++++ 1116.639372 m 8.0000 279 | 7/10
17 h-m-p 0.0160 8.0000 2.5418 -----------N 1116.639372 0 0.0000 306 | 7/10
18 h-m-p 0.0160 8.0000 0.0000 +++++ 1116.639372 m 8.0000 322 | 7/10
19 h-m-p 0.0160 8.0000 0.0695 +++++ 1116.639368 m 8.0000 341 | 7/10
20 h-m-p 0.1431 8.0000 3.8854 ------------N 1116.639368 0 0.0000 369 | 7/10
21 h-m-p 0.0160 8.0000 0.0000 -C 1116.639368 0 0.0010 383 | 7/10
22 h-m-p 0.0160 8.0000 0.0000 +++++ 1116.639368 m 8.0000 402 | 7/10
23 h-m-p 0.0005 0.2477 9.5948 +++++ 1116.639320 m 0.2477 421 | 8/10
24 h-m-p 0.2234 8.0000 2.1521 +++ 1116.639265 m 8.0000 435 | 8/10
25 h-m-p 1.6000 8.0000 0.0000 N 1116.639265 0 1.6000 448
Out..
lnL = -1116.639265
449 lfun, 1796 eigenQcodon, 6735 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1116.673725 S = -1116.639960 -0.012993
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:03
did 20 / 53 patterns 0:03
did 30 / 53 patterns 0:03
did 40 / 53 patterns 0:03
did 50 / 53 patterns 0:03
did 53 / 53 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5); MP score: 0
0.062556 0.087254 0.088722 0.043144 0.105859 0.000100 0.940972 1.208154
ntime & nrate & np: 5 1 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 12.378422
np = 8
lnL0 = -1222.987646
Iterating by ming2
Initial: fx= 1222.987646
x= 0.06256 0.08725 0.08872 0.04314 0.10586 0.00011 0.94097 1.20815
1 h-m-p 0.0000 0.0000 591.2857 ++ 1222.449095 m 0.0000 13 | 1/8
2 h-m-p 0.0000 0.0131 72.6977 +++++ 1172.242959 m 0.0131 27 | 2/8
3 h-m-p 0.0000 0.0001 1325.4493 ++ 1134.156742 m 0.0001 38 | 3/8
4 h-m-p 0.0023 0.0154 66.8886 +
QuantileBeta(0.15, 0.00500, 2.55043) = 9.943587e-161 2000 rounds
+ 1130.703960 m 0.0154 49
QuantileBeta(0.15, 0.00500, 2.55043) = 9.943587e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55043) = 9.943587e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55043) = 9.943587e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55043) = 9.943587e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55043) = 9.943587e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55043) = 9.943587e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55043) = 1.029071e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55043) = 9.943579e-161 2000 rounds
| 4/8
5 h-m-p 0.0000 0.0001 1650.5914
QuantileBeta(0.15, 0.00500, 2.50186) = 1.017995e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35616) = 1.096090e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.30759) = 1.124825e-160 2000 rounds
+ 1121.831651 m 0.0001 60
QuantileBeta(0.15, 0.00500, 2.30759) = 1.124825e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30759) = 1.124825e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30759) = 1.124825e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30759) = 1.124825e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30759) = 1.124825e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30759) = 1.124825e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30759) = 1.164092e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30759) = 1.124824e-160 2000 rounds
| 5/8
6 h-m-p 0.0001 0.0007 72.2274
QuantileBeta(0.15, 0.00500, 2.31676) = 1.119286e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.34427) = 1.102989e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
+ 1121.770939 m 0.0007 71
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.135980e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097660e-160 2000 rounds
| 6/8
7 h-m-p 0.0160 8.0000 4.1158
QuantileBeta(0.15, 0.00500, 2.41740) = 1.061867e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36943) = 1.088490e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.35744) = 1.095354e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.35444) = 1.097083e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.35369) = 1.097516e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.35350) = 1.097625e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.35346) = 1.097652e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097658e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097660e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097660e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.135980e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097660e-160 2000 rounds
| 6/8
8 h-m-p 0.0000 0.0001 275.6370
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
+ 1116.639265 m 0.0001 104
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.135980e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097660e-160 2000 rounds
| 7/8
9 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
N 1116.639265 0 0.4000 115
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.135980e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35357) = 1.097588e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35331) = 1.097733e-160 2000 rounds
| 7/8
10 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
N 1116.639265 0 1.6000 127
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
Out..
lnL = -1116.639265
128 lfun, 1408 eigenQcodon, 6400 P(t)
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35344) = 1.097661e-160 2000 rounds
Time used: 0:05
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.010213 0.092761 0.045115 0.041972 0.058367 0.000100 0.900000 0.759407 1.705206 2.842564
ntime & nrate & np: 5 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 10.824931
np = 10
lnL0 = -1181.120508
Iterating by ming2
Initial: fx= 1181.120508
x= 0.01021 0.09276 0.04511 0.04197 0.05837 0.00011 0.90000 0.75941 1.70521 2.84256
1 h-m-p 0.0000 0.0000 536.8695 ++ 1180.460483 m 0.0000 15 | 1/10
2 h-m-p 0.0000 0.0001 340.0497 ++ 1167.674065 m 0.0001 28 | 2/10
3 h-m-p 0.0001 0.0003 211.3608 ++ 1135.210214 m 0.0003 41 | 3/10
4 h-m-p 0.0021 0.0172 31.1926 ++ 1121.411395 m 0.0172 54 | 4/10
5 h-m-p 0.0000 0.0000 5417.4966 ++ 1119.068311 m 0.0000 67 | 5/10
6 h-m-p 0.0000 0.0000 318237.9504 ++ 1118.696669 m 0.0000 80 | 6/10
7 h-m-p 0.0020 0.0262 55.6136 ------------.. | 6/10
8 h-m-p 0.0000 0.0000 282.4307 ++ 1116.639387 m 0.0000 116 | 7/10
9 h-m-p 0.2605 8.0000 0.0000 +++ 1116.639387 m 8.0000 130 | 7/10
10 h-m-p 0.0164 8.0000 0.0044 ----Y 1116.639387 0 0.0000 150 | 7/10
11 h-m-p 0.0160 8.0000 0.0004 ----Y 1116.639387 0 0.0000 170 | 7/10
12 h-m-p 0.0160 8.0000 0.0001 +++++ 1116.639387 m 8.0000 189 | 7/10
13 h-m-p 0.0160 8.0000 0.8978 --------Y 1116.639387 0 0.0000 213 | 7/10
14 h-m-p 0.0160 8.0000 0.0001 ----N 1116.639387 0 0.0000 233 | 7/10
15 h-m-p 0.0160 8.0000 0.0000 +++++ 1116.639387 m 8.0000 252 | 7/10
16 h-m-p 0.0003 0.1440 16.3077 ++++
QuantileBeta(0.15, 0.00500, 2.25105) = 1.160216e-160 2000 rounds
+ 1116.639341 m 0.1440 271
QuantileBeta(0.15, 0.00500, 2.25105) = 1.160216e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25105) = 1.160216e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25105) = 1.160216e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25105) = 1.160216e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25105) = 1.160216e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25105) = 1.160216e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25105) = 1.160216e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25105) = 1.200719e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25105) = 1.160215e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25105) = 1.160216e-160 2000 rounds
| 8/10
17 h-m-p 0.0056 0.0465 44.8706 ++ 1116.639265 m 0.0465 284 | 9/10
18 h-m-p 1.0243 8.0000 2.0170
QuantileBeta(0.15, 0.00500, 2.25105) = 1.160216e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 8.44916) = 2.590044e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 16.32120) = 1.302178e-161 2000 rounds
+ 1116.639265 m 8.0000 297
QuantileBeta(0.15, 0.00500, 16.32120) = 1.302178e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.32120) = 1.302178e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.32120) = 1.302178e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.32120) = 1.302178e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.32120) = 1.302178e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.32120) = 1.302178e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.32120) = 1.302178e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.32120) = 1.347636e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.32121) = 1.302177e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.32120) = 1.302178e-161 2000 rounds
| 9/10
19 h-m-p 1.6000 8.0000 0.0739
QuantileBeta(0.15, 0.00500, 16.43949) = 1.292518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.79437) = 1.264381e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 16.91267) = 1.255273e-161 2000 rounds
+ 1116.639265 m 8.0000 310
QuantileBeta(0.15, 0.00500, 16.91267) = 1.255273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.91267) = 1.255273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.91267) = 1.255273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.91267) = 1.255273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.91267) = 1.255273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.91267) = 1.255273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.91267) = 1.255273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.91267) = 1.299094e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.91305) = 1.255243e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.91228) = 1.255302e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.91267) = 1.255273e-161 2000 rounds
| 9/10
20 h-m-p 1.6000 8.0000 0.0060
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.95121) = 1.252333e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.92622) = 1.254238e-161 2000 rounds
C 1116.639265 0 1.6000 324
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.92230) = 1.298332e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.92269) = 1.254507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.92192) = 1.254566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
| 9/10
21 h-m-p 1.5002 8.0000 0.0064
QuantileBeta(0.15, 0.00500, 16.91267) = 1.255273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.91989) = 1.254720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.92170) = 1.254582e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.92215) = 1.254548e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.92227) = 1.254539e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.92229) = 1.254537e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254537e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.92230) = 1.298332e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.92269) = 1.254507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.92192) = 1.254566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
| 9/10
22 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
Y 1116.639265 0 0.0160 366
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
Out..
lnL = -1116.639265
367 lfun, 4404 eigenQcodon, 20185 P(t)
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1116.683922 S = -1116.639960 -0.019454
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:12
did 20 / 53 patterns 0:12
did 30 / 53 patterns 0:12
did 40 / 53 patterns 0:12
did 50 / 53 patterns 0:12
did 53 / 53 patterns 0:12
QuantileBeta(0.15, 0.00500, 16.92230) = 1.254536e-161 2000 rounds
Time used: 0:12
CodeML output code: -1