--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:26:23 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/suhB/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1162.33         -1165.52
2      -1162.40         -1166.03
--------------------------------------
TOTAL    -1162.37         -1165.81
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.688187    0.066248    0.230123    1.178556    0.657702   1306.22   1339.51    1.000
r(A<->C){all}   0.159915    0.019770    0.000044    0.456160    0.119830    104.29    149.12    1.000
r(A<->G){all}   0.165381    0.019143    0.000034    0.444742    0.129477    103.16    164.05    1.000
r(A<->T){all}   0.180801    0.023559    0.000234    0.493286    0.141023    180.98    212.59    1.000
r(C<->G){all}   0.167121    0.019787    0.000063    0.460460    0.130817    278.81    366.05    1.000
r(C<->T){all}   0.154248    0.017093    0.000229    0.420404    0.120064    167.80    196.69    1.000
r(G<->T){all}   0.172535    0.020277    0.000009    0.460672    0.133226    253.36    268.53    1.001
pi(A){all}      0.145984    0.000140    0.122438    0.169045    0.145779   1237.34   1297.96    1.000
pi(C){all}      0.279837    0.000236    0.249343    0.309717    0.279996   1233.80   1296.59    1.000
pi(G){all}      0.369117    0.000262    0.337559    0.401649    0.369124    816.17   1118.97    1.000
pi(T){all}      0.205063    0.000189    0.178691    0.232946    0.204807    972.59   1120.29    1.002
alpha{1,2}      0.411966    0.220457    0.000125    1.334582    0.256751   1182.93   1255.77    1.000
alpha{3}        0.454690    0.229474    0.000398    1.377105    0.285155   1279.47   1373.18    1.000
pinvar{all}     0.998262    0.000004    0.994455    0.999999    0.998934   1002.75   1191.29    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1116.639355
Model 2: PositiveSelection	-1116.639265
Model 0: one-ratio	-1116.639265
Model 7: beta	-1116.639265
Model 8: beta&w>1	-1116.639265


Model 0 vs 1	1.8000000000029104E-4

Model 2 vs 1	1.8000000000029104E-4

Model 8 vs 7	0.0
>C1
VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
>C2
VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
>C3
VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
>C4
VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
>C5
VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=291 

C1              VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
C2              VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
C3              VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
C4              VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
C5              VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
                **************************************************

C1              TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
C2              TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
C3              TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
C4              TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
C5              TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
                **************************************************

C1              WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
C2              WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
C3              WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
C4              WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
C5              WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
                **************************************************

C1              LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
C2              LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
C3              LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
C4              LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
C5              LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
                **************************************************

C1              VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
C2              VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
C3              VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
C4              VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
C5              VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
                **************************************************

C1              QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
C2              QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
C3              QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
C4              QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
C5              QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
                *****************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  291 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  291 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5820]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [5820]--->[5820]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.436 Mb, Max= 30.730 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
C2              VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
C3              VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
C4              VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
C5              VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
                **************************************************

C1              TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
C2              TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
C3              TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
C4              TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
C5              TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
                **************************************************

C1              WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
C2              WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
C3              WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
C4              WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
C5              WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
                **************************************************

C1              LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
C2              LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
C3              LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
C4              LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
C5              LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
                **************************************************

C1              VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
C2              VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
C3              VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
C4              VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
C5              VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
                **************************************************

C1              QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
C2              QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
C3              QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
C4              QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
C5              QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
                *****************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGACAGTACCTGACAACGATCCCGAGCAGCTGCGCTGCGTAGCCGAATC
C2              GTGACAGTACCTGACAACGATCCCGAGCAGCTGCGCTGCGTAGCCGAATC
C3              GTGACAGTACCTGACAACGATCCCGAGCAGCTGCGCTGCGTAGCCGAATC
C4              GTGACAGTACCTGACAACGATCCCGAGCAGCTGCGCTGCGTAGCCGAATC
C5              GTGACAGTACCTGACAACGATCCCGAGCAGCTGCGCTGCGTAGCCGAATC
                **************************************************

C1              ACTGGCCACTGAGGCCGCCGCGTTCGTGCGATGTCGCCGAGCTGAGGTGT
C2              ACTGGCCACTGAGGCCGCCGCGTTCGTGCGATGTCGCCGAGCTGAGGTGT
C3              ACTGGCCACTGAGGCCGCCGCGTTCGTGCGATGTCGCCGAGCTGAGGTGT
C4              ACTGGCCACTGAGGCCGCCGCGTTCGTGCGATGTCGCCGAGCTGAGGTGT
C5              ACTGGCCACTGAGGCCGCCGCGTTCGTGCGATGTCGCCGAGCTGAGGTGT
                **************************************************

C1              TTGGTACTGACCTGGGCGCCGCAGGCGGCGGCGCGGTACGGGCGAAGAGT
C2              TTGGTACTGACCTGGGCGCCGCAGGCGGCGGCGCGGTACGGGCGAAGAGT
C3              TTGGTACTGACCTGGGCGCCGCAGGCGGCGGCGCGGTACGGGCGAAGAGT
C4              TTGGTACTGACCTGGGCGCCGCAGGCGGCGGCGCGGTACGGGCGAAGAGT
C5              TTGGTACTGACCTGGGCGCCGCAGGCGGCGGCGCGGTACGGGCGAAGAGT
                **************************************************

C1              ACCCCGACCGATCCGGTGACTGTCGTTGACACCGAGACAGAACGCTTGTT
C2              ACCCCGACCGATCCGGTGACTGTCGTTGACACCGAGACAGAACGCTTGTT
C3              ACCCCGACCGATCCGGTGACTGTCGTTGACACCGAGACAGAACGCTTGTT
C4              ACCCCGACCGATCCGGTGACTGTCGTTGACACCGAGACAGAACGCTTGTT
C5              ACCCCGACCGATCCGGTGACTGTCGTTGACACCGAGACAGAACGCTTGTT
                **************************************************

C1              GCGTGATCGGCTCGCTCAACTACGGCCCGGTGACTCGATCCTTGGGGAGG
C2              GCGTGATCGGCTCGCTCAACTACGGCCCGGTGACTCGATCCTTGGGGAGG
C3              GCGTGATCGGCTCGCTCAACTACGGCCCGGTGACTCGATCCTTGGGGAGG
C4              GCGTGATCGGCTCGCTCAACTACGGCCCGGTGACTCGATCCTTGGGGAGG
C5              GCGTGATCGGCTCGCTCAACTACGGCCCGGTGACTCGATCCTTGGGGAGG
                **************************************************

C1              AGGGGGGTGGGCCCGCCGATCTGACCGCCACGCCTGCAGACACGGTAACC
C2              AGGGGGGTGGGCCCGCCGATCTGACCGCCACGCCTGCAGACACGGTAACC
C3              AGGGGGGTGGGCCCGCCGATCTGACCGCCACGCCTGCAGACACGGTAACC
C4              AGGGGGGTGGGCCCGCCGATCTGACCGCCACGCCTGCAGACACGGTAACC
C5              AGGGGGGTGGGCCCGCCGATCTGACCGCCACGCCTGCAGACACGGTAACC
                **************************************************

C1              TGGGTGCTTGACCCCATCGATGGCACGGTGAACTTTGTCTACGGCATCCC
C2              TGGGTGCTTGACCCCATCGATGGCACGGTGAACTTTGTCTACGGCATCCC
C3              TGGGTGCTTGACCCCATCGATGGCACGGTGAACTTTGTCTACGGCATCCC
C4              TGGGTGCTTGACCCCATCGATGGCACGGTGAACTTTGTCTACGGCATCCC
C5              TGGGTGCTTGACCCCATCGATGGCACGGTGAACTTTGTCTACGGCATCCC
                **************************************************

C1              GGCTTACGCGGTGTCGGTCGCAGCTCAGGTTGATGGCGTGTCAGTGGCCG
C2              GGCTTACGCGGTGTCGGTCGCAGCTCAGGTTGATGGCGTGTCAGTGGCCG
C3              GGCTTACGCGGTGTCGGTCGCAGCTCAGGTTGATGGCGTGTCAGTGGCCG
C4              GGCTTACGCGGTGTCGGTCGCAGCTCAGGTTGATGGCGTGTCAGTGGCCG
C5              GGCTTACGCGGTGTCGGTCGCAGCTCAGGTTGATGGCGTGTCAGTGGCCG
                **************************************************

C1              GCGCGGTTGCTGAAGTTGTTGCCGGTCGGGTGCACTCGGCGGCGAGCGGC
C2              GCGCGGTTGCTGAAGTTGTTGCCGGTCGGGTGCACTCGGCGGCGAGCGGC
C3              GCGCGGTTGCTGAAGTTGTTGCCGGTCGGGTGCACTCGGCGGCGAGCGGC
C4              GCGCGGTTGCTGAAGTTGTTGCCGGTCGGGTGCACTCGGCGGCGAGCGGC
C5              GCGCGGTTGCTGAAGTTGTTGCCGGTCGGGTGCACTCGGCGGCGAGCGGC
                **************************************************

C1              CTCGGCGCGCATGTCACCGACGAGTATGGTGTACAGGTACTGAGATGCAG
C2              CTCGGCGCGCATGTCACCGACGAGTATGGTGTACAGGTACTGAGATGCAG
C3              CTCGGCGCGCATGTCACCGACGAGTATGGTGTACAGGTACTGAGATGCAG
C4              CTCGGCGCGCATGTCACCGACGAGTATGGTGTACAGGTACTGAGATGCAG
C5              CTCGGCGCGCATGTCACCGACGAGTATGGTGTACAGGTACTGAGATGCAG
                **************************************************

C1              CGCAGTCGATGACTTGTCGATGGCGCTGCTAGGTACTGGCTTTGCCTATT
C2              CGCAGTCGATGACTTGTCGATGGCGCTGCTAGGTACTGGCTTTGCCTATT
C3              CGCAGTCGATGACTTGTCGATGGCGCTGCTAGGTACTGGCTTTGCCTATT
C4              CGCAGTCGATGACTTGTCGATGGCGCTGCTAGGTACTGGCTTTGCCTATT
C5              CGCAGTCGATGACTTGTCGATGGCGCTGCTAGGTACTGGCTTTGCCTATT
                **************************************************

C1              CGGTAGTGCGCCGCGCCGCCCAGGCGGCGCTGTTGGCCCAGATGCTGCCG
C2              CGGTAGTGCGCCGCGCCGCCCAGGCGGCGCTGTTGGCCCAGATGCTGCCG
C3              CGGTAGTGCGCCGCGCCGCCCAGGCGGCGCTGTTGGCCCAGATGCTGCCG
C4              CGGTAGTGCGCCGCGCCGCCCAGGCGGCGCTGTTGGCCCAGATGCTGCCG
C5              CGGTAGTGCGCCGCGCCGCCCAGGCGGCGCTGTTGGCCCAGATGCTGCCG
                **************************************************

C1              GTGGTACGTGATGTACGTCGCATCGGTTCGGCCGCGTTAGACCTTTGCAT
C2              GTGGTACGTGATGTACGTCGCATCGGTTCGGCCGCGTTAGACCTTTGCAT
C3              GTGGTACGTGATGTACGTCGCATCGGTTCGGCCGCGTTAGACCTTTGCAT
C4              GTGGTACGTGATGTACGTCGCATCGGTTCGGCCGCGTTAGACCTTTGCAT
C5              GTGGTACGTGATGTACGTCGCATCGGTTCGGCCGCGTTAGACCTTTGCAT
                **************************************************

C1              GGTTGCGGCGGGCCAGTTGGATGCTTATTACGAGCATGAGGTGCAGGTGT
C2              GGTTGCGGCGGGCCAGTTGGATGCTTATTACGAGCATGAGGTGCAGGTGT
C3              GGTTGCGGCGGGCCAGTTGGATGCTTATTACGAGCATGAGGTGCAGGTGT
C4              GGTTGCGGCGGGCCAGTTGGATGCTTATTACGAGCATGAGGTGCAGGTGT
C5              GGTTGCGGCGGGCCAGTTGGATGCTTATTACGAGCATGAGGTGCAGGTGT
                **************************************************

C1              GGGATTGCGCGGCTGGCGCGTTGATCGCGGCGGAAGCGGGGGCCTGTGTG
C2              GGGATTGCGCGGCTGGCGCGTTGATCGCGGCGGAAGCGGGGGCCTGTGTG
C3              GGGATTGCGCGGCTGGCGCGTTGATCGCGGCGGAAGCGGGGGCCTGTGTG
C4              GGGATTGCGCGGCTGGCGCGTTGATCGCGGCGGAAGCGGGGGCCTGTGTG
C5              GGGATTGCGCGGCTGGCGCGTTGATCGCGGCGGAAGCGGGGGCCTGTGTG
                **************************************************

C1              CAGTTGCCTAAGCGGAACGGGCCCGTGGGCGGTGCCGGATTGGTGGTAGC
C2              CAGTTGCCTAAGCGGAACGGGCCCGTGGGCGGTGCCGGATTGGTGGTAGC
C3              CAGTTGCCTAAGCGGAACGGGCCCGTGGGCGGTGCCGGATTGGTGGTAGC
C4              CAGTTGCCTAAGCGGAACGGGCCCGTGGGCGGTGCCGGATTGGTGGTAGC
C5              CAGTTGCCTAAGCGGAACGGGCCCGTGGGCGGTGCCGGATTGGTGGTAGC
                **************************************************

C1              TGCCGCGCCTGGAATCGCCGACGCATTGTTGGCTGCCTTGCAGCGATTCA
C2              TGCCGCGCCTGGAATCGCCGACGCATTGTTGGCTGCCTTGCAGCGATTCA
C3              TGCCGCGCCTGGAATCGCCGACGCATTGTTGGCTGCCTTGCAGCGATTCA
C4              TGCCGCGCCTGGAATCGCCGACGCATTGTTGGCTGCCTTGCAGCGATTCA
C5              TGCCGCGCCTGGAATCGCCGACGCATTGTTGGCTGCCTTGCAGCGATTCA
                **************************************************

C1              ACGGCCTGGCGCCGATCCTGGAC
C2              ACGGCCTGGCGCCGATCCTGGAC
C3              ACGGCCTGGCGCCGATCCTGGAC
C4              ACGGCCTGGCGCCGATCCTGGAC
C5              ACGGCCTGGCGCCGATCCTGGAC
                ***********************



>C1
GTGACAGTACCTGACAACGATCCCGAGCAGCTGCGCTGCGTAGCCGAATC
ACTGGCCACTGAGGCCGCCGCGTTCGTGCGATGTCGCCGAGCTGAGGTGT
TTGGTACTGACCTGGGCGCCGCAGGCGGCGGCGCGGTACGGGCGAAGAGT
ACCCCGACCGATCCGGTGACTGTCGTTGACACCGAGACAGAACGCTTGTT
GCGTGATCGGCTCGCTCAACTACGGCCCGGTGACTCGATCCTTGGGGAGG
AGGGGGGTGGGCCCGCCGATCTGACCGCCACGCCTGCAGACACGGTAACC
TGGGTGCTTGACCCCATCGATGGCACGGTGAACTTTGTCTACGGCATCCC
GGCTTACGCGGTGTCGGTCGCAGCTCAGGTTGATGGCGTGTCAGTGGCCG
GCGCGGTTGCTGAAGTTGTTGCCGGTCGGGTGCACTCGGCGGCGAGCGGC
CTCGGCGCGCATGTCACCGACGAGTATGGTGTACAGGTACTGAGATGCAG
CGCAGTCGATGACTTGTCGATGGCGCTGCTAGGTACTGGCTTTGCCTATT
CGGTAGTGCGCCGCGCCGCCCAGGCGGCGCTGTTGGCCCAGATGCTGCCG
GTGGTACGTGATGTACGTCGCATCGGTTCGGCCGCGTTAGACCTTTGCAT
GGTTGCGGCGGGCCAGTTGGATGCTTATTACGAGCATGAGGTGCAGGTGT
GGGATTGCGCGGCTGGCGCGTTGATCGCGGCGGAAGCGGGGGCCTGTGTG
CAGTTGCCTAAGCGGAACGGGCCCGTGGGCGGTGCCGGATTGGTGGTAGC
TGCCGCGCCTGGAATCGCCGACGCATTGTTGGCTGCCTTGCAGCGATTCA
ACGGCCTGGCGCCGATCCTGGAC
>C2
GTGACAGTACCTGACAACGATCCCGAGCAGCTGCGCTGCGTAGCCGAATC
ACTGGCCACTGAGGCCGCCGCGTTCGTGCGATGTCGCCGAGCTGAGGTGT
TTGGTACTGACCTGGGCGCCGCAGGCGGCGGCGCGGTACGGGCGAAGAGT
ACCCCGACCGATCCGGTGACTGTCGTTGACACCGAGACAGAACGCTTGTT
GCGTGATCGGCTCGCTCAACTACGGCCCGGTGACTCGATCCTTGGGGAGG
AGGGGGGTGGGCCCGCCGATCTGACCGCCACGCCTGCAGACACGGTAACC
TGGGTGCTTGACCCCATCGATGGCACGGTGAACTTTGTCTACGGCATCCC
GGCTTACGCGGTGTCGGTCGCAGCTCAGGTTGATGGCGTGTCAGTGGCCG
GCGCGGTTGCTGAAGTTGTTGCCGGTCGGGTGCACTCGGCGGCGAGCGGC
CTCGGCGCGCATGTCACCGACGAGTATGGTGTACAGGTACTGAGATGCAG
CGCAGTCGATGACTTGTCGATGGCGCTGCTAGGTACTGGCTTTGCCTATT
CGGTAGTGCGCCGCGCCGCCCAGGCGGCGCTGTTGGCCCAGATGCTGCCG
GTGGTACGTGATGTACGTCGCATCGGTTCGGCCGCGTTAGACCTTTGCAT
GGTTGCGGCGGGCCAGTTGGATGCTTATTACGAGCATGAGGTGCAGGTGT
GGGATTGCGCGGCTGGCGCGTTGATCGCGGCGGAAGCGGGGGCCTGTGTG
CAGTTGCCTAAGCGGAACGGGCCCGTGGGCGGTGCCGGATTGGTGGTAGC
TGCCGCGCCTGGAATCGCCGACGCATTGTTGGCTGCCTTGCAGCGATTCA
ACGGCCTGGCGCCGATCCTGGAC
>C3
GTGACAGTACCTGACAACGATCCCGAGCAGCTGCGCTGCGTAGCCGAATC
ACTGGCCACTGAGGCCGCCGCGTTCGTGCGATGTCGCCGAGCTGAGGTGT
TTGGTACTGACCTGGGCGCCGCAGGCGGCGGCGCGGTACGGGCGAAGAGT
ACCCCGACCGATCCGGTGACTGTCGTTGACACCGAGACAGAACGCTTGTT
GCGTGATCGGCTCGCTCAACTACGGCCCGGTGACTCGATCCTTGGGGAGG
AGGGGGGTGGGCCCGCCGATCTGACCGCCACGCCTGCAGACACGGTAACC
TGGGTGCTTGACCCCATCGATGGCACGGTGAACTTTGTCTACGGCATCCC
GGCTTACGCGGTGTCGGTCGCAGCTCAGGTTGATGGCGTGTCAGTGGCCG
GCGCGGTTGCTGAAGTTGTTGCCGGTCGGGTGCACTCGGCGGCGAGCGGC
CTCGGCGCGCATGTCACCGACGAGTATGGTGTACAGGTACTGAGATGCAG
CGCAGTCGATGACTTGTCGATGGCGCTGCTAGGTACTGGCTTTGCCTATT
CGGTAGTGCGCCGCGCCGCCCAGGCGGCGCTGTTGGCCCAGATGCTGCCG
GTGGTACGTGATGTACGTCGCATCGGTTCGGCCGCGTTAGACCTTTGCAT
GGTTGCGGCGGGCCAGTTGGATGCTTATTACGAGCATGAGGTGCAGGTGT
GGGATTGCGCGGCTGGCGCGTTGATCGCGGCGGAAGCGGGGGCCTGTGTG
CAGTTGCCTAAGCGGAACGGGCCCGTGGGCGGTGCCGGATTGGTGGTAGC
TGCCGCGCCTGGAATCGCCGACGCATTGTTGGCTGCCTTGCAGCGATTCA
ACGGCCTGGCGCCGATCCTGGAC
>C4
GTGACAGTACCTGACAACGATCCCGAGCAGCTGCGCTGCGTAGCCGAATC
ACTGGCCACTGAGGCCGCCGCGTTCGTGCGATGTCGCCGAGCTGAGGTGT
TTGGTACTGACCTGGGCGCCGCAGGCGGCGGCGCGGTACGGGCGAAGAGT
ACCCCGACCGATCCGGTGACTGTCGTTGACACCGAGACAGAACGCTTGTT
GCGTGATCGGCTCGCTCAACTACGGCCCGGTGACTCGATCCTTGGGGAGG
AGGGGGGTGGGCCCGCCGATCTGACCGCCACGCCTGCAGACACGGTAACC
TGGGTGCTTGACCCCATCGATGGCACGGTGAACTTTGTCTACGGCATCCC
GGCTTACGCGGTGTCGGTCGCAGCTCAGGTTGATGGCGTGTCAGTGGCCG
GCGCGGTTGCTGAAGTTGTTGCCGGTCGGGTGCACTCGGCGGCGAGCGGC
CTCGGCGCGCATGTCACCGACGAGTATGGTGTACAGGTACTGAGATGCAG
CGCAGTCGATGACTTGTCGATGGCGCTGCTAGGTACTGGCTTTGCCTATT
CGGTAGTGCGCCGCGCCGCCCAGGCGGCGCTGTTGGCCCAGATGCTGCCG
GTGGTACGTGATGTACGTCGCATCGGTTCGGCCGCGTTAGACCTTTGCAT
GGTTGCGGCGGGCCAGTTGGATGCTTATTACGAGCATGAGGTGCAGGTGT
GGGATTGCGCGGCTGGCGCGTTGATCGCGGCGGAAGCGGGGGCCTGTGTG
CAGTTGCCTAAGCGGAACGGGCCCGTGGGCGGTGCCGGATTGGTGGTAGC
TGCCGCGCCTGGAATCGCCGACGCATTGTTGGCTGCCTTGCAGCGATTCA
ACGGCCTGGCGCCGATCCTGGAC
>C5
GTGACAGTACCTGACAACGATCCCGAGCAGCTGCGCTGCGTAGCCGAATC
ACTGGCCACTGAGGCCGCCGCGTTCGTGCGATGTCGCCGAGCTGAGGTGT
TTGGTACTGACCTGGGCGCCGCAGGCGGCGGCGCGGTACGGGCGAAGAGT
ACCCCGACCGATCCGGTGACTGTCGTTGACACCGAGACAGAACGCTTGTT
GCGTGATCGGCTCGCTCAACTACGGCCCGGTGACTCGATCCTTGGGGAGG
AGGGGGGTGGGCCCGCCGATCTGACCGCCACGCCTGCAGACACGGTAACC
TGGGTGCTTGACCCCATCGATGGCACGGTGAACTTTGTCTACGGCATCCC
GGCTTACGCGGTGTCGGTCGCAGCTCAGGTTGATGGCGTGTCAGTGGCCG
GCGCGGTTGCTGAAGTTGTTGCCGGTCGGGTGCACTCGGCGGCGAGCGGC
CTCGGCGCGCATGTCACCGACGAGTATGGTGTACAGGTACTGAGATGCAG
CGCAGTCGATGACTTGTCGATGGCGCTGCTAGGTACTGGCTTTGCCTATT
CGGTAGTGCGCCGCGCCGCCCAGGCGGCGCTGTTGGCCCAGATGCTGCCG
GTGGTACGTGATGTACGTCGCATCGGTTCGGCCGCGTTAGACCTTTGCAT
GGTTGCGGCGGGCCAGTTGGATGCTTATTACGAGCATGAGGTGCAGGTGT
GGGATTGCGCGGCTGGCGCGTTGATCGCGGCGGAAGCGGGGGCCTGTGTG
CAGTTGCCTAAGCGGAACGGGCCCGTGGGCGGTGCCGGATTGGTGGTAGC
TGCCGCGCCTGGAATCGCCGACGCATTGTTGGCTGCCTTGCAGCGATTCA
ACGGCCTGGCGCCGATCCTGGAC
>C1
VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
>C2
VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
>C3
VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
>C4
VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD
>C5
VTVPDNDPEQLRCVAESLATEAAAFVRCRRAEVFGTDLGAAGGGAVRAKS
TPTDPVTVVDTETERLLRDRLAQLRPGDSILGEEGGGPADLTATPADTVT
WVLDPIDGTVNFVYGIPAYAVSVAAQVDGVSVAGAVAEVVAGRVHSAASG
LGAHVTDEYGVQVLRCSAVDDLSMALLGTGFAYSVVRRAAQAALLAQMLP
VVRDVRRIGSAALDLCMVAAGQLDAYYEHEVQVWDCAAGALIAAEAGACV
QLPKRNGPVGGAGLVVAAAPGIADALLAALQRFNGLAPILD


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 873 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579789508
      Setting output file names to "/data/12res/suhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1753337395
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0612821072
      Seed = 331407421
      Swapseed = 1579789508
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1793.140691 -- -25.624409
         Chain 2 -- -1793.140691 -- -25.624409
         Chain 3 -- -1793.140691 -- -25.624409
         Chain 4 -- -1793.140691 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1793.140755 -- -25.624409
         Chain 2 -- -1793.140691 -- -25.624409
         Chain 3 -- -1793.140691 -- -25.624409
         Chain 4 -- -1793.140691 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1793.141] (-1793.141) (-1793.141) (-1793.141) * [-1793.141] (-1793.141) (-1793.141) (-1793.141) 
        500 -- [-1173.570] (-1203.293) (-1186.161) (-1206.001) * (-1174.068) [-1170.942] (-1204.492) (-1175.866) -- 0:00:00
       1000 -- [-1171.794] (-1197.118) (-1178.705) (-1190.514) * [-1168.678] (-1175.292) (-1180.285) (-1170.326) -- 0:00:00
       1500 -- (-1168.974) (-1175.758) [-1171.569] (-1169.158) * [-1169.411] (-1170.351) (-1166.095) (-1170.808) -- 0:00:00
       2000 -- (-1172.101) [-1176.562] (-1172.982) (-1171.764) * (-1171.466) [-1166.812] (-1172.459) (-1175.980) -- 0:00:00
       2500 -- (-1168.202) [-1167.021] (-1172.499) (-1167.024) * (-1173.762) [-1166.383] (-1164.338) (-1166.391) -- 0:00:00
       3000 -- (-1164.642) (-1165.096) [-1170.527] (-1172.060) * (-1175.651) (-1174.983) (-1168.970) [-1171.035] -- 0:00:00
       3500 -- (-1171.537) [-1173.192] (-1176.291) (-1172.397) * (-1171.681) [-1170.564] (-1163.724) (-1171.510) -- 0:00:00
       4000 -- (-1174.837) [-1164.762] (-1178.095) (-1169.381) * (-1171.808) (-1171.155) [-1167.587] (-1168.913) -- 0:00:00
       4500 -- (-1168.780) (-1170.525) (-1170.388) [-1170.003] * (-1180.469) [-1167.590] (-1167.306) (-1168.409) -- 0:00:00
       5000 -- (-1175.751) (-1168.218) (-1168.337) [-1170.485] * (-1165.919) (-1172.303) [-1165.369] (-1172.904) -- 0:03:19

      Average standard deviation of split frequencies: 0.104757

       5500 -- (-1176.807) (-1170.564) [-1167.052] (-1174.402) * [-1164.785] (-1181.020) (-1170.729) (-1175.763) -- 0:03:00
       6000 -- (-1169.170) (-1173.781) (-1172.553) [-1170.269] * (-1172.034) [-1164.074] (-1167.573) (-1176.617) -- 0:02:45
       6500 -- [-1172.142] (-1168.930) (-1172.850) (-1170.705) * (-1169.597) [-1170.027] (-1175.612) (-1174.549) -- 0:02:32
       7000 -- (-1178.090) (-1170.001) (-1168.276) [-1168.418] * (-1166.767) (-1172.027) (-1173.217) [-1167.857] -- 0:02:21
       7500 -- (-1173.363) (-1167.292) (-1172.847) [-1170.293] * (-1168.598) (-1169.957) (-1169.222) [-1173.077] -- 0:02:12
       8000 -- (-1169.418) (-1174.113) (-1174.777) [-1167.882] * (-1173.663) (-1171.745) (-1165.755) [-1163.939] -- 0:02:04
       8500 -- (-1170.850) (-1169.034) (-1170.081) [-1167.064] * [-1171.689] (-1168.746) (-1161.072) (-1164.998) -- 0:01:56
       9000 -- (-1172.606) (-1169.222) (-1169.846) [-1164.683] * (-1172.457) (-1168.483) (-1162.464) [-1165.781] -- 0:01:50
       9500 -- [-1167.864] (-1167.981) (-1170.587) (-1172.242) * (-1171.993) [-1168.485] (-1163.003) (-1172.862) -- 0:01:44
      10000 -- [-1169.948] (-1170.108) (-1164.224) (-1174.615) * [-1167.113] (-1174.294) (-1165.158) (-1181.864) -- 0:01:39

      Average standard deviation of split frequencies: 0.063836

      10500 -- (-1174.629) (-1171.983) (-1169.919) [-1176.363] * [-1169.612] (-1170.533) (-1163.389) (-1172.952) -- 0:01:34
      11000 -- [-1169.769] (-1170.907) (-1174.190) (-1165.287) * [-1169.016] (-1168.500) (-1162.524) (-1169.602) -- 0:01:29
      11500 -- (-1167.868) (-1165.798) (-1170.453) [-1170.283] * (-1171.851) (-1169.628) [-1162.706] (-1171.029) -- 0:01:25
      12000 -- (-1173.139) [-1167.261] (-1166.376) (-1169.821) * (-1171.328) (-1168.769) [-1161.602] (-1168.810) -- 0:01:22
      12500 -- (-1171.278) (-1176.034) (-1174.515) [-1172.775] * [-1170.811] (-1170.760) (-1161.739) (-1167.137) -- 0:01:19
      13000 -- [-1166.876] (-1181.014) (-1165.839) (-1170.173) * (-1167.375) [-1170.759] (-1161.847) (-1168.940) -- 0:01:15
      13500 -- (-1168.174) [-1169.945] (-1175.556) (-1169.369) * (-1168.164) (-1165.995) [-1161.490] (-1170.056) -- 0:01:13
      14000 -- (-1173.396) (-1177.062) (-1168.566) [-1167.489] * (-1168.963) (-1170.557) [-1160.991] (-1172.113) -- 0:01:10
      14500 -- (-1185.279) (-1166.752) [-1170.758] (-1173.686) * (-1171.784) (-1169.646) [-1163.016] (-1175.732) -- 0:01:07
      15000 -- (-1179.014) (-1168.920) [-1167.962] (-1173.124) * (-1168.537) [-1169.436] (-1165.366) (-1173.128) -- 0:01:05

      Average standard deviation of split frequencies: 0.064818

      15500 -- (-1170.026) (-1167.944) (-1175.279) [-1172.891] * (-1177.584) [-1169.273] (-1163.602) (-1166.390) -- 0:01:03
      16000 -- (-1174.079) (-1170.881) (-1173.011) [-1169.434] * (-1174.688) (-1168.283) (-1166.759) [-1170.805] -- 0:01:01
      16500 -- [-1168.728] (-1166.742) (-1175.848) (-1173.035) * (-1164.986) (-1173.216) (-1163.985) [-1166.502] -- 0:00:59
      17000 -- (-1175.402) (-1169.814) (-1168.891) [-1163.950] * (-1171.666) (-1174.521) (-1163.619) [-1169.116] -- 0:00:57
      17500 -- (-1173.419) (-1165.328) [-1170.582] (-1174.899) * (-1177.337) (-1170.639) (-1161.839) [-1165.661] -- 0:00:56
      18000 -- (-1169.602) [-1169.883] (-1171.684) (-1166.059) * (-1176.514) (-1166.625) [-1163.395] (-1175.086) -- 0:00:54
      18500 -- (-1169.854) (-1168.027) [-1165.201] (-1168.123) * (-1175.527) (-1169.815) [-1162.831] (-1177.058) -- 0:00:53
      19000 -- (-1166.296) [-1170.256] (-1171.267) (-1166.723) * (-1173.864) [-1166.737] (-1161.986) (-1180.083) -- 0:00:51
      19500 -- (-1173.010) (-1178.880) (-1169.930) [-1169.988] * (-1164.955) (-1169.780) (-1163.247) [-1168.702] -- 0:00:50
      20000 -- (-1170.071) [-1173.899] (-1166.880) (-1174.708) * (-1165.797) (-1167.908) (-1166.237) [-1167.299] -- 0:00:49

      Average standard deviation of split frequencies: 0.054744

      20500 -- (-1170.097) [-1167.958] (-1167.239) (-1172.898) * [-1168.406] (-1168.241) (-1163.173) (-1167.910) -- 0:00:47
      21000 -- [-1170.095] (-1166.016) (-1172.152) (-1173.034) * [-1171.900] (-1167.076) (-1161.527) (-1168.811) -- 0:00:46
      21500 -- (-1172.509) (-1169.463) (-1169.555) [-1168.301] * [-1168.529] (-1169.218) (-1160.908) (-1179.203) -- 0:01:31
      22000 -- [-1166.915] (-1168.622) (-1171.103) (-1172.745) * (-1172.236) (-1173.561) (-1161.648) [-1171.360] -- 0:01:28
      22500 -- (-1171.201) [-1168.280] (-1170.973) (-1180.035) * (-1178.726) (-1171.029) [-1161.590] (-1163.534) -- 0:01:26
      23000 -- [-1171.482] (-1168.796) (-1175.456) (-1172.113) * (-1162.542) (-1172.038) [-1162.744] (-1168.238) -- 0:01:24
      23500 -- (-1179.725) [-1174.502] (-1166.518) (-1166.077) * (-1163.218) (-1167.115) [-1163.207] (-1170.700) -- 0:01:23
      24000 -- (-1167.236) [-1172.665] (-1167.579) (-1168.253) * (-1166.118) [-1165.632] (-1161.992) (-1176.875) -- 0:01:21
      24500 -- (-1170.769) (-1173.284) (-1167.060) [-1167.158] * (-1164.537) (-1168.191) [-1162.314] (-1167.772) -- 0:01:19
      25000 -- (-1166.295) (-1165.605) (-1172.735) [-1167.745] * (-1164.095) (-1167.088) (-1163.347) [-1169.888] -- 0:01:18

      Average standard deviation of split frequencies: 0.054393

      25500 -- (-1165.252) [-1165.711] (-1166.216) (-1181.666) * (-1163.780) (-1166.691) [-1163.133] (-1165.238) -- 0:01:16
      26000 -- [-1163.145] (-1169.811) (-1170.502) (-1175.501) * [-1164.542] (-1179.540) (-1162.619) (-1164.801) -- 0:01:14
      26500 -- [-1162.577] (-1169.493) (-1168.443) (-1168.425) * (-1162.775) (-1170.672) (-1165.100) [-1169.276] -- 0:01:13
      27000 -- [-1162.089] (-1172.007) (-1171.011) (-1173.001) * [-1162.084] (-1176.575) (-1164.902) (-1167.663) -- 0:01:12
      27500 -- (-1161.597) (-1175.483) (-1179.964) [-1169.100] * [-1163.047] (-1180.345) (-1165.191) (-1172.940) -- 0:01:10
      28000 -- (-1165.556) [-1175.224] (-1175.287) (-1167.608) * [-1161.748] (-1166.541) (-1162.023) (-1169.326) -- 0:01:09
      28500 -- (-1162.538) (-1171.142) (-1168.165) [-1168.207] * (-1161.625) [-1165.653] (-1164.151) (-1166.441) -- 0:01:08
      29000 -- (-1163.987) (-1175.003) [-1171.407] (-1170.312) * (-1162.866) [-1169.440] (-1163.563) (-1165.318) -- 0:01:06
      29500 -- (-1164.086) [-1165.705] (-1166.932) (-1172.590) * (-1163.537) [-1169.869] (-1163.000) (-1169.441) -- 0:01:05
      30000 -- [-1163.832] (-1172.670) (-1167.507) (-1170.454) * [-1161.565] (-1171.701) (-1161.684) (-1167.049) -- 0:01:04

      Average standard deviation of split frequencies: 0.046116

      30500 -- (-1162.913) (-1166.578) [-1170.000] (-1167.472) * (-1162.224) [-1168.616] (-1161.729) (-1169.947) -- 0:01:03
      31000 -- (-1162.506) (-1169.714) [-1165.333] (-1172.884) * (-1161.924) (-1168.325) (-1164.361) [-1168.841] -- 0:01:02
      31500 -- [-1162.535] (-1178.377) (-1165.878) (-1171.705) * (-1161.270) [-1168.502] (-1164.448) (-1173.305) -- 0:01:01
      32000 -- (-1163.504) [-1170.205] (-1171.235) (-1168.457) * (-1161.883) (-1169.751) (-1165.022) [-1166.687] -- 0:01:00
      32500 -- (-1162.557) [-1172.675] (-1170.302) (-1175.797) * [-1165.032] (-1166.968) (-1165.186) (-1169.440) -- 0:00:59
      33000 -- (-1163.675) (-1170.424) [-1164.610] (-1170.958) * (-1164.841) (-1169.928) [-1163.497] (-1175.403) -- 0:00:58
      33500 -- (-1165.547) [-1166.074] (-1162.693) (-1172.308) * (-1162.119) (-1170.522) [-1161.142] (-1170.958) -- 0:00:57
      34000 -- [-1162.396] (-1167.458) (-1164.877) (-1166.027) * (-1162.286) [-1165.208] (-1162.544) (-1174.592) -- 0:00:56
      34500 -- (-1164.555) [-1164.149] (-1165.467) (-1175.621) * (-1163.545) (-1170.198) (-1162.987) [-1167.792] -- 0:00:55
      35000 -- [-1165.310] (-1167.175) (-1165.763) (-1171.350) * (-1163.223) (-1169.097) (-1162.750) [-1175.212] -- 0:00:55

      Average standard deviation of split frequencies: 0.034046

      35500 -- (-1163.532) (-1171.643) (-1165.014) [-1172.042] * (-1169.206) (-1170.639) [-1164.070] (-1169.117) -- 0:00:54
      36000 -- (-1164.370) (-1170.050) (-1166.403) [-1166.428] * (-1164.672) [-1167.151] (-1162.580) (-1184.573) -- 0:00:53
      36500 -- [-1163.566] (-1168.254) (-1163.933) (-1170.790) * (-1161.805) [-1170.754] (-1162.299) (-1179.495) -- 0:00:52
      37000 -- (-1162.778) [-1166.674] (-1161.514) (-1169.259) * (-1161.347) [-1170.887] (-1162.636) (-1171.754) -- 0:00:52
      37500 -- (-1162.941) [-1169.812] (-1162.540) (-1169.765) * (-1161.192) [-1165.600] (-1163.278) (-1163.360) -- 0:00:51
      38000 -- (-1163.951) (-1173.080) (-1168.131) [-1169.218] * (-1161.689) (-1166.378) [-1164.564] (-1163.392) -- 0:01:15
      38500 -- [-1163.321] (-1171.256) (-1166.424) (-1167.524) * (-1164.486) (-1166.321) (-1163.844) [-1162.218] -- 0:01:14
      39000 -- (-1161.960) (-1175.609) [-1166.454] (-1169.434) * (-1162.595) [-1168.538] (-1164.420) (-1164.575) -- 0:01:13
      39500 -- (-1161.995) [-1168.123] (-1163.192) (-1176.377) * [-1161.095] (-1171.305) (-1165.289) (-1164.854) -- 0:01:12
      40000 -- (-1163.433) (-1171.072) (-1161.827) [-1171.166] * (-1163.642) (-1168.020) (-1164.385) [-1165.124] -- 0:01:12

      Average standard deviation of split frequencies: 0.039413

      40500 -- (-1162.467) (-1173.077) (-1161.443) [-1170.075] * [-1163.407] (-1169.383) (-1163.893) (-1169.042) -- 0:01:11
      41000 -- (-1162.761) [-1164.654] (-1161.378) (-1166.948) * (-1163.188) (-1165.034) (-1165.898) [-1168.706] -- 0:01:10
      41500 -- (-1167.780) [-1167.670] (-1161.664) (-1168.473) * (-1166.169) (-1167.895) [-1163.070] (-1165.069) -- 0:01:09
      42000 -- (-1164.114) (-1172.819) (-1162.444) [-1169.388] * (-1164.422) [-1171.173] (-1165.000) (-1165.230) -- 0:01:08
      42500 -- (-1163.573) [-1161.822] (-1162.372) (-1172.971) * (-1163.473) (-1170.475) (-1162.572) [-1166.916] -- 0:01:07
      43000 -- (-1164.089) (-1161.410) [-1165.640] (-1167.231) * (-1163.548) (-1173.424) (-1166.412) [-1164.951] -- 0:01:06
      43500 -- (-1161.614) (-1162.231) (-1170.588) [-1170.436] * [-1166.237] (-1171.507) (-1163.571) (-1161.710) -- 0:01:05
      44000 -- [-1161.692] (-1162.146) (-1166.169) (-1172.938) * (-1165.926) (-1168.155) [-1162.637] (-1166.386) -- 0:01:05
      44500 -- (-1161.509) [-1162.111] (-1166.839) (-1171.852) * (-1166.031) (-1171.672) (-1164.811) [-1162.882] -- 0:01:04
      45000 -- (-1161.997) (-1165.857) [-1163.001] (-1167.438) * (-1166.031) [-1169.211] (-1162.847) (-1174.828) -- 0:01:03

      Average standard deviation of split frequencies: 0.047140

      45500 -- (-1162.133) (-1164.597) (-1163.204) [-1173.101] * (-1165.343) [-1169.143] (-1163.912) (-1164.395) -- 0:01:02
      46000 -- (-1162.919) (-1163.397) (-1166.428) [-1169.951] * (-1164.120) (-1172.717) [-1163.147] (-1163.497) -- 0:01:02
      46500 -- [-1162.620] (-1163.507) (-1163.919) (-1169.984) * (-1161.751) (-1174.419) [-1165.075] (-1164.198) -- 0:01:01
      47000 -- (-1162.557) [-1162.861] (-1162.468) (-1167.025) * (-1160.778) [-1167.175] (-1163.446) (-1163.893) -- 0:01:00
      47500 -- (-1162.934) (-1163.395) [-1161.241] (-1171.893) * (-1163.435) (-1171.006) (-1165.929) [-1164.502] -- 0:01:00
      48000 -- (-1162.321) [-1162.725] (-1161.744) (-1174.805) * (-1163.154) (-1178.043) (-1161.421) [-1170.488] -- 0:00:59
      48500 -- [-1162.439] (-1168.860) (-1162.282) (-1167.897) * (-1167.693) (-1170.247) (-1161.686) [-1162.837] -- 0:00:58
      49000 -- (-1164.804) (-1164.226) [-1161.839] (-1165.292) * (-1169.362) (-1177.794) [-1162.531] (-1162.135) -- 0:00:58
      49500 -- [-1161.703] (-1163.814) (-1161.537) (-1165.174) * (-1163.741) (-1172.197) (-1161.824) [-1161.164] -- 0:00:57
      50000 -- [-1162.929] (-1162.559) (-1162.531) (-1163.764) * (-1163.907) (-1170.126) [-1162.630] (-1165.252) -- 0:00:57

      Average standard deviation of split frequencies: 0.050242

      50500 -- (-1164.769) (-1163.208) (-1162.299) [-1162.960] * [-1161.437] (-1166.468) (-1162.254) (-1164.285) -- 0:00:56
      51000 -- [-1163.549] (-1162.043) (-1164.911) (-1162.630) * [-1162.155] (-1173.647) (-1162.624) (-1165.578) -- 0:00:55
      51500 -- [-1162.388] (-1177.454) (-1163.992) (-1161.938) * (-1162.464) [-1173.840] (-1169.110) (-1162.754) -- 0:00:55
      52000 -- [-1161.547] (-1173.307) (-1163.174) (-1163.298) * (-1164.627) (-1172.663) (-1170.857) [-1162.401] -- 0:00:54
      52500 -- (-1165.038) (-1168.678) [-1162.764] (-1164.162) * (-1162.827) [-1169.993] (-1165.521) (-1162.422) -- 0:00:54
      53000 -- (-1162.429) (-1168.576) [-1163.429] (-1161.986) * (-1166.018) (-1167.340) (-1164.819) [-1164.403] -- 0:00:53
      53500 -- (-1163.118) (-1166.571) [-1162.507] (-1164.426) * [-1162.591] (-1171.545) (-1164.106) (-1164.044) -- 0:01:10
      54000 -- (-1162.907) (-1166.469) (-1164.269) [-1163.906] * (-1164.501) (-1171.877) (-1164.866) [-1167.159] -- 0:01:10
      54500 -- (-1162.482) (-1164.045) (-1163.902) [-1162.272] * (-1165.142) [-1165.938] (-1163.076) (-1161.603) -- 0:01:09
      55000 -- [-1162.037] (-1165.106) (-1163.627) (-1161.353) * (-1162.871) (-1174.835) (-1163.092) [-1162.690] -- 0:01:08

      Average standard deviation of split frequencies: 0.047140

      55500 -- (-1162.144) [-1161.563] (-1164.548) (-1162.234) * [-1161.932] (-1166.502) (-1163.285) (-1163.728) -- 0:01:08
      56000 -- [-1162.443] (-1164.770) (-1162.511) (-1162.270) * (-1162.136) (-1171.861) [-1163.544] (-1164.669) -- 0:01:07
      56500 -- (-1162.831) (-1165.668) (-1164.653) [-1161.907] * [-1161.942] (-1170.571) (-1163.633) (-1165.427) -- 0:01:06
      57000 -- (-1163.272) (-1166.350) [-1162.455] (-1162.688) * (-1161.230) (-1172.888) [-1164.476] (-1165.718) -- 0:01:06
      57500 -- (-1161.886) [-1162.176] (-1162.906) (-1163.772) * [-1161.276] (-1167.625) (-1164.334) (-1161.727) -- 0:01:05
      58000 -- [-1161.515] (-1163.258) (-1161.428) (-1164.196) * (-1163.626) (-1177.598) (-1162.406) [-1163.032] -- 0:01:04
      58500 -- (-1165.334) (-1164.375) [-1166.497] (-1162.820) * [-1162.959] (-1183.076) (-1166.954) (-1165.327) -- 0:01:04
      59000 -- (-1167.521) (-1163.984) (-1167.846) [-1162.393] * (-1161.006) (-1163.204) (-1163.628) [-1165.594] -- 0:01:03
      59500 -- (-1169.435) (-1161.521) [-1163.902] (-1162.744) * (-1163.224) (-1167.116) (-1166.402) [-1162.948] -- 0:01:03
      60000 -- (-1166.811) [-1161.140] (-1161.712) (-1165.405) * (-1163.822) (-1164.739) [-1169.655] (-1161.453) -- 0:01:02

      Average standard deviation of split frequencies: 0.038852

      60500 -- (-1161.123) (-1163.732) [-1162.328] (-1165.040) * (-1161.709) (-1163.269) (-1162.587) [-1161.357] -- 0:01:02
      61000 -- [-1162.502] (-1163.035) (-1162.996) (-1163.305) * (-1165.810) [-1166.598] (-1166.362) (-1161.561) -- 0:01:01
      61500 -- (-1162.083) (-1161.859) [-1165.311] (-1165.982) * [-1163.592] (-1162.561) (-1167.021) (-1162.713) -- 0:01:01
      62000 -- [-1162.174] (-1162.782) (-1164.479) (-1164.704) * [-1163.477] (-1162.297) (-1162.471) (-1164.555) -- 0:01:00
      62500 -- [-1161.954] (-1167.646) (-1163.078) (-1162.738) * [-1165.176] (-1162.131) (-1162.806) (-1161.218) -- 0:01:00
      63000 -- (-1161.949) (-1165.352) [-1162.487] (-1163.514) * (-1164.870) [-1162.356] (-1162.153) (-1164.875) -- 0:00:59
      63500 -- (-1161.373) (-1166.057) (-1162.922) [-1163.730] * [-1162.735] (-1162.184) (-1165.782) (-1172.118) -- 0:00:58
      64000 -- (-1161.987) (-1164.189) [-1164.358] (-1163.729) * [-1165.656] (-1161.835) (-1166.762) (-1170.929) -- 0:00:58
      64500 -- [-1161.058] (-1162.596) (-1166.823) (-1166.609) * (-1161.599) (-1164.840) [-1162.158] (-1170.994) -- 0:00:58
      65000 -- (-1164.629) (-1164.602) [-1163.377] (-1165.194) * (-1160.926) (-1163.057) (-1162.347) [-1169.874] -- 0:00:57

      Average standard deviation of split frequencies: 0.037141

      65500 -- [-1161.592] (-1164.545) (-1163.375) (-1165.677) * (-1162.240) (-1164.286) (-1163.175) [-1165.722] -- 0:00:57
      66000 -- (-1163.327) (-1164.127) [-1163.391] (-1166.740) * [-1163.373] (-1162.093) (-1163.173) (-1166.283) -- 0:00:56
      66500 -- (-1162.680) [-1167.631] (-1162.608) (-1164.531) * [-1163.776] (-1162.168) (-1162.141) (-1165.376) -- 0:00:56
      67000 -- [-1169.765] (-1165.570) (-1162.337) (-1163.896) * (-1166.000) [-1161.761] (-1164.081) (-1166.133) -- 0:00:55
      67500 -- (-1166.077) (-1163.178) (-1162.741) [-1163.910] * (-1165.422) (-1163.492) (-1162.889) [-1162.867] -- 0:00:55
      68000 -- (-1162.914) (-1165.165) (-1163.895) [-1164.846] * (-1162.320) [-1163.389] (-1162.941) (-1163.098) -- 0:00:54
      68500 -- (-1162.921) (-1163.437) (-1162.887) [-1163.874] * (-1161.252) (-1161.422) [-1163.065] (-1163.516) -- 0:00:54
      69000 -- (-1162.730) [-1161.700] (-1164.130) (-1161.490) * (-1163.518) [-1166.497] (-1161.816) (-1164.885) -- 0:00:53
      69500 -- (-1162.226) [-1161.934] (-1164.347) (-1162.443) * (-1162.428) (-1166.016) [-1161.426] (-1162.883) -- 0:00:53
      70000 -- (-1164.400) (-1161.913) (-1164.031) [-1162.134] * (-1166.163) (-1163.152) (-1162.182) [-1161.334] -- 0:00:53

      Average standard deviation of split frequencies: 0.040025

      70500 -- [-1162.648] (-1160.895) (-1165.702) (-1163.104) * (-1164.890) (-1161.256) [-1161.893] (-1163.574) -- 0:00:52
      71000 -- (-1164.053) [-1161.273] (-1161.894) (-1161.745) * (-1162.458) [-1161.434] (-1166.119) (-1165.042) -- 0:01:05
      71500 -- (-1165.097) [-1161.313] (-1162.984) (-1162.890) * (-1162.035) (-1162.771) (-1162.106) [-1161.435] -- 0:01:04
      72000 -- (-1164.636) [-1161.474] (-1162.982) (-1163.148) * (-1164.853) (-1161.568) [-1161.558] (-1161.616) -- 0:01:04
      72500 -- (-1165.073) (-1161.273) [-1166.494] (-1161.792) * (-1162.378) (-1161.213) (-1165.660) [-1163.207] -- 0:01:03
      73000 -- [-1164.743] (-1163.846) (-1167.157) (-1164.662) * (-1165.077) [-1160.882] (-1164.484) (-1162.714) -- 0:01:03
      73500 -- (-1164.401) [-1166.339] (-1163.982) (-1164.771) * (-1162.634) [-1162.434] (-1163.606) (-1162.832) -- 0:01:03
      74000 -- (-1163.070) (-1162.754) [-1162.583] (-1166.506) * [-1162.836] (-1162.905) (-1166.460) (-1163.746) -- 0:01:02
      74500 -- (-1163.724) (-1165.976) [-1161.664] (-1161.810) * (-1162.548) [-1163.402] (-1162.945) (-1162.021) -- 0:01:02
      75000 -- (-1161.470) (-1162.488) [-1161.036] (-1162.833) * (-1164.475) [-1162.355] (-1164.225) (-1165.979) -- 0:01:01

      Average standard deviation of split frequencies: 0.044659

      75500 -- (-1161.827) [-1163.935] (-1161.315) (-1161.230) * (-1161.019) (-1162.729) [-1161.650] (-1163.188) -- 0:01:01
      76000 -- (-1163.004) (-1161.651) (-1164.488) [-1162.112] * (-1165.481) (-1165.496) [-1163.948] (-1163.907) -- 0:01:00
      76500 -- (-1161.671) [-1163.002] (-1163.320) (-1161.433) * (-1164.685) [-1164.949] (-1162.928) (-1162.275) -- 0:01:00
      77000 -- (-1161.992) (-1163.424) [-1163.197] (-1163.587) * (-1165.836) (-1164.384) (-1164.331) [-1165.575] -- 0:00:59
      77500 -- (-1162.807) [-1164.817] (-1163.844) (-1163.921) * [-1163.519] (-1164.836) (-1163.332) (-1164.592) -- 0:00:59
      78000 -- [-1161.731] (-1163.652) (-1164.165) (-1164.041) * [-1163.411] (-1161.866) (-1161.797) (-1161.225) -- 0:00:59
      78500 -- [-1161.738] (-1166.202) (-1161.593) (-1167.263) * (-1164.170) (-1162.665) (-1162.211) [-1162.982] -- 0:00:58
      79000 -- (-1161.096) (-1166.568) [-1162.884] (-1162.622) * (-1166.074) (-1164.128) (-1163.577) [-1163.475] -- 0:00:58
      79500 -- (-1161.101) (-1165.686) (-1161.912) [-1161.630] * [-1164.297] (-1160.925) (-1162.359) (-1161.574) -- 0:00:57
      80000 -- [-1161.373] (-1162.894) (-1161.282) (-1163.158) * (-1163.719) [-1162.351] (-1162.251) (-1163.162) -- 0:00:57

      Average standard deviation of split frequencies: 0.044413

      80500 -- (-1160.696) (-1162.426) [-1161.276] (-1162.465) * (-1167.407) [-1162.647] (-1163.514) (-1161.232) -- 0:00:57
      81000 -- [-1160.985] (-1164.718) (-1166.717) (-1161.974) * (-1164.020) [-1161.836] (-1161.964) (-1161.278) -- 0:00:56
      81500 -- [-1162.664] (-1162.334) (-1163.208) (-1162.135) * (-1164.937) [-1162.484] (-1162.602) (-1161.336) -- 0:00:56
      82000 -- (-1162.793) (-1162.251) (-1161.935) [-1162.575] * [-1166.602] (-1162.973) (-1160.791) (-1161.157) -- 0:00:55
      82500 -- (-1162.600) (-1162.795) (-1161.114) [-1164.822] * [-1165.626] (-1162.491) (-1162.801) (-1161.157) -- 0:00:55
      83000 -- [-1162.655] (-1162.993) (-1165.299) (-1161.918) * (-1161.763) [-1161.436] (-1165.208) (-1161.152) -- 0:00:55
      83500 -- (-1162.417) (-1166.015) (-1165.656) [-1161.706] * (-1166.185) (-1161.342) [-1170.633] (-1165.710) -- 0:00:54
      84000 -- (-1161.734) (-1165.828) (-1166.107) [-1161.706] * (-1168.306) [-1162.562] (-1165.570) (-1165.534) -- 0:00:54
      84500 -- [-1161.062] (-1166.916) (-1161.957) (-1161.619) * [-1163.653] (-1160.819) (-1166.219) (-1162.850) -- 0:00:54
      85000 -- (-1162.463) (-1163.686) [-1164.414] (-1162.654) * (-1166.280) [-1161.592] (-1163.980) (-1162.408) -- 0:00:53

      Average standard deviation of split frequencies: 0.043852

      85500 -- (-1161.994) [-1164.411] (-1162.696) (-1163.696) * [-1164.526] (-1162.213) (-1164.992) (-1161.690) -- 0:00:53
      86000 -- (-1164.192) (-1165.146) [-1164.178] (-1163.562) * (-1166.124) [-1162.173] (-1162.728) (-1162.326) -- 0:00:53
      86500 -- [-1161.785] (-1163.575) (-1165.753) (-1162.090) * (-1165.205) (-1160.981) (-1164.721) [-1164.474] -- 0:00:52
      87000 -- [-1162.774] (-1165.689) (-1163.183) (-1163.929) * (-1166.517) (-1162.962) (-1165.021) [-1162.404] -- 0:00:52
      87500 -- [-1161.836] (-1162.318) (-1162.695) (-1161.500) * [-1162.176] (-1162.803) (-1164.209) (-1162.315) -- 0:01:02
      88000 -- (-1167.388) [-1163.907] (-1162.387) (-1170.573) * (-1162.276) [-1162.006] (-1166.695) (-1162.929) -- 0:01:02
      88500 -- (-1170.921) (-1166.352) [-1162.083] (-1164.095) * (-1162.605) [-1162.005] (-1161.986) (-1165.807) -- 0:01:01
      89000 -- (-1165.407) (-1166.774) (-1165.158) [-1163.382] * (-1162.298) [-1161.948] (-1161.568) (-1170.178) -- 0:01:01
      89500 -- (-1166.580) [-1161.775] (-1164.676) (-1162.356) * (-1162.392) [-1164.243] (-1162.557) (-1164.385) -- 0:01:01
      90000 -- (-1163.852) (-1161.343) [-1163.003] (-1164.547) * (-1164.196) (-1161.324) (-1166.842) [-1164.175] -- 0:01:00

      Average standard deviation of split frequencies: 0.040555

      90500 -- (-1164.996) (-1162.379) [-1161.392] (-1164.975) * (-1162.690) (-1160.824) (-1167.413) [-1164.401] -- 0:01:00
      91000 -- [-1163.712] (-1162.075) (-1161.669) (-1165.451) * (-1163.098) (-1160.855) [-1162.056] (-1163.612) -- 0:00:59
      91500 -- [-1163.536] (-1163.241) (-1163.492) (-1164.219) * (-1165.317) (-1160.734) [-1162.307] (-1163.172) -- 0:00:59
      92000 -- [-1162.960] (-1163.241) (-1162.056) (-1162.519) * (-1160.794) (-1160.715) [-1161.184] (-1165.019) -- 0:00:59
      92500 -- (-1162.605) (-1164.451) (-1164.418) [-1164.534] * (-1161.370) (-1162.370) [-1161.175] (-1163.611) -- 0:00:58
      93000 -- [-1163.493] (-1163.788) (-1162.996) (-1164.452) * (-1161.355) (-1164.607) [-1161.975] (-1162.954) -- 0:00:58
      93500 -- (-1168.057) (-1163.078) (-1167.150) [-1163.025] * [-1164.849] (-1161.305) (-1162.782) (-1163.935) -- 0:00:58
      94000 -- [-1164.236] (-1162.471) (-1165.798) (-1164.717) * (-1164.904) (-1160.939) (-1165.426) [-1165.174] -- 0:00:57
      94500 -- (-1161.044) (-1163.546) [-1164.654] (-1163.565) * (-1167.591) (-1161.866) [-1163.530] (-1163.424) -- 0:00:57
      95000 -- (-1163.577) [-1163.680] (-1161.707) (-1165.077) * (-1165.453) [-1161.866] (-1164.267) (-1163.827) -- 0:00:57

      Average standard deviation of split frequencies: 0.035355

      95500 -- (-1163.962) (-1164.520) [-1163.746] (-1163.846) * (-1163.055) (-1164.168) (-1164.087) [-1163.567] -- 0:00:56
      96000 -- (-1168.299) (-1165.137) (-1161.401) [-1163.970] * (-1162.245) (-1162.252) [-1164.801] (-1166.574) -- 0:00:56
      96500 -- (-1163.661) [-1165.371] (-1164.187) (-1165.954) * (-1161.630) (-1163.612) (-1174.383) [-1162.393] -- 0:00:56
      97000 -- (-1161.957) [-1163.716] (-1162.654) (-1165.892) * [-1162.875] (-1164.434) (-1167.735) (-1166.183) -- 0:00:55
      97500 -- (-1161.071) [-1161.792] (-1161.371) (-1166.026) * (-1163.245) (-1164.284) [-1164.259] (-1164.775) -- 0:00:55
      98000 -- (-1162.093) (-1161.472) (-1163.615) [-1165.871] * (-1164.632) [-1162.215] (-1168.365) (-1164.536) -- 0:00:55
      98500 -- (-1163.858) (-1161.858) [-1163.215] (-1171.583) * (-1164.937) (-1163.460) (-1170.114) [-1162.628] -- 0:00:54
      99000 -- [-1162.452] (-1161.148) (-1163.213) (-1169.695) * (-1163.998) [-1162.430] (-1167.637) (-1164.851) -- 0:00:54
      99500 -- [-1161.949] (-1162.938) (-1162.646) (-1161.760) * (-1168.282) (-1162.663) [-1164.192] (-1168.073) -- 0:00:54
      100000 -- (-1161.366) (-1166.188) [-1161.641] (-1161.178) * (-1165.469) (-1166.301) (-1162.704) [-1163.052] -- 0:00:54

      Average standard deviation of split frequencies: 0.035589

      100500 -- (-1161.631) (-1168.219) (-1161.397) [-1161.131] * (-1163.064) [-1163.614] (-1162.580) (-1164.819) -- 0:00:53
      101000 -- [-1161.875] (-1164.167) (-1161.067) (-1161.461) * (-1163.062) (-1168.013) (-1162.106) [-1161.545] -- 0:00:53
      101500 -- [-1162.716] (-1163.710) (-1160.969) (-1162.501) * (-1163.796) [-1164.331] (-1162.797) (-1161.948) -- 0:00:53
      102000 -- [-1162.817] (-1161.723) (-1160.969) (-1163.674) * [-1161.787] (-1165.868) (-1162.107) (-1161.689) -- 0:00:52
      102500 -- (-1164.934) (-1162.566) [-1163.777] (-1166.711) * (-1161.232) (-1165.290) [-1161.985] (-1163.215) -- 0:00:52
      103000 -- [-1165.265] (-1161.653) (-1165.544) (-1162.918) * (-1163.822) (-1165.208) [-1162.021] (-1164.065) -- 0:00:52
      103500 -- (-1164.432) [-1161.651] (-1161.580) (-1161.311) * (-1162.804) (-1165.242) (-1164.403) [-1164.689] -- 0:00:51
      104000 -- (-1164.207) (-1161.543) (-1162.865) [-1163.256] * [-1163.210] (-1167.054) (-1165.806) (-1163.173) -- 0:00:51
      104500 -- (-1163.223) [-1161.797] (-1160.971) (-1162.022) * [-1161.623] (-1164.965) (-1161.618) (-1161.416) -- 0:00:59
      105000 -- (-1162.852) (-1162.853) (-1161.404) [-1163.677] * (-1161.269) [-1162.095] (-1164.930) (-1161.591) -- 0:00:59

      Average standard deviation of split frequencies: 0.031130

      105500 -- (-1162.989) [-1162.597] (-1162.006) (-1161.920) * (-1164.065) [-1162.085] (-1161.929) (-1161.362) -- 0:00:59
      106000 -- (-1164.166) (-1162.296) (-1162.227) [-1162.217] * (-1163.346) (-1161.897) (-1162.045) [-1162.517] -- 0:00:59
      106500 -- [-1166.376] (-1161.623) (-1163.303) (-1169.182) * (-1166.893) [-1162.566] (-1161.992) (-1162.905) -- 0:00:58
      107000 -- [-1161.718] (-1162.668) (-1162.332) (-1164.418) * (-1164.923) (-1164.405) [-1162.585] (-1163.226) -- 0:00:58
      107500 -- [-1163.118] (-1164.763) (-1161.504) (-1165.971) * (-1163.018) (-1163.116) (-1164.757) [-1163.161] -- 0:00:58
      108000 -- (-1162.852) (-1161.135) [-1161.506] (-1166.665) * [-1163.019] (-1163.003) (-1165.340) (-1163.666) -- 0:00:57
      108500 -- [-1161.072] (-1166.923) (-1164.869) (-1163.770) * (-1167.693) (-1164.147) (-1165.949) [-1162.570] -- 0:00:57
      109000 -- (-1161.119) [-1164.044] (-1162.074) (-1164.711) * (-1161.789) (-1166.133) [-1163.465] (-1162.170) -- 0:00:57
      109500 -- [-1161.113] (-1161.720) (-1163.999) (-1164.511) * (-1163.662) (-1166.149) [-1161.906] (-1161.829) -- 0:00:56
      110000 -- (-1163.524) [-1161.587] (-1164.276) (-1162.632) * [-1161.928] (-1162.865) (-1161.202) (-1161.462) -- 0:00:56

      Average standard deviation of split frequencies: 0.031522

      110500 -- (-1162.916) [-1163.142] (-1163.818) (-1163.246) * (-1161.596) (-1161.760) (-1162.046) [-1166.413] -- 0:00:56
      111000 -- (-1162.256) (-1162.783) [-1164.680] (-1162.780) * (-1163.318) (-1165.232) [-1164.791] (-1166.184) -- 0:00:56
      111500 -- (-1163.648) (-1161.015) (-1164.936) [-1163.204] * [-1163.732] (-1164.049) (-1165.153) (-1166.478) -- 0:00:55
      112000 -- [-1161.089] (-1162.024) (-1165.425) (-1161.299) * [-1161.596] (-1163.205) (-1166.597) (-1165.405) -- 0:00:55
      112500 -- [-1163.162] (-1162.468) (-1166.103) (-1162.422) * (-1164.224) [-1162.518] (-1165.983) (-1164.789) -- 0:00:55
      113000 -- (-1165.653) (-1163.421) (-1163.934) [-1161.904] * (-1166.664) (-1163.060) [-1165.072] (-1163.647) -- 0:00:54
      113500 -- [-1164.339] (-1161.593) (-1164.558) (-1161.425) * (-1165.170) (-1163.900) [-1164.004] (-1162.920) -- 0:00:54
      114000 -- (-1163.563) [-1167.392] (-1168.455) (-1163.214) * (-1164.540) (-1163.792) [-1163.754] (-1163.392) -- 0:00:54
      114500 -- (-1163.990) [-1164.197] (-1167.926) (-1163.798) * (-1164.589) (-1163.257) (-1165.311) [-1162.020] -- 0:00:54
      115000 -- (-1161.831) (-1163.794) (-1163.128) [-1168.175] * (-1164.348) [-1162.275] (-1164.346) (-1161.076) -- 0:00:53

      Average standard deviation of split frequencies: 0.027634

      115500 -- (-1166.401) (-1164.265) [-1162.242] (-1165.230) * (-1162.670) (-1162.378) [-1163.750] (-1163.430) -- 0:00:53
      116000 -- (-1161.857) (-1161.382) (-1162.876) [-1162.782] * (-1163.431) (-1163.338) [-1162.262] (-1161.913) -- 0:00:53
      116500 -- [-1163.656] (-1162.136) (-1164.513) (-1164.603) * (-1163.323) [-1162.731] (-1168.529) (-1161.077) -- 0:00:53
      117000 -- (-1161.500) (-1162.815) [-1168.375] (-1163.063) * (-1164.196) (-1165.303) (-1170.132) [-1163.584] -- 0:00:52
      117500 -- (-1163.405) [-1161.945] (-1166.356) (-1161.461) * [-1164.826] (-1161.968) (-1165.315) (-1162.820) -- 0:00:52
      118000 -- (-1164.011) (-1161.661) [-1168.230] (-1163.066) * (-1164.629) (-1161.649) (-1164.731) [-1161.582] -- 0:00:52
      118500 -- (-1162.674) (-1161.895) (-1164.342) [-1165.169] * [-1162.691] (-1164.105) (-1167.565) (-1162.108) -- 0:00:52
      119000 -- (-1163.821) (-1163.998) [-1165.984] (-1163.392) * (-1163.415) [-1163.204] (-1166.165) (-1163.281) -- 0:00:51
      119500 -- (-1165.202) [-1162.078] (-1162.700) (-1168.036) * [-1161.322] (-1165.269) (-1163.810) (-1163.787) -- 0:00:51
      120000 -- [-1163.241] (-1167.545) (-1165.036) (-1170.545) * (-1163.261) [-1162.422] (-1161.223) (-1163.161) -- 0:00:51

      Average standard deviation of split frequencies: 0.029691

      120500 -- (-1164.463) (-1165.431) (-1164.925) [-1163.657] * [-1161.208] (-1164.875) (-1161.404) (-1161.908) -- 0:00:58
      121000 -- [-1161.776] (-1162.289) (-1166.922) (-1165.152) * (-1161.181) (-1167.329) [-1161.077] (-1165.269) -- 0:00:58
      121500 -- (-1162.173) (-1163.565) (-1162.083) [-1162.434] * (-1165.803) (-1164.213) [-1162.368] (-1162.631) -- 0:00:57
      122000 -- [-1163.036] (-1163.141) (-1162.547) (-1163.020) * (-1167.316) [-1162.841] (-1161.413) (-1162.862) -- 0:00:57
      122500 -- (-1161.217) (-1163.112) (-1163.095) [-1163.100] * (-1165.979) [-1164.175] (-1163.247) (-1163.246) -- 0:00:57
      123000 -- (-1163.342) (-1165.516) (-1165.179) [-1161.928] * [-1165.026] (-1165.117) (-1165.071) (-1162.779) -- 0:00:57
      123500 -- [-1169.727] (-1162.876) (-1162.315) (-1162.662) * [-1163.703] (-1166.087) (-1165.353) (-1162.577) -- 0:00:56
      124000 -- [-1161.852] (-1161.924) (-1162.793) (-1163.828) * (-1163.628) (-1162.451) [-1164.391] (-1162.730) -- 0:00:56
      124500 -- (-1162.774) [-1162.731] (-1167.510) (-1163.306) * (-1164.968) (-1161.510) [-1161.274] (-1161.408) -- 0:00:56
      125000 -- (-1161.775) (-1164.963) (-1164.355) [-1164.862] * (-1165.154) (-1162.442) [-1161.637] (-1162.198) -- 0:00:56

      Average standard deviation of split frequencies: 0.032175

      125500 -- (-1161.926) (-1162.725) [-1162.056] (-1164.764) * (-1165.226) (-1161.643) (-1162.150) [-1161.381] -- 0:00:55
      126000 -- (-1163.332) [-1162.719] (-1164.814) (-1167.660) * (-1164.555) [-1161.559] (-1163.220) (-1161.596) -- 0:00:55
      126500 -- [-1161.536] (-1161.787) (-1163.905) (-1163.760) * (-1165.076) [-1161.030] (-1161.896) (-1166.364) -- 0:00:55
      127000 -- (-1162.256) [-1161.682] (-1161.252) (-1163.133) * (-1168.211) [-1161.752] (-1163.372) (-1161.464) -- 0:00:54
      127500 -- (-1163.315) [-1161.764] (-1161.565) (-1166.513) * [-1161.122] (-1161.111) (-1163.231) (-1161.838) -- 0:00:54
      128000 -- (-1161.645) [-1162.060] (-1162.727) (-1163.141) * (-1161.576) (-1162.161) (-1164.053) [-1161.315] -- 0:00:54
      128500 -- (-1169.556) (-1162.959) (-1161.826) [-1163.366] * [-1161.548] (-1162.473) (-1164.332) (-1163.378) -- 0:00:54
      129000 -- (-1163.200) [-1163.124] (-1162.118) (-1163.299) * (-1161.511) (-1162.057) [-1162.558] (-1164.030) -- 0:00:54
      129500 -- (-1162.413) (-1162.794) (-1164.500) [-1163.077] * [-1165.139] (-1162.081) (-1166.804) (-1163.317) -- 0:00:53
      130000 -- [-1161.321] (-1163.883) (-1162.087) (-1162.438) * [-1160.934] (-1162.966) (-1167.094) (-1163.860) -- 0:00:53

      Average standard deviation of split frequencies: 0.030305

      130500 -- (-1164.849) (-1164.940) (-1161.594) [-1161.044] * [-1161.432] (-1162.090) (-1163.173) (-1161.627) -- 0:00:53
      131000 -- (-1166.938) (-1166.323) (-1161.838) [-1161.232] * (-1164.033) (-1162.220) (-1161.540) [-1161.973] -- 0:00:53
      131500 -- (-1164.628) (-1165.200) (-1168.021) [-1162.113] * (-1161.404) [-1162.312] (-1162.856) (-1162.129) -- 0:00:52
      132000 -- [-1164.856] (-1166.473) (-1164.560) (-1162.420) * (-1164.301) (-1167.324) (-1161.154) [-1161.091] -- 0:00:52
      132500 -- [-1163.991] (-1165.144) (-1161.496) (-1163.468) * (-1162.525) (-1163.063) (-1161.163) [-1162.556] -- 0:00:52
      133000 -- [-1165.723] (-1167.382) (-1166.042) (-1164.003) * (-1161.278) (-1164.819) (-1161.841) [-1163.632] -- 0:00:52
      133500 -- (-1164.596) (-1164.171) [-1164.519] (-1163.310) * (-1161.351) (-1163.899) (-1162.891) [-1165.902] -- 0:00:51
      134000 -- (-1163.807) [-1162.138] (-1167.745) (-1163.428) * (-1162.464) [-1164.252] (-1162.612) (-1167.589) -- 0:00:51
      134500 -- (-1164.931) (-1162.967) (-1167.836) [-1163.725] * (-1162.270) [-1163.151] (-1163.323) (-1168.653) -- 0:00:51
      135000 -- [-1165.129] (-1161.754) (-1167.627) (-1163.835) * (-1169.232) [-1164.225] (-1162.758) (-1165.537) -- 0:00:51

      Average standard deviation of split frequencies: 0.030503

      135500 -- (-1166.286) (-1162.576) [-1164.224] (-1165.362) * (-1162.900) [-1164.031] (-1162.518) (-1165.541) -- 0:00:51
      136000 -- (-1165.767) (-1165.401) [-1163.226] (-1169.492) * (-1162.530) [-1163.087] (-1163.592) (-1164.394) -- 0:00:50
      136500 -- (-1163.012) (-1164.264) (-1164.651) [-1165.285] * [-1162.138] (-1166.685) (-1162.062) (-1163.169) -- 0:00:56
      137000 -- [-1161.966] (-1163.040) (-1167.006) (-1166.076) * (-1163.446) (-1163.247) (-1162.295) [-1163.308] -- 0:00:56
      137500 -- [-1163.043] (-1166.232) (-1165.342) (-1163.896) * (-1166.123) (-1162.049) (-1162.796) [-1167.014] -- 0:00:56
      138000 -- [-1162.377] (-1165.289) (-1164.998) (-1163.916) * (-1162.464) (-1165.510) (-1162.766) [-1165.669] -- 0:00:56
      138500 -- (-1162.451) [-1163.364] (-1164.065) (-1161.595) * [-1161.640] (-1164.567) (-1162.999) (-1167.190) -- 0:00:55
      139000 -- (-1162.544) (-1164.259) [-1161.419] (-1161.628) * (-1161.676) (-1165.470) [-1162.557] (-1166.061) -- 0:00:55
      139500 -- [-1162.108] (-1160.816) (-1163.268) (-1162.961) * (-1161.162) (-1163.002) [-1163.912] (-1163.575) -- 0:00:55
      140000 -- [-1161.132] (-1160.930) (-1162.864) (-1169.766) * (-1161.159) [-1163.616] (-1163.436) (-1169.128) -- 0:00:55

      Average standard deviation of split frequencies: 0.030831

      140500 -- (-1162.917) (-1160.930) [-1162.304] (-1164.022) * (-1161.904) (-1163.357) (-1163.215) [-1166.161] -- 0:00:55
      141000 -- (-1161.081) [-1161.050] (-1162.309) (-1162.010) * (-1161.183) (-1163.459) [-1163.235] (-1167.734) -- 0:00:54
      141500 -- (-1163.540) [-1161.277] (-1164.339) (-1162.425) * (-1163.001) [-1163.267] (-1166.033) (-1164.348) -- 0:00:54
      142000 -- [-1161.149] (-1161.663) (-1164.520) (-1163.334) * (-1163.486) [-1161.099] (-1165.684) (-1167.512) -- 0:00:54
      142500 -- (-1162.816) (-1162.507) (-1165.076) [-1163.178] * (-1162.577) (-1161.327) [-1162.280] (-1167.731) -- 0:00:54
      143000 -- (-1162.962) [-1163.039] (-1164.761) (-1166.998) * (-1162.587) (-1163.772) [-1162.781] (-1167.455) -- 0:00:53
      143500 -- [-1163.516] (-1165.604) (-1163.310) (-1164.989) * (-1163.712) (-1163.778) [-1161.983] (-1164.911) -- 0:00:53
      144000 -- (-1160.885) (-1161.456) [-1162.860] (-1162.673) * [-1163.119] (-1162.586) (-1166.079) (-1163.070) -- 0:00:53
      144500 -- (-1161.868) (-1161.456) [-1162.971] (-1161.159) * (-1163.715) (-1161.524) [-1166.058] (-1164.185) -- 0:00:53
      145000 -- (-1161.425) [-1163.811] (-1161.050) (-1161.162) * (-1163.755) [-1161.719] (-1165.420) (-1162.195) -- 0:00:53

      Average standard deviation of split frequencies: 0.027768

      145500 -- (-1160.738) [-1166.357] (-1161.041) (-1169.578) * (-1164.347) (-1162.360) (-1164.300) [-1162.809] -- 0:00:52
      146000 -- [-1162.456] (-1164.040) (-1165.755) (-1162.484) * (-1161.448) (-1162.869) (-1164.196) [-1162.037] -- 0:00:52
      146500 -- (-1162.718) (-1165.212) (-1167.402) [-1163.554] * (-1161.670) (-1163.100) (-1161.933) [-1161.618] -- 0:00:52
      147000 -- [-1162.677] (-1164.402) (-1166.563) (-1165.922) * (-1161.501) (-1164.502) (-1161.505) [-1164.803] -- 0:00:52
      147500 -- (-1161.270) (-1166.708) (-1162.023) [-1162.271] * (-1163.608) [-1164.541] (-1162.455) (-1165.267) -- 0:00:52
      148000 -- (-1163.965) (-1162.500) (-1161.278) [-1161.996] * [-1163.840] (-1164.578) (-1162.471) (-1164.815) -- 0:00:51
      148500 -- (-1163.154) (-1161.530) (-1162.773) [-1164.830] * (-1162.662) (-1164.647) [-1164.411] (-1163.993) -- 0:00:51
      149000 -- (-1162.986) (-1165.947) [-1161.662] (-1162.545) * [-1162.356] (-1163.942) (-1162.560) (-1164.552) -- 0:00:51
      149500 -- (-1163.224) [-1163.756] (-1162.302) (-1162.958) * (-1161.925) (-1162.494) (-1162.538) [-1162.293] -- 0:00:51
      150000 -- (-1165.632) (-1162.583) [-1164.157] (-1164.981) * (-1161.476) [-1161.996] (-1161.714) (-1161.852) -- 0:00:51

      Average standard deviation of split frequencies: 0.027533

      150500 -- (-1166.334) [-1163.445] (-1162.588) (-1163.719) * (-1163.127) (-1162.632) (-1161.572) [-1161.953] -- 0:00:50
      151000 -- (-1167.227) (-1164.343) [-1161.386] (-1167.129) * (-1164.525) (-1165.688) [-1161.782] (-1162.875) -- 0:00:50
      151500 -- (-1166.605) [-1162.539] (-1162.845) (-1165.753) * (-1163.169) (-1165.736) (-1165.465) [-1160.973] -- 0:00:50
      152000 -- (-1166.750) (-1163.300) (-1161.590) [-1165.008] * (-1162.144) (-1167.298) (-1165.476) [-1162.755] -- 0:00:50
      152500 -- (-1166.292) (-1165.004) [-1160.916] (-1170.403) * (-1163.915) (-1166.668) [-1162.238] (-1163.132) -- 0:00:50
      153000 -- (-1166.003) (-1162.912) (-1161.952) [-1163.236] * (-1161.537) (-1165.620) [-1163.401] (-1166.122) -- 0:00:55
      153500 -- (-1170.967) (-1164.292) [-1163.249] (-1161.550) * (-1161.928) (-1163.334) [-1164.989] (-1167.050) -- 0:00:55
      154000 -- [-1164.085] (-1164.565) (-1164.024) (-1161.903) * (-1165.086) (-1163.978) (-1162.870) [-1166.403] -- 0:00:54
      154500 -- (-1162.880) (-1163.701) (-1165.633) [-1163.804] * (-1162.841) (-1163.138) (-1163.008) [-1161.221] -- 0:00:54
      155000 -- (-1165.409) [-1164.082] (-1163.564) (-1165.069) * [-1160.835] (-1162.636) (-1163.255) (-1161.212) -- 0:00:54

      Average standard deviation of split frequencies: 0.028405

      155500 -- (-1164.999) [-1161.951] (-1161.472) (-1164.545) * (-1162.563) (-1163.083) (-1163.270) [-1161.595] -- 0:00:54
      156000 -- (-1164.838) [-1161.655] (-1163.672) (-1164.474) * (-1165.216) [-1166.276] (-1164.625) (-1164.164) -- 0:00:54
      156500 -- (-1164.428) (-1163.103) [-1163.398] (-1162.863) * (-1161.892) (-1162.547) [-1165.495] (-1161.546) -- 0:00:53
      157000 -- [-1164.626] (-1162.742) (-1163.383) (-1161.374) * (-1163.647) (-1163.076) [-1162.506] (-1163.002) -- 0:00:53
      157500 -- (-1162.492) (-1162.664) [-1162.351] (-1161.416) * [-1166.634] (-1162.115) (-1163.395) (-1161.070) -- 0:00:53
      158000 -- (-1161.664) (-1162.474) [-1162.242] (-1163.217) * (-1162.823) [-1162.603] (-1162.942) (-1160.994) -- 0:00:53
      158500 -- (-1164.738) (-1162.034) [-1162.901] (-1163.773) * (-1161.927) (-1163.626) [-1161.173] (-1166.317) -- 0:00:53
      159000 -- (-1167.577) [-1164.378] (-1165.054) (-1164.128) * (-1161.023) [-1162.269] (-1162.352) (-1161.852) -- 0:00:52
      159500 -- (-1163.721) (-1168.636) (-1163.017) [-1164.990] * (-1161.524) (-1163.230) (-1164.158) [-1162.802] -- 0:00:52
      160000 -- (-1161.843) (-1161.159) (-1162.720) [-1163.964] * [-1164.642] (-1162.776) (-1161.348) (-1160.898) -- 0:00:52

      Average standard deviation of split frequencies: 0.025820

      160500 -- (-1166.766) (-1162.407) (-1162.540) [-1161.382] * (-1164.046) [-1162.461] (-1161.800) (-1160.936) -- 0:00:52
      161000 -- (-1165.956) (-1162.799) (-1163.137) [-1163.642] * (-1163.613) [-1162.354] (-1162.761) (-1163.008) -- 0:00:52
      161500 -- (-1170.081) (-1161.666) [-1162.971] (-1162.338) * (-1162.396) [-1162.786] (-1164.839) (-1162.993) -- 0:00:51
      162000 -- (-1165.477) [-1160.852] (-1162.700) (-1163.127) * [-1163.029] (-1163.766) (-1168.441) (-1161.321) -- 0:00:51
      162500 -- (-1165.995) (-1161.501) (-1162.768) [-1161.337] * (-1161.198) (-1164.859) [-1167.736] (-1162.967) -- 0:00:51
      163000 -- [-1163.909] (-1162.421) (-1162.141) (-1166.179) * (-1168.713) (-1163.446) (-1165.075) [-1163.993] -- 0:00:51
      163500 -- [-1164.706] (-1162.349) (-1163.342) (-1163.807) * (-1169.180) (-1164.875) (-1164.588) [-1162.773] -- 0:00:51
      164000 -- (-1161.684) (-1162.704) (-1166.229) [-1164.196] * (-1168.152) [-1169.170] (-1164.621) (-1164.697) -- 0:00:50
      164500 -- (-1161.406) (-1162.713) [-1163.094] (-1161.857) * (-1166.477) (-1164.682) (-1163.661) [-1164.623] -- 0:00:50
      165000 -- (-1161.384) (-1163.550) (-1163.478) [-1164.154] * [-1168.981] (-1167.832) (-1163.373) (-1166.384) -- 0:00:50

      Average standard deviation of split frequencies: 0.025558

      165500 -- (-1161.579) (-1165.877) (-1162.263) [-1163.909] * (-1166.783) (-1163.611) (-1161.829) [-1164.340] -- 0:00:50
      166000 -- (-1162.827) (-1162.679) (-1171.074) [-1163.695] * (-1167.408) (-1163.989) (-1162.457) [-1162.732] -- 0:00:50
      166500 -- [-1161.537] (-1162.693) (-1161.674) (-1163.258) * (-1167.378) [-1162.795] (-1167.406) (-1161.369) -- 0:00:50
      167000 -- [-1163.697] (-1162.903) (-1162.371) (-1162.255) * (-1169.381) (-1162.477) [-1164.455] (-1163.686) -- 0:00:49
      167500 -- (-1162.612) [-1162.963] (-1164.957) (-1163.323) * (-1164.655) (-1168.624) (-1164.654) [-1162.461] -- 0:00:49
      168000 -- (-1163.029) [-1162.390] (-1165.861) (-1166.726) * [-1164.303] (-1162.455) (-1163.808) (-1162.574) -- 0:00:49
      168500 -- [-1162.968] (-1161.972) (-1164.747) (-1165.588) * (-1167.493) [-1161.259] (-1164.165) (-1162.685) -- 0:00:49
      169000 -- [-1162.536] (-1161.505) (-1162.862) (-1166.260) * [-1163.950] (-1161.972) (-1163.909) (-1164.129) -- 0:00:49
      169500 -- [-1161.329] (-1161.740) (-1162.632) (-1165.289) * (-1163.077) [-1162.913] (-1162.408) (-1162.813) -- 0:00:48
      170000 -- (-1162.690) [-1161.939] (-1162.294) (-1167.127) * (-1161.232) (-1166.003) [-1164.355] (-1162.502) -- 0:00:53

      Average standard deviation of split frequencies: 0.024859

      170500 -- [-1162.764] (-1165.265) (-1161.990) (-1163.050) * (-1162.190) (-1166.545) (-1163.696) [-1161.957] -- 0:00:53
      171000 -- [-1162.712] (-1161.901) (-1168.692) (-1163.766) * [-1161.727] (-1163.116) (-1162.072) (-1165.038) -- 0:00:53
      171500 -- (-1167.516) [-1162.569] (-1162.450) (-1162.303) * [-1162.041] (-1164.257) (-1161.567) (-1162.658) -- 0:00:53
      172000 -- (-1164.148) [-1161.849] (-1163.145) (-1162.542) * [-1162.112] (-1164.243) (-1163.093) (-1163.417) -- 0:00:52
      172500 -- (-1163.741) [-1161.900] (-1164.965) (-1163.444) * [-1163.484] (-1165.218) (-1162.816) (-1163.833) -- 0:00:52
      173000 -- (-1166.322) (-1161.631) (-1161.749) [-1162.299] * (-1165.545) (-1163.306) (-1162.768) [-1161.395] -- 0:00:52
      173500 -- [-1164.461] (-1163.072) (-1163.189) (-1165.843) * [-1161.326] (-1162.949) (-1162.182) (-1162.862) -- 0:00:52
      174000 -- (-1162.057) (-1163.479) [-1163.128] (-1162.626) * (-1162.374) [-1164.120] (-1162.035) (-1167.256) -- 0:00:52
      174500 -- [-1162.476] (-1162.219) (-1163.051) (-1163.419) * (-1161.849) [-1162.730] (-1162.035) (-1163.232) -- 0:00:52
      175000 -- (-1162.743) [-1164.198] (-1166.050) (-1162.463) * [-1161.961] (-1163.263) (-1162.078) (-1162.389) -- 0:00:51

      Average standard deviation of split frequencies: 0.025177

      175500 -- [-1162.954] (-1163.110) (-1166.472) (-1163.646) * (-1163.056) (-1163.876) (-1162.613) [-1163.465] -- 0:00:51
      176000 -- (-1165.032) (-1167.981) [-1162.402] (-1162.373) * (-1167.298) [-1164.578] (-1163.487) (-1164.790) -- 0:00:51
      176500 -- (-1162.974) (-1165.724) (-1165.092) [-1162.645] * (-1162.620) (-1167.906) (-1162.721) [-1165.289] -- 0:00:51
      177000 -- (-1165.836) (-1162.117) (-1163.756) [-1163.691] * (-1163.245) (-1168.050) (-1162.903) [-1163.651] -- 0:00:51
      177500 -- (-1163.517) (-1162.617) (-1167.271) [-1163.230] * [-1163.241] (-1167.212) (-1163.620) (-1164.767) -- 0:00:50
      178000 -- [-1164.332] (-1167.059) (-1163.161) (-1163.930) * (-1161.912) [-1163.162] (-1162.907) (-1166.024) -- 0:00:50
      178500 -- (-1162.194) (-1164.931) [-1162.789] (-1163.713) * (-1162.686) (-1166.213) [-1163.475] (-1167.194) -- 0:00:50
      179000 -- (-1165.624) (-1163.796) (-1162.867) [-1162.425] * (-1168.308) [-1162.677] (-1164.043) (-1163.712) -- 0:00:50
      179500 -- (-1163.009) (-1162.659) (-1161.682) [-1164.355] * (-1167.231) (-1162.170) (-1162.137) [-1164.170] -- 0:00:50
      180000 -- (-1165.455) (-1161.818) (-1162.412) [-1162.971] * (-1164.272) (-1165.773) (-1162.414) [-1162.485] -- 0:00:50

      Average standard deviation of split frequencies: 0.020874

      180500 -- [-1162.913] (-1162.106) (-1162.376) (-1162.841) * (-1164.353) (-1161.919) (-1162.479) [-1163.283] -- 0:00:49
      181000 -- [-1165.016] (-1162.519) (-1163.648) (-1162.945) * (-1162.762) [-1163.250] (-1161.944) (-1162.897) -- 0:00:49
      181500 -- [-1170.460] (-1163.829) (-1164.339) (-1164.237) * (-1161.843) (-1161.576) (-1163.521) [-1161.714] -- 0:00:49
      182000 -- (-1163.843) [-1162.637] (-1163.841) (-1162.954) * [-1161.527] (-1161.997) (-1161.976) (-1164.524) -- 0:00:49
      182500 -- (-1164.854) [-1164.394] (-1165.276) (-1163.578) * [-1164.046] (-1166.861) (-1163.176) (-1164.253) -- 0:00:49
      183000 -- (-1166.486) (-1166.641) [-1165.054] (-1164.126) * [-1162.222] (-1162.156) (-1163.727) (-1165.587) -- 0:00:49
      183500 -- (-1163.924) (-1163.333) [-1161.612] (-1163.693) * [-1161.097] (-1163.582) (-1165.404) (-1164.533) -- 0:00:48
      184000 -- (-1164.235) (-1161.768) (-1167.532) [-1162.811] * (-1164.574) [-1163.903] (-1165.267) (-1164.384) -- 0:00:48
      184500 -- (-1165.270) (-1161.347) [-1164.785] (-1164.434) * (-1164.453) (-1169.238) (-1164.950) [-1163.739] -- 0:00:48
      185000 -- [-1163.468] (-1161.681) (-1164.432) (-1164.419) * (-1163.863) (-1163.817) [-1161.638] (-1166.822) -- 0:00:48

      Average standard deviation of split frequencies: 0.019262

      185500 -- (-1166.106) [-1162.156] (-1167.239) (-1166.491) * (-1161.316) (-1163.467) (-1161.631) [-1167.703] -- 0:00:48
      186000 -- (-1162.643) [-1162.401] (-1167.406) (-1163.879) * [-1162.507] (-1162.619) (-1166.416) (-1165.196) -- 0:00:48
      186500 -- (-1162.874) [-1163.704] (-1165.625) (-1162.854) * (-1162.111) [-1166.476] (-1163.783) (-1164.514) -- 0:00:47
      187000 -- (-1163.256) (-1161.723) [-1163.190] (-1163.552) * (-1167.434) (-1166.653) (-1164.615) [-1164.099] -- 0:00:47
      187500 -- (-1163.083) [-1164.135] (-1163.027) (-1165.117) * (-1163.568) (-1163.601) [-1164.547] (-1162.041) -- 0:00:52
      188000 -- [-1163.444] (-1164.681) (-1165.179) (-1164.863) * (-1166.729) (-1163.311) (-1163.339) [-1161.896] -- 0:00:51
      188500 -- [-1162.525] (-1169.444) (-1164.208) (-1163.415) * (-1163.450) [-1163.665] (-1164.907) (-1164.175) -- 0:00:51
      189000 -- [-1161.310] (-1165.301) (-1162.168) (-1164.595) * (-1161.144) (-1161.629) [-1163.487] (-1163.960) -- 0:00:51
      189500 -- (-1164.745) (-1165.014) [-1163.188] (-1164.597) * [-1161.941] (-1165.895) (-1162.362) (-1162.238) -- 0:00:51
      190000 -- (-1161.373) [-1162.886] (-1163.721) (-1162.328) * (-1163.067) (-1166.674) (-1164.332) [-1161.809] -- 0:00:51

      Average standard deviation of split frequencies: 0.018296

      190500 -- [-1161.387] (-1167.329) (-1164.513) (-1162.722) * (-1162.084) (-1170.371) [-1163.582] (-1162.906) -- 0:00:50
      191000 -- [-1161.457] (-1164.042) (-1163.779) (-1163.394) * [-1162.554] (-1162.345) (-1166.106) (-1163.134) -- 0:00:50
      191500 -- [-1164.139] (-1165.075) (-1162.940) (-1167.630) * (-1162.850) (-1163.852) [-1165.053] (-1164.794) -- 0:00:50
      192000 -- (-1162.406) (-1166.186) [-1161.224] (-1164.756) * [-1163.783] (-1163.707) (-1162.004) (-1164.100) -- 0:00:50
      192500 -- [-1164.338] (-1162.843) (-1164.702) (-1163.306) * [-1164.251] (-1163.211) (-1166.897) (-1164.103) -- 0:00:50
      193000 -- (-1161.193) (-1164.063) (-1163.488) [-1163.124] * (-1162.393) (-1162.908) [-1165.275] (-1163.410) -- 0:00:50
      193500 -- (-1161.592) (-1162.116) (-1161.667) [-1165.584] * (-1161.051) (-1161.989) (-1164.696) [-1163.256] -- 0:00:50
      194000 -- (-1161.494) (-1162.081) (-1168.797) [-1165.030] * [-1162.443] (-1163.486) (-1164.457) (-1163.464) -- 0:00:49
      194500 -- (-1161.345) (-1162.240) (-1165.769) [-1162.353] * (-1165.287) [-1166.139] (-1166.677) (-1163.933) -- 0:00:49
      195000 -- (-1162.210) [-1162.472] (-1168.250) (-1162.376) * (-1165.490) (-1167.214) [-1165.009] (-1165.643) -- 0:00:49

      Average standard deviation of split frequencies: 0.018760

      195500 -- (-1163.416) [-1162.203] (-1167.336) (-1162.035) * (-1164.364) [-1162.569] (-1164.161) (-1167.090) -- 0:00:49
      196000 -- [-1161.054] (-1163.556) (-1162.302) (-1163.464) * [-1163.105] (-1162.096) (-1164.170) (-1162.332) -- 0:00:49
      196500 -- (-1160.936) [-1161.916] (-1165.250) (-1163.991) * (-1161.034) (-1161.157) (-1163.149) [-1161.821] -- 0:00:49
      197000 -- (-1161.705) [-1163.740] (-1161.772) (-1161.881) * (-1161.019) (-1167.842) (-1161.713) [-1162.276] -- 0:00:48
      197500 -- (-1161.705) (-1165.717) [-1162.523] (-1162.304) * [-1162.344] (-1161.701) (-1161.622) (-1161.010) -- 0:00:48
      198000 -- (-1163.511) [-1162.212] (-1162.649) (-1163.493) * [-1161.379] (-1162.187) (-1161.466) (-1160.997) -- 0:00:48
      198500 -- (-1161.492) (-1162.093) [-1165.632] (-1163.947) * [-1163.110] (-1161.653) (-1164.196) (-1162.728) -- 0:00:48
      199000 -- [-1164.093] (-1162.354) (-1162.159) (-1163.996) * (-1162.551) [-1165.038] (-1165.752) (-1167.200) -- 0:00:48
      199500 -- (-1160.905) [-1163.382] (-1163.423) (-1163.890) * (-1164.959) [-1161.748] (-1163.501) (-1164.736) -- 0:00:48
      200000 -- (-1164.089) (-1163.119) (-1164.819) [-1163.080] * (-1163.390) [-1167.324] (-1161.637) (-1164.760) -- 0:00:48

      Average standard deviation of split frequencies: 0.017384

      200500 -- (-1161.952) [-1162.395] (-1162.496) (-1164.236) * (-1164.943) [-1162.093] (-1162.235) (-1162.953) -- 0:00:47
      201000 -- (-1161.532) [-1162.465] (-1166.297) (-1162.647) * (-1164.212) [-1163.232] (-1163.276) (-1162.953) -- 0:00:47
      201500 -- (-1166.333) (-1162.596) (-1163.075) [-1162.921] * (-1163.844) (-1161.982) (-1161.484) [-1166.335] -- 0:00:47
      202000 -- [-1163.198] (-1163.305) (-1163.154) (-1167.337) * [-1163.365] (-1163.657) (-1163.959) (-1162.443) -- 0:00:47
      202500 -- (-1166.291) (-1162.402) [-1162.277] (-1166.071) * [-1164.157] (-1162.632) (-1165.262) (-1162.709) -- 0:00:47
      203000 -- [-1162.769] (-1162.073) (-1166.147) (-1162.769) * (-1165.276) (-1163.785) (-1163.721) [-1166.494] -- 0:00:51
      203500 -- [-1163.355] (-1163.699) (-1166.278) (-1162.456) * (-1166.188) (-1161.499) (-1167.527) [-1163.186] -- 0:00:50
      204000 -- (-1167.769) (-1162.484) (-1164.980) [-1163.543] * (-1163.560) (-1161.004) (-1166.662) [-1164.197] -- 0:00:50
      204500 -- (-1165.619) [-1162.873] (-1161.287) (-1163.461) * (-1164.418) (-1162.920) [-1167.508] (-1166.164) -- 0:00:50
      205000 -- (-1164.116) (-1166.061) (-1163.166) [-1162.659] * (-1166.751) (-1162.314) (-1162.293) [-1163.245] -- 0:00:50

      Average standard deviation of split frequencies: 0.017392

      205500 -- (-1163.121) [-1163.747] (-1161.995) (-1162.317) * (-1162.560) (-1164.230) (-1163.354) [-1161.858] -- 0:00:50
      206000 -- (-1165.111) (-1164.613) [-1162.561] (-1164.032) * [-1165.835] (-1163.202) (-1165.581) (-1163.360) -- 0:00:50
      206500 -- (-1163.431) [-1165.096] (-1166.568) (-1163.980) * (-1161.259) (-1163.019) (-1169.472) [-1162.676] -- 0:00:49
      207000 -- (-1161.000) (-1163.165) (-1164.280) [-1161.313] * (-1161.164) (-1164.173) (-1164.379) [-1162.886] -- 0:00:49
      207500 -- (-1162.561) (-1161.605) (-1162.716) [-1160.820] * [-1163.776] (-1162.818) (-1165.613) (-1163.466) -- 0:00:49
      208000 -- (-1161.695) [-1161.616] (-1163.760) (-1168.656) * (-1162.932) [-1162.861] (-1162.383) (-1166.412) -- 0:00:49
      208500 -- (-1164.266) (-1162.940) (-1165.113) [-1164.443] * [-1163.730] (-1163.159) (-1164.998) (-1163.685) -- 0:00:49
      209000 -- (-1165.442) (-1165.090) [-1163.317] (-1163.707) * [-1163.261] (-1162.962) (-1162.897) (-1164.293) -- 0:00:49
      209500 -- [-1161.985] (-1164.498) (-1163.912) (-1165.386) * (-1165.549) [-1162.458] (-1162.200) (-1163.319) -- 0:00:49
      210000 -- (-1164.558) (-1165.006) [-1164.904] (-1166.018) * [-1161.445] (-1162.064) (-1165.788) (-1161.916) -- 0:00:48

      Average standard deviation of split frequencies: 0.015664

      210500 -- (-1168.174) (-1165.755) [-1163.490] (-1170.495) * [-1161.414] (-1161.307) (-1164.505) (-1161.882) -- 0:00:48
      211000 -- [-1166.324] (-1161.918) (-1167.561) (-1164.217) * [-1163.953] (-1162.705) (-1164.779) (-1165.221) -- 0:00:48
      211500 -- (-1163.142) [-1162.959] (-1165.493) (-1164.764) * [-1162.509] (-1161.327) (-1164.778) (-1161.990) -- 0:00:48
      212000 -- (-1164.146) (-1162.166) [-1162.755] (-1164.119) * (-1162.465) [-1161.481] (-1161.024) (-1161.820) -- 0:00:48
      212500 -- [-1162.740] (-1162.778) (-1163.946) (-1163.139) * (-1163.826) (-1162.637) [-1161.024] (-1161.771) -- 0:00:48
      213000 -- [-1163.675] (-1162.216) (-1163.444) (-1164.474) * (-1163.743) [-1163.350] (-1162.236) (-1161.800) -- 0:00:48
      213500 -- (-1162.777) (-1164.915) [-1162.178] (-1162.577) * (-1163.387) [-1162.928] (-1161.952) (-1163.368) -- 0:00:47
      214000 -- [-1161.481] (-1162.796) (-1163.652) (-1161.751) * (-1169.789) [-1162.583] (-1162.047) (-1168.968) -- 0:00:47
      214500 -- (-1161.873) [-1161.572] (-1162.573) (-1164.072) * (-1165.441) (-1162.896) (-1162.616) [-1167.119] -- 0:00:47
      215000 -- (-1162.078) (-1164.871) [-1162.261] (-1166.658) * (-1163.480) [-1163.884] (-1161.781) (-1165.353) -- 0:00:47

      Average standard deviation of split frequencies: 0.019205

      215500 -- (-1162.026) (-1166.490) (-1161.737) [-1160.858] * [-1161.352] (-1162.221) (-1163.625) (-1164.902) -- 0:00:47
      216000 -- (-1162.397) [-1162.340] (-1161.080) (-1161.153) * (-1162.729) [-1161.785] (-1162.639) (-1163.797) -- 0:00:47
      216500 -- (-1163.041) [-1161.750] (-1163.869) (-1161.607) * (-1163.535) (-1162.035) (-1163.714) [-1164.897] -- 0:00:47
      217000 -- (-1162.225) (-1161.944) (-1162.091) [-1161.627] * (-1165.776) (-1162.479) (-1163.780) [-1163.340] -- 0:00:46
      217500 -- [-1161.265] (-1163.648) (-1162.085) (-1161.199) * (-1164.584) [-1164.246] (-1162.133) (-1162.967) -- 0:00:46
      218000 -- (-1163.316) (-1163.210) [-1163.156] (-1162.756) * (-1163.245) (-1165.160) [-1161.548] (-1161.901) -- 0:00:46
      218500 -- (-1168.143) (-1163.840) (-1162.429) [-1162.724] * (-1163.430) (-1163.321) [-1161.768] (-1162.052) -- 0:00:46
      219000 -- (-1168.655) [-1164.569] (-1162.080) (-1164.064) * (-1166.634) [-1162.652] (-1162.984) (-1163.310) -- 0:00:49
      219500 -- [-1163.838] (-1164.384) (-1161.278) (-1161.271) * (-1163.936) [-1161.848] (-1164.744) (-1162.400) -- 0:00:49
      220000 -- (-1161.970) [-1165.008] (-1163.524) (-1166.492) * (-1166.211) (-1161.503) (-1162.966) [-1162.256] -- 0:00:49

      Average standard deviation of split frequencies: 0.017517

      220500 -- [-1163.105] (-1161.710) (-1166.463) (-1162.205) * (-1166.406) [-1165.114] (-1162.521) (-1164.328) -- 0:00:49
      221000 -- (-1161.636) [-1161.740] (-1163.069) (-1161.497) * (-1161.867) (-1165.854) (-1161.887) [-1164.145] -- 0:00:49
      221500 -- (-1161.141) (-1162.835) (-1164.535) [-1162.059] * (-1163.566) (-1163.581) [-1163.115] (-1164.286) -- 0:00:49
      222000 -- [-1161.142] (-1167.337) (-1165.244) (-1161.733) * (-1161.144) (-1163.424) (-1163.131) [-1164.624] -- 0:00:49
      222500 -- (-1162.010) (-1166.862) (-1162.226) [-1162.110] * (-1161.614) (-1163.620) (-1167.544) [-1163.657] -- 0:00:48
      223000 -- [-1161.085] (-1160.990) (-1164.171) (-1163.467) * [-1162.198] (-1161.268) (-1161.296) (-1163.290) -- 0:00:48
      223500 -- (-1163.671) [-1161.037] (-1163.144) (-1162.421) * (-1162.865) (-1163.734) [-1161.713] (-1162.325) -- 0:00:48
      224000 -- [-1164.351] (-1161.035) (-1162.837) (-1163.816) * (-1162.112) (-1163.183) (-1162.736) [-1162.056] -- 0:00:48
      224500 -- [-1164.306] (-1161.322) (-1164.146) (-1161.820) * [-1162.764] (-1164.552) (-1162.726) (-1161.192) -- 0:00:48
      225000 -- (-1167.606) (-1163.737) (-1163.169) [-1161.583] * (-1161.276) [-1165.648] (-1165.772) (-1161.182) -- 0:00:48

      Average standard deviation of split frequencies: 0.020024

      225500 -- (-1166.464) (-1163.671) [-1163.272] (-1162.371) * [-1162.730] (-1167.925) (-1165.497) (-1163.381) -- 0:00:48
      226000 -- [-1162.674] (-1162.646) (-1163.968) (-1162.659) * (-1166.820) [-1166.454] (-1163.872) (-1163.456) -- 0:00:47
      226500 -- (-1163.300) (-1165.064) (-1163.554) [-1163.777] * (-1163.720) (-1164.689) [-1164.027] (-1164.837) -- 0:00:47
      227000 -- (-1166.418) (-1161.784) [-1161.756] (-1161.943) * [-1160.871] (-1163.051) (-1162.990) (-1165.155) -- 0:00:47
      227500 -- [-1166.887] (-1165.440) (-1162.722) (-1161.938) * (-1162.072) (-1162.540) (-1161.928) [-1163.809] -- 0:00:47
      228000 -- (-1166.114) (-1161.643) (-1164.253) [-1161.468] * (-1162.790) (-1164.171) (-1162.181) [-1162.912] -- 0:00:47
      228500 -- (-1169.143) [-1161.811] (-1165.422) (-1163.296) * [-1165.531] (-1162.873) (-1163.045) (-1164.046) -- 0:00:47
      229000 -- (-1165.818) (-1162.187) [-1164.047] (-1166.637) * (-1163.599) (-1164.025) [-1162.195] (-1161.493) -- 0:00:47
      229500 -- (-1164.938) (-1165.247) (-1161.911) [-1165.724] * (-1164.831) [-1163.182] (-1161.921) (-1162.060) -- 0:00:47
      230000 -- (-1164.239) (-1162.227) [-1165.823] (-1165.558) * (-1165.230) (-1163.457) [-1162.290] (-1161.486) -- 0:00:46

      Average standard deviation of split frequencies: 0.017984

      230500 -- (-1166.197) (-1163.191) (-1164.948) [-1162.564] * (-1162.864) [-1163.234] (-1167.793) (-1162.370) -- 0:00:46
      231000 -- [-1163.105] (-1166.951) (-1165.242) (-1164.523) * (-1163.551) (-1164.490) [-1167.852] (-1162.112) -- 0:00:46
      231500 -- (-1165.769) [-1164.074] (-1164.722) (-1165.935) * (-1161.796) (-1166.328) [-1166.075] (-1162.412) -- 0:00:46
      232000 -- (-1163.795) (-1163.778) [-1164.293] (-1163.744) * (-1168.662) (-1163.757) [-1168.015] (-1161.646) -- 0:00:46
      232500 -- (-1163.313) (-1164.304) (-1163.493) [-1164.051] * [-1162.799] (-1163.852) (-1162.504) (-1164.482) -- 0:00:46
      233000 -- [-1162.865] (-1164.717) (-1161.950) (-1163.713) * (-1163.218) [-1165.469] (-1162.807) (-1162.169) -- 0:00:46
      233500 -- (-1168.495) (-1165.786) [-1162.735] (-1163.668) * (-1163.530) [-1163.584] (-1161.895) (-1163.196) -- 0:00:49
      234000 -- (-1170.052) [-1163.075] (-1162.941) (-1167.103) * (-1166.021) [-1163.850] (-1161.820) (-1164.495) -- 0:00:49
      234500 -- (-1166.561) (-1162.098) [-1161.680] (-1162.254) * (-1168.367) (-1164.403) [-1162.268] (-1163.072) -- 0:00:48
      235000 -- (-1163.171) [-1161.747] (-1161.974) (-1161.919) * [-1163.149] (-1163.114) (-1164.468) (-1163.552) -- 0:00:48

      Average standard deviation of split frequencies: 0.016779

      235500 -- (-1162.094) [-1162.630] (-1163.156) (-1162.549) * (-1163.953) [-1163.952] (-1166.404) (-1162.737) -- 0:00:48
      236000 -- (-1161.940) (-1163.206) (-1163.227) [-1165.338] * (-1162.036) (-1163.757) [-1164.936] (-1162.279) -- 0:00:48
      236500 -- [-1163.306] (-1164.485) (-1165.205) (-1162.542) * (-1163.967) [-1163.245] (-1162.617) (-1162.644) -- 0:00:48
      237000 -- (-1162.347) (-1165.351) (-1163.156) [-1164.398] * [-1163.534] (-1162.582) (-1165.049) (-1161.865) -- 0:00:48
      237500 -- [-1162.029] (-1161.351) (-1161.303) (-1163.246) * (-1163.266) (-1163.539) (-1163.071) [-1161.428] -- 0:00:48
      238000 -- (-1161.620) [-1162.298] (-1162.638) (-1162.148) * (-1163.495) (-1164.766) [-1162.502] (-1161.876) -- 0:00:48
      238500 -- [-1160.750] (-1163.227) (-1164.842) (-1166.759) * (-1161.262) (-1164.476) (-1163.407) [-1163.211] -- 0:00:47
      239000 -- (-1162.387) (-1161.939) (-1163.137) [-1164.345] * (-1161.670) [-1163.679] (-1164.017) (-1166.761) -- 0:00:47
      239500 -- (-1162.364) (-1163.391) [-1162.106] (-1161.315) * (-1164.357) (-1162.427) [-1164.227] (-1167.067) -- 0:00:47
      240000 -- (-1163.068) (-1162.279) (-1163.361) [-1161.508] * (-1162.237) [-1161.663] (-1161.365) (-1163.072) -- 0:00:47

      Average standard deviation of split frequencies: 0.019196

      240500 -- (-1164.094) (-1162.042) [-1161.252] (-1161.283) * (-1164.958) (-1164.980) [-1163.092] (-1163.580) -- 0:00:47
      241000 -- (-1163.147) (-1162.167) [-1161.924] (-1161.850) * (-1162.912) (-1164.358) [-1164.124] (-1163.663) -- 0:00:47
      241500 -- (-1164.615) (-1164.536) [-1163.007] (-1161.401) * (-1162.038) [-1161.914] (-1164.433) (-1163.682) -- 0:00:47
      242000 -- (-1166.609) (-1162.736) [-1161.825] (-1164.162) * (-1164.231) [-1161.896] (-1162.284) (-1162.502) -- 0:00:46
      242500 -- (-1162.533) (-1161.562) [-1162.396] (-1161.943) * [-1162.911] (-1162.910) (-1162.033) (-1165.170) -- 0:00:46
      243000 -- (-1163.529) (-1161.903) [-1163.806] (-1163.509) * [-1165.917] (-1161.548) (-1163.202) (-1164.928) -- 0:00:46
      243500 -- [-1161.215] (-1161.510) (-1162.688) (-1165.144) * (-1161.546) [-1161.778] (-1161.459) (-1165.723) -- 0:00:46
      244000 -- (-1162.297) [-1165.544] (-1167.445) (-1164.711) * (-1163.344) (-1162.784) (-1162.457) [-1163.453] -- 0:00:46
      244500 -- [-1164.298] (-1161.308) (-1163.501) (-1166.167) * [-1162.763] (-1161.854) (-1166.435) (-1164.481) -- 0:00:46
      245000 -- (-1166.330) (-1167.281) (-1162.492) [-1161.740] * [-1164.643] (-1162.184) (-1164.154) (-1162.128) -- 0:00:46

      Average standard deviation of split frequencies: 0.020313

      245500 -- (-1170.939) (-1164.970) (-1163.724) [-1162.996] * [-1163.223] (-1163.336) (-1162.120) (-1162.821) -- 0:00:46
      246000 -- (-1163.828) (-1166.917) [-1165.846] (-1163.366) * [-1164.576] (-1165.326) (-1162.740) (-1162.558) -- 0:00:45
      246500 -- [-1161.290] (-1165.541) (-1163.171) (-1163.061) * (-1164.463) (-1168.321) [-1162.346] (-1163.369) -- 0:00:45
      247000 -- (-1162.260) [-1163.904] (-1162.480) (-1164.965) * (-1164.933) (-1165.001) (-1162.602) [-1162.140] -- 0:00:45
      247500 -- (-1161.562) [-1162.471] (-1166.773) (-1164.876) * (-1163.238) [-1161.549] (-1162.822) (-1163.111) -- 0:00:45
      248000 -- (-1163.757) (-1165.419) [-1162.180] (-1166.248) * (-1165.739) (-1164.225) (-1167.062) [-1165.032] -- 0:00:45
      248500 -- (-1163.333) (-1164.682) [-1162.604] (-1165.331) * (-1166.304) (-1163.245) (-1165.816) [-1162.895] -- 0:00:45
      249000 -- (-1164.295) (-1164.018) (-1167.688) [-1162.056] * (-1164.267) (-1163.661) (-1164.287) [-1164.841] -- 0:00:45
      249500 -- (-1162.401) (-1162.287) [-1162.646] (-1163.844) * [-1162.701] (-1165.367) (-1164.101) (-1165.886) -- 0:00:48
      250000 -- (-1162.133) [-1161.697] (-1161.793) (-1162.347) * (-1163.758) [-1163.579] (-1164.283) (-1165.270) -- 0:00:48

      Average standard deviation of split frequencies: 0.020311

      250500 -- (-1162.443) [-1162.083] (-1162.404) (-1162.591) * [-1162.018] (-1163.522) (-1167.866) (-1163.381) -- 0:00:47
      251000 -- (-1162.411) (-1161.034) (-1160.841) [-1162.913] * [-1164.404] (-1165.579) (-1163.255) (-1162.730) -- 0:00:47
      251500 -- (-1168.445) (-1161.405) (-1161.502) [-1161.347] * (-1162.233) (-1162.371) (-1163.587) [-1162.100] -- 0:00:47
      252000 -- [-1165.227] (-1162.650) (-1162.119) (-1162.570) * (-1162.232) (-1164.046) [-1164.007] (-1162.200) -- 0:00:47
      252500 -- [-1165.232] (-1162.432) (-1162.205) (-1164.404) * (-1162.770) (-1173.821) (-1164.682) [-1162.554] -- 0:00:47
      253000 -- (-1163.798) [-1162.274] (-1162.233) (-1165.380) * (-1161.775) (-1169.247) [-1162.609] (-1163.056) -- 0:00:47
      253500 -- (-1165.361) [-1166.176] (-1163.600) (-1163.325) * [-1163.041] (-1163.904) (-1167.958) (-1166.573) -- 0:00:47
      254000 -- (-1160.914) (-1163.263) (-1162.385) [-1161.028] * (-1163.645) (-1165.519) (-1163.445) [-1163.598] -- 0:00:46
      254500 -- (-1160.992) (-1161.571) [-1162.476] (-1160.877) * [-1163.257] (-1166.559) (-1161.084) (-1163.846) -- 0:00:46
      255000 -- (-1164.144) (-1166.006) (-1163.078) [-1161.304] * (-1163.812) (-1168.192) (-1161.172) [-1161.100] -- 0:00:46

      Average standard deviation of split frequencies: 0.019151

      255500 -- (-1161.625) (-1164.464) [-1165.395] (-1161.721) * [-1162.491] (-1162.168) (-1162.996) (-1162.623) -- 0:00:46
      256000 -- (-1163.854) (-1163.074) (-1161.330) [-1162.176] * (-1163.098) [-1162.833] (-1162.866) (-1162.617) -- 0:00:46
      256500 -- (-1161.909) (-1164.032) [-1161.058] (-1163.195) * (-1162.909) (-1162.726) (-1164.489) [-1162.388] -- 0:00:46
      257000 -- (-1164.415) (-1170.570) (-1160.825) [-1162.897] * [-1162.672] (-1162.878) (-1163.966) (-1163.132) -- 0:00:46
      257500 -- (-1161.759) (-1167.613) [-1161.051] (-1163.425) * (-1163.072) (-1168.359) [-1165.314] (-1163.527) -- 0:00:46
      258000 -- (-1162.262) (-1161.608) [-1161.135] (-1165.440) * (-1162.978) (-1168.010) (-1164.086) [-1166.223] -- 0:00:46
      258500 -- [-1161.308] (-1163.433) (-1161.713) (-1162.640) * (-1166.628) (-1168.851) [-1162.499] (-1167.107) -- 0:00:45
      259000 -- (-1161.093) [-1165.556] (-1163.472) (-1163.411) * (-1162.626) (-1166.960) (-1163.385) [-1162.874] -- 0:00:45
      259500 -- [-1163.017] (-1163.732) (-1164.036) (-1163.214) * (-1161.760) (-1163.892) (-1165.220) [-1162.960] -- 0:00:45
      260000 -- (-1163.723) (-1161.324) [-1164.737] (-1162.829) * (-1165.449) [-1165.540] (-1164.355) (-1163.954) -- 0:00:45

      Average standard deviation of split frequencies: 0.020616

      260500 -- (-1162.583) (-1162.868) [-1164.452] (-1163.342) * (-1164.850) (-1163.749) [-1165.260] (-1164.415) -- 0:00:45
      261000 -- [-1166.446] (-1164.579) (-1161.332) (-1163.895) * (-1164.519) (-1163.554) (-1165.286) [-1165.131] -- 0:00:45
      261500 -- (-1163.632) (-1163.132) (-1162.598) [-1164.446] * [-1167.722] (-1166.975) (-1162.771) (-1163.073) -- 0:00:45
      262000 -- (-1164.774) (-1164.208) (-1164.609) [-1166.042] * (-1166.960) (-1166.587) (-1163.537) [-1163.233] -- 0:00:45
      262500 -- [-1164.463] (-1166.462) (-1162.553) (-1163.943) * (-1162.101) [-1161.179] (-1162.981) (-1166.492) -- 0:00:44
      263000 -- (-1164.654) (-1166.103) (-1162.395) [-1167.132] * (-1163.676) [-1161.299] (-1161.465) (-1163.838) -- 0:00:44
      263500 -- (-1163.787) (-1164.985) [-1163.809] (-1163.517) * [-1163.268] (-1162.256) (-1163.368) (-1165.098) -- 0:00:44
      264000 -- (-1162.631) (-1162.554) (-1164.178) [-1161.672] * (-1162.942) (-1162.168) [-1163.277] (-1164.622) -- 0:00:44
      264500 -- (-1166.807) [-1162.745] (-1165.398) (-1161.455) * (-1163.362) (-1162.453) [-1163.858] (-1164.116) -- 0:00:44
      265000 -- (-1167.576) (-1162.195) [-1163.860] (-1161.880) * (-1166.179) (-1161.213) (-1168.321) [-1162.540] -- 0:00:44

      Average standard deviation of split frequencies: 0.019494

      265500 -- (-1164.436) (-1161.693) (-1161.523) [-1162.358] * (-1163.190) (-1163.051) [-1161.767] (-1161.054) -- 0:00:44
      266000 -- (-1161.548) (-1163.013) (-1164.036) [-1162.498] * (-1164.915) [-1161.075] (-1162.685) (-1161.139) -- 0:00:46
      266500 -- (-1162.795) (-1163.262) (-1163.068) [-1161.708] * (-1163.511) [-1161.233] (-1161.538) (-1162.013) -- 0:00:46
      267000 -- (-1163.286) (-1163.943) (-1166.963) [-1162.313] * (-1161.866) (-1162.415) [-1162.089] (-1162.226) -- 0:00:46
      267500 -- (-1162.176) (-1162.885) [-1164.745] (-1169.483) * (-1165.156) (-1165.354) (-1162.748) [-1162.381] -- 0:00:46
      268000 -- [-1164.914] (-1165.708) (-1163.346) (-1170.958) * (-1161.731) (-1162.465) [-1162.158] (-1165.135) -- 0:00:46
      268500 -- (-1163.345) (-1166.251) [-1164.014] (-1165.953) * (-1164.608) (-1162.033) [-1163.323] (-1164.330) -- 0:00:46
      269000 -- (-1160.913) (-1162.290) [-1163.210] (-1164.938) * (-1167.236) (-1162.421) (-1163.769) [-1164.830] -- 0:00:46
      269500 -- (-1161.402) (-1165.449) [-1161.281] (-1164.251) * (-1165.011) (-1162.636) [-1163.532] (-1162.380) -- 0:00:46
      270000 -- [-1161.915] (-1163.486) (-1162.624) (-1163.431) * (-1164.154) (-1161.136) (-1162.950) [-1164.215] -- 0:00:45

      Average standard deviation of split frequencies: 0.019158

      270500 -- (-1161.796) (-1162.489) (-1164.475) [-1162.234] * (-1164.119) (-1161.299) [-1164.307] (-1162.214) -- 0:00:45
      271000 -- [-1161.021] (-1161.111) (-1164.047) (-1164.355) * [-1162.321] (-1164.079) (-1164.112) (-1163.785) -- 0:00:45
      271500 -- [-1160.743] (-1161.851) (-1165.533) (-1163.358) * (-1165.712) [-1165.434] (-1162.948) (-1168.410) -- 0:00:45
      272000 -- (-1161.939) [-1162.068] (-1164.295) (-1165.970) * [-1162.054] (-1166.909) (-1162.947) (-1163.908) -- 0:00:45
      272500 -- (-1160.780) [-1162.568] (-1164.042) (-1164.049) * (-1165.856) (-1167.160) [-1165.053] (-1164.713) -- 0:00:45
      273000 -- (-1161.686) (-1162.649) (-1164.824) [-1163.532] * (-1165.651) (-1167.173) (-1163.117) [-1164.392] -- 0:00:45
      273500 -- [-1161.255] (-1164.718) (-1164.212) (-1161.789) * [-1164.065] (-1162.393) (-1164.284) (-1166.253) -- 0:00:45
      274000 -- [-1165.275] (-1166.673) (-1166.840) (-1162.754) * [-1162.852] (-1163.378) (-1167.530) (-1168.083) -- 0:00:45
      274500 -- (-1166.783) [-1165.858] (-1165.780) (-1161.632) * (-1163.348) [-1164.266] (-1169.794) (-1163.912) -- 0:00:44
      275000 -- (-1166.881) [-1161.706] (-1165.423) (-1165.268) * (-1162.230) (-1164.872) [-1168.433] (-1163.303) -- 0:00:44

      Average standard deviation of split frequencies: 0.017421

      275500 -- (-1165.923) [-1163.606] (-1162.065) (-1167.956) * (-1163.949) [-1165.796] (-1163.075) (-1162.781) -- 0:00:44
      276000 -- (-1163.603) (-1165.348) [-1164.064] (-1166.094) * [-1166.600] (-1167.860) (-1164.960) (-1163.003) -- 0:00:44
      276500 -- (-1163.174) (-1163.411) (-1164.628) [-1163.204] * (-1165.066) (-1163.973) (-1163.003) [-1161.922] -- 0:00:44
      277000 -- (-1165.199) [-1166.517] (-1163.674) (-1162.914) * (-1163.992) (-1164.016) [-1164.561] (-1162.704) -- 0:00:44
      277500 -- (-1164.746) (-1163.460) (-1162.247) [-1162.197] * (-1165.518) (-1165.804) [-1163.459] (-1163.668) -- 0:00:44
      278000 -- (-1169.391) [-1163.429] (-1163.657) (-1164.444) * (-1166.054) (-1161.333) [-1162.759] (-1163.529) -- 0:00:44
      278500 -- [-1163.126] (-1164.263) (-1165.333) (-1165.266) * (-1165.006) (-1161.205) [-1162.830] (-1164.989) -- 0:00:44
      279000 -- (-1162.466) [-1165.666] (-1161.436) (-1161.557) * (-1163.900) (-1166.912) [-1161.490] (-1163.336) -- 0:00:43
      279500 -- (-1162.823) [-1161.632] (-1162.953) (-1161.674) * (-1163.145) (-1166.792) [-1164.677] (-1163.366) -- 0:00:43
      280000 -- (-1161.975) [-1163.740] (-1162.965) (-1161.418) * (-1163.880) (-1163.108) (-1163.790) [-1164.401] -- 0:00:43

      Average standard deviation of split frequencies: 0.014780

      280500 -- [-1161.720] (-1165.140) (-1163.756) (-1160.732) * [-1167.542] (-1164.808) (-1163.638) (-1164.345) -- 0:00:43
      281000 -- [-1161.745] (-1162.591) (-1163.681) (-1162.831) * (-1164.118) (-1161.618) (-1163.805) [-1162.583] -- 0:00:43
      281500 -- (-1162.690) [-1162.549] (-1164.465) (-1162.714) * (-1163.919) [-1164.721] (-1162.873) (-1161.400) -- 0:00:43
      282000 -- (-1163.582) [-1163.333] (-1165.913) (-1165.787) * (-1164.509) (-1161.977) (-1163.726) [-1161.511] -- 0:00:43
      282500 -- [-1163.355] (-1162.225) (-1166.599) (-1163.229) * [-1163.408] (-1162.473) (-1165.150) (-1161.384) -- 0:00:45
      283000 -- (-1161.358) (-1163.454) (-1170.949) [-1161.835] * [-1162.658] (-1165.235) (-1163.059) (-1162.362) -- 0:00:45
      283500 -- (-1162.523) (-1163.473) (-1162.067) [-1163.188] * (-1165.481) (-1163.413) (-1163.049) [-1162.874] -- 0:00:45
      284000 -- (-1163.037) [-1160.888] (-1162.683) (-1161.696) * [-1161.462] (-1162.887) (-1162.423) (-1166.046) -- 0:00:45
      284500 -- [-1166.943] (-1162.352) (-1162.879) (-1161.355) * (-1162.659) [-1163.089] (-1166.200) (-1163.492) -- 0:00:45
      285000 -- [-1165.225] (-1162.625) (-1162.216) (-1161.427) * [-1164.348] (-1165.482) (-1162.241) (-1161.618) -- 0:00:45

      Average standard deviation of split frequencies: 0.013845

      285500 -- (-1169.442) (-1162.077) (-1163.481) [-1161.698] * (-1162.812) (-1165.027) (-1163.072) [-1165.311] -- 0:00:45
      286000 -- (-1164.881) (-1163.785) (-1164.923) [-1161.687] * (-1161.209) [-1162.545] (-1163.907) (-1162.944) -- 0:00:44
      286500 -- [-1161.940] (-1166.435) (-1163.061) (-1161.677) * [-1161.711] (-1163.367) (-1166.678) (-1164.066) -- 0:00:44
      287000 -- (-1163.961) (-1166.073) (-1161.374) [-1162.368] * (-1161.641) (-1162.904) (-1164.335) [-1165.134] -- 0:00:44
      287500 -- (-1164.994) (-1163.873) (-1161.834) [-1163.373] * (-1162.769) (-1163.448) (-1164.328) [-1161.876] -- 0:00:44
      288000 -- [-1170.156] (-1166.732) (-1161.829) (-1163.665) * (-1165.766) [-1163.005] (-1166.057) (-1165.148) -- 0:00:44
      288500 -- (-1162.517) (-1164.745) (-1161.706) [-1168.435] * (-1166.922) [-1163.199] (-1166.528) (-1163.080) -- 0:00:44
      289000 -- [-1162.476] (-1161.904) (-1162.753) (-1164.525) * (-1164.434) (-1165.536) (-1165.592) [-1162.743] -- 0:00:44
      289500 -- (-1163.875) [-1162.291] (-1164.192) (-1166.402) * (-1163.674) [-1162.512] (-1165.266) (-1165.852) -- 0:00:44
      290000 -- (-1165.427) (-1163.113) [-1161.157] (-1162.670) * [-1164.148] (-1163.699) (-1162.462) (-1164.877) -- 0:00:44

      Average standard deviation of split frequencies: 0.012974

      290500 -- (-1167.733) (-1163.341) (-1163.548) [-1162.172] * [-1161.244] (-1162.581) (-1162.965) (-1163.539) -- 0:00:43
      291000 -- (-1162.545) (-1163.076) [-1166.390] (-1165.306) * [-1161.181] (-1162.019) (-1165.354) (-1165.714) -- 0:00:43
      291500 -- (-1162.233) [-1161.885] (-1166.801) (-1166.270) * [-1161.187] (-1161.417) (-1165.975) (-1163.859) -- 0:00:43
      292000 -- (-1167.012) (-1162.128) [-1163.494] (-1161.349) * (-1161.383) [-1161.455] (-1170.253) (-1161.604) -- 0:00:43
      292500 -- (-1166.095) (-1162.013) (-1163.728) [-1161.372] * (-1161.706) [-1161.513] (-1168.488) (-1162.092) -- 0:00:43
      293000 -- (-1161.574) [-1161.749] (-1162.764) (-1162.595) * (-1163.829) (-1161.821) [-1165.089] (-1163.777) -- 0:00:43
      293500 -- (-1161.907) [-1162.203] (-1162.667) (-1168.498) * (-1166.199) (-1162.567) [-1164.376] (-1165.356) -- 0:00:43
      294000 -- [-1161.915] (-1161.308) (-1163.699) (-1170.480) * [-1162.372] (-1161.584) (-1162.405) (-1161.776) -- 0:00:43
      294500 -- (-1163.998) [-1161.248] (-1165.014) (-1164.786) * (-1161.301) (-1162.454) (-1162.067) [-1163.639] -- 0:00:43
      295000 -- (-1163.273) [-1163.392] (-1165.529) (-1167.065) * (-1161.301) [-1162.145] (-1161.242) (-1163.941) -- 0:00:43

      Average standard deviation of split frequencies: 0.012422

      295500 -- [-1162.064] (-1164.284) (-1163.783) (-1164.864) * (-1160.972) (-1164.426) [-1160.854] (-1162.021) -- 0:00:42
      296000 -- [-1161.584] (-1161.692) (-1163.708) (-1166.489) * (-1163.121) (-1163.775) [-1162.201] (-1164.995) -- 0:00:42
      296500 -- [-1161.341] (-1161.897) (-1163.882) (-1167.504) * [-1163.015] (-1162.013) (-1164.014) (-1164.271) -- 0:00:42
      297000 -- (-1163.003) (-1161.894) [-1161.637] (-1166.967) * (-1161.758) [-1162.006] (-1164.941) (-1163.031) -- 0:00:42
      297500 -- (-1164.567) [-1162.166] (-1162.020) (-1163.458) * [-1163.267] (-1161.235) (-1165.219) (-1161.648) -- 0:00:42
      298000 -- [-1162.004] (-1165.550) (-1163.514) (-1165.267) * (-1162.998) [-1163.876] (-1168.278) (-1168.058) -- 0:00:42
      298500 -- (-1162.999) (-1162.704) (-1162.134) [-1166.622] * (-1164.255) (-1163.019) [-1163.450] (-1163.014) -- 0:00:42
      299000 -- [-1162.012] (-1166.801) (-1167.009) (-1166.553) * (-1162.645) (-1163.051) (-1164.513) [-1165.671] -- 0:00:42
      299500 -- (-1161.415) (-1166.742) (-1164.886) [-1163.263] * (-1162.954) (-1162.929) [-1168.358] (-1166.083) -- 0:00:44
      300000 -- (-1162.943) [-1162.984] (-1163.190) (-1164.060) * (-1162.898) (-1164.781) [-1162.766] (-1162.517) -- 0:00:44

      Average standard deviation of split frequencies: 0.013484

      300500 -- (-1164.730) (-1167.462) [-1162.674] (-1161.583) * (-1165.823) (-1162.964) (-1164.439) [-1162.222] -- 0:00:44
      301000 -- (-1165.691) (-1165.732) [-1161.952] (-1164.068) * (-1165.564) (-1161.639) [-1164.000] (-1165.484) -- 0:00:44
      301500 -- (-1167.568) (-1161.648) (-1163.382) [-1167.111] * (-1162.945) [-1161.253] (-1163.642) (-1164.164) -- 0:00:44
      302000 -- (-1163.351) [-1161.893] (-1162.100) (-1166.632) * (-1167.997) (-1162.542) (-1163.649) [-1167.455] -- 0:00:43
      302500 -- (-1163.304) (-1161.673) (-1162.672) [-1164.053] * (-1161.696) (-1161.532) (-1163.046) [-1163.981] -- 0:00:43
      303000 -- (-1166.236) (-1161.683) (-1162.901) [-1161.622] * (-1161.370) [-1161.572] (-1161.741) (-1165.053) -- 0:00:43
      303500 -- (-1165.615) [-1162.435] (-1162.119) (-1161.705) * (-1165.333) (-1164.787) (-1162.574) [-1166.600] -- 0:00:43
      304000 -- (-1163.659) (-1165.203) (-1164.195) [-1165.444] * (-1165.621) (-1168.365) [-1161.946] (-1166.360) -- 0:00:43
      304500 -- [-1164.270] (-1163.213) (-1162.102) (-1166.177) * (-1166.847) [-1162.430] (-1162.023) (-1163.673) -- 0:00:43
      305000 -- (-1162.596) (-1163.500) (-1162.270) [-1162.486] * (-1165.008) (-1162.658) [-1165.139] (-1161.243) -- 0:00:43

      Average standard deviation of split frequencies: 0.012016

      305500 -- (-1162.541) (-1164.140) (-1166.677) [-1166.400] * (-1164.865) (-1166.464) [-1163.710] (-1161.539) -- 0:00:43
      306000 -- (-1161.679) (-1163.616) [-1166.130] (-1162.409) * (-1163.063) (-1161.821) [-1162.285] (-1161.497) -- 0:00:43
      306500 -- (-1162.963) [-1164.625] (-1162.435) (-1164.015) * (-1163.370) (-1161.607) (-1161.671) [-1162.345] -- 0:00:42
      307000 -- (-1165.479) [-1162.894] (-1162.682) (-1163.503) * (-1163.138) (-1166.004) (-1165.178) [-1163.731] -- 0:00:42
      307500 -- (-1166.900) (-1162.456) [-1163.707] (-1163.103) * (-1164.032) (-1162.518) (-1161.776) [-1165.754] -- 0:00:42
      308000 -- (-1164.697) [-1162.591] (-1161.748) (-1162.813) * (-1162.384) (-1163.523) [-1161.955] (-1164.562) -- 0:00:42
      308500 -- (-1163.910) (-1166.620) [-1161.834] (-1165.453) * (-1163.717) [-1162.249] (-1162.797) (-1162.677) -- 0:00:42
      309000 -- (-1164.123) [-1162.333] (-1162.079) (-1162.097) * (-1162.451) (-1163.756) [-1164.121] (-1161.861) -- 0:00:42
      309500 -- (-1163.403) (-1162.154) [-1161.007] (-1165.196) * [-1161.325] (-1163.090) (-1163.859) (-1163.871) -- 0:00:42
      310000 -- (-1164.260) (-1164.019) [-1164.967] (-1164.419) * (-1164.950) [-1161.788] (-1162.670) (-1162.492) -- 0:00:42

      Average standard deviation of split frequencies: 0.011532

      310500 -- [-1163.120] (-1163.900) (-1164.030) (-1162.029) * (-1165.404) (-1161.998) (-1162.302) [-1166.598] -- 0:00:42
      311000 -- (-1166.516) (-1163.398) (-1166.227) [-1161.679] * (-1162.345) [-1165.216] (-1162.379) (-1162.354) -- 0:00:42
      311500 -- (-1163.054) (-1162.009) [-1161.633] (-1161.909) * (-1164.405) [-1162.442] (-1162.184) (-1163.224) -- 0:00:41
      312000 -- (-1162.679) (-1161.437) [-1163.432] (-1163.227) * (-1165.798) (-1162.712) [-1162.530] (-1164.300) -- 0:00:41
      312500 -- (-1164.067) [-1161.462] (-1163.721) (-1164.451) * (-1165.979) (-1162.429) (-1168.982) [-1168.111] -- 0:00:41
      313000 -- (-1163.378) (-1165.281) (-1164.902) [-1162.935] * [-1164.959] (-1163.539) (-1167.397) (-1170.119) -- 0:00:41
      313500 -- (-1165.342) (-1163.004) (-1161.927) [-1162.635] * (-1165.979) [-1165.108] (-1166.086) (-1162.509) -- 0:00:41
      314000 -- [-1163.643] (-1162.506) (-1161.461) (-1163.168) * (-1163.753) (-1162.265) (-1164.093) [-1164.136] -- 0:00:41
      314500 -- (-1163.519) (-1172.607) (-1164.349) [-1162.563] * (-1161.725) [-1162.259] (-1165.345) (-1163.940) -- 0:00:41
      315000 -- (-1162.671) (-1166.070) (-1164.774) [-1161.565] * (-1166.627) (-1164.407) (-1164.825) [-1160.902] -- 0:00:41

      Average standard deviation of split frequencies: 0.011636

      315500 -- [-1162.058] (-1165.392) (-1165.161) (-1163.091) * [-1164.594] (-1164.404) (-1162.226) (-1161.518) -- 0:00:41
      316000 -- (-1162.920) (-1161.588) (-1163.535) [-1163.685] * (-1164.143) (-1161.732) (-1163.799) [-1162.023] -- 0:00:43
      316500 -- (-1162.874) (-1162.375) [-1162.666] (-1162.184) * (-1164.696) (-1161.740) (-1162.488) [-1162.278] -- 0:00:43
      317000 -- (-1162.298) (-1163.447) [-1163.211] (-1161.976) * [-1161.467] (-1167.946) (-1165.462) (-1161.832) -- 0:00:43
      317500 -- (-1162.382) (-1162.247) [-1161.499] (-1163.312) * (-1161.335) (-1168.165) [-1165.392] (-1161.970) -- 0:00:42
      318000 -- [-1161.464] (-1162.949) (-1164.219) (-1167.028) * [-1161.411] (-1167.040) (-1165.896) (-1162.537) -- 0:00:42
      318500 -- (-1163.695) (-1164.499) [-1163.492] (-1167.657) * [-1162.432] (-1164.075) (-1163.423) (-1161.967) -- 0:00:42
      319000 -- (-1162.703) [-1161.528] (-1164.343) (-1164.553) * (-1163.875) (-1164.180) [-1161.675] (-1162.814) -- 0:00:42
      319500 -- (-1164.218) [-1164.234] (-1166.878) (-1160.757) * (-1165.406) (-1165.481) [-1161.935] (-1163.464) -- 0:00:42
      320000 -- (-1164.767) [-1163.190] (-1163.229) (-1165.036) * (-1164.197) (-1166.836) [-1162.761] (-1162.040) -- 0:00:42

      Average standard deviation of split frequencies: 0.009703

      320500 -- [-1164.225] (-1163.129) (-1163.046) (-1162.381) * (-1161.960) [-1162.579] (-1165.101) (-1165.590) -- 0:00:42
      321000 -- [-1164.208] (-1165.443) (-1162.163) (-1162.760) * (-1162.616) (-1161.349) [-1163.808] (-1162.278) -- 0:00:42
      321500 -- [-1163.421] (-1167.644) (-1161.396) (-1164.959) * (-1161.499) [-1166.918] (-1168.092) (-1163.423) -- 0:00:42
      322000 -- [-1160.958] (-1167.510) (-1161.314) (-1165.114) * (-1164.016) [-1161.683] (-1168.319) (-1164.288) -- 0:00:42
      322500 -- [-1160.958] (-1167.423) (-1162.538) (-1162.196) * (-1163.673) (-1162.163) [-1163.888] (-1165.029) -- 0:00:42
      323000 -- [-1163.900] (-1164.283) (-1161.943) (-1162.302) * [-1164.024] (-1161.698) (-1163.305) (-1165.293) -- 0:00:41
      323500 -- (-1164.994) [-1164.580] (-1164.309) (-1161.623) * (-1161.400) [-1161.699] (-1164.026) (-1166.234) -- 0:00:41
      324000 -- [-1166.645] (-1165.072) (-1163.170) (-1161.617) * (-1165.976) [-1162.472] (-1165.423) (-1164.998) -- 0:00:41
      324500 -- (-1167.387) [-1162.716] (-1162.156) (-1162.154) * [-1167.047] (-1162.623) (-1165.177) (-1163.242) -- 0:00:41
      325000 -- (-1161.450) [-1162.615] (-1162.356) (-1162.971) * (-1164.142) (-1161.469) (-1163.997) [-1161.327] -- 0:00:41

      Average standard deviation of split frequencies: 0.010990

      325500 -- (-1161.354) (-1166.577) (-1165.871) [-1164.893] * (-1161.412) (-1164.661) [-1164.453] (-1162.952) -- 0:00:41
      326000 -- (-1163.797) (-1166.070) (-1166.555) [-1162.708] * [-1162.698] (-1165.450) (-1163.301) (-1166.646) -- 0:00:41
      326500 -- [-1163.280] (-1164.067) (-1164.322) (-1163.143) * (-1161.477) [-1161.205] (-1164.124) (-1167.445) -- 0:00:41
      327000 -- (-1165.415) [-1161.779] (-1167.021) (-1163.408) * (-1161.649) [-1163.242] (-1162.499) (-1163.828) -- 0:00:41
      327500 -- (-1163.387) [-1161.862] (-1161.752) (-1163.146) * [-1163.128] (-1166.383) (-1162.159) (-1161.059) -- 0:00:41
      328000 -- (-1161.995) [-1161.576] (-1162.758) (-1165.034) * (-1162.841) [-1167.810] (-1163.742) (-1162.971) -- 0:00:40
      328500 -- (-1161.372) (-1162.710) [-1161.782] (-1164.620) * [-1163.832] (-1161.759) (-1167.041) (-1162.210) -- 0:00:40
      329000 -- [-1162.906] (-1162.109) (-1161.774) (-1167.246) * (-1164.458) (-1163.180) (-1165.836) [-1163.382] -- 0:00:40
      329500 -- [-1161.492] (-1162.558) (-1164.602) (-1163.777) * (-1161.342) (-1163.231) [-1166.880] (-1163.932) -- 0:00:40
      330000 -- (-1162.815) (-1165.343) [-1163.084] (-1162.137) * (-1162.443) (-1162.085) (-1165.081) [-1162.044] -- 0:00:40

      Average standard deviation of split frequencies: 0.009409

      330500 -- (-1160.833) [-1161.643] (-1164.857) (-1161.680) * (-1165.477) (-1165.070) (-1168.742) [-1162.260] -- 0:00:40
      331000 -- (-1161.590) (-1163.336) (-1162.694) [-1161.764] * (-1163.381) [-1161.853] (-1161.696) (-1162.008) -- 0:00:40
      331500 -- (-1161.765) [-1162.237] (-1164.304) (-1161.858) * (-1165.333) (-1163.028) (-1163.279) [-1161.867] -- 0:00:40
      332000 -- (-1162.831) [-1162.507] (-1165.706) (-1162.036) * [-1165.565] (-1163.786) (-1162.979) (-1163.055) -- 0:00:40
      332500 -- (-1162.147) [-1162.856] (-1165.415) (-1164.537) * (-1163.221) (-1165.730) (-1164.008) [-1162.048] -- 0:00:40
      333000 -- [-1163.909] (-1162.807) (-1162.272) (-1162.338) * (-1167.898) (-1162.973) (-1162.299) [-1162.024] -- 0:00:42
      333500 -- [-1163.971] (-1162.727) (-1162.459) (-1162.528) * (-1168.293) [-1162.124] (-1167.396) (-1165.327) -- 0:00:41
      334000 -- (-1164.909) (-1170.866) [-1162.398] (-1162.206) * (-1161.524) (-1163.223) (-1164.706) [-1162.978] -- 0:00:41
      334500 -- (-1169.557) (-1163.447) (-1162.950) [-1161.911] * [-1165.708] (-1162.929) (-1161.637) (-1165.053) -- 0:00:41
      335000 -- (-1166.867) (-1165.932) (-1165.728) [-1163.166] * [-1164.450] (-1164.790) (-1162.565) (-1163.191) -- 0:00:41

      Average standard deviation of split frequencies: 0.009821

      335500 -- [-1163.054] (-1161.461) (-1161.838) (-1164.020) * (-1165.178) [-1162.739] (-1163.043) (-1163.461) -- 0:00:41
      336000 -- (-1163.574) (-1163.181) (-1163.368) [-1163.836] * (-1164.303) (-1167.191) (-1166.268) [-1164.638] -- 0:00:41
      336500 -- (-1164.063) (-1163.138) [-1162.625] (-1162.811) * [-1163.274] (-1163.772) (-1165.891) (-1163.341) -- 0:00:41
      337000 -- (-1163.182) (-1161.285) (-1165.308) [-1161.595] * (-1161.063) (-1162.908) [-1162.573] (-1163.759) -- 0:00:41
      337500 -- [-1161.280] (-1164.053) (-1163.480) (-1164.695) * [-1161.067] (-1162.469) (-1161.892) (-1161.715) -- 0:00:41
      338000 -- (-1163.104) (-1161.973) [-1165.374] (-1164.431) * (-1163.443) (-1162.138) (-1161.975) [-1161.705] -- 0:00:41
      338500 -- (-1165.170) [-1161.803] (-1169.083) (-1163.683) * (-1166.778) (-1162.931) [-1166.362] (-1161.646) -- 0:00:41
      339000 -- (-1161.885) [-1161.729] (-1162.468) (-1162.808) * (-1170.714) [-1162.704] (-1167.255) (-1161.694) -- 0:00:40
      339500 -- (-1161.250) [-1163.018] (-1165.537) (-1162.063) * (-1168.185) [-1161.637] (-1164.393) (-1161.683) -- 0:00:40
      340000 -- (-1162.775) [-1162.600] (-1165.627) (-1161.143) * (-1166.308) (-1162.514) [-1163.821] (-1163.171) -- 0:00:40

      Average standard deviation of split frequencies: 0.010793

      340500 -- (-1162.021) (-1166.974) [-1161.878] (-1161.654) * (-1164.418) [-1162.560] (-1163.891) (-1165.140) -- 0:00:40
      341000 -- (-1162.684) (-1164.229) (-1162.376) [-1161.163] * (-1163.538) [-1163.413] (-1165.864) (-1168.492) -- 0:00:40
      341500 -- (-1164.751) (-1162.984) [-1162.373] (-1161.580) * (-1162.912) (-1162.594) [-1163.866] (-1165.596) -- 0:00:40
      342000 -- (-1165.047) (-1161.547) (-1162.181) [-1160.932] * (-1161.437) (-1161.506) (-1161.845) [-1162.004] -- 0:00:40
      342500 -- [-1162.930] (-1167.502) (-1165.916) (-1163.238) * (-1163.018) (-1161.488) (-1164.468) [-1162.859] -- 0:00:40
      343000 -- (-1166.256) (-1162.934) [-1162.662] (-1164.333) * (-1162.551) [-1161.481] (-1165.035) (-1163.175) -- 0:00:40
      343500 -- (-1169.549) (-1165.031) (-1165.954) [-1161.258] * (-1163.514) [-1162.033] (-1165.368) (-1162.972) -- 0:00:40
      344000 -- (-1162.259) (-1162.455) [-1161.570] (-1161.258) * (-1162.146) (-1161.325) (-1164.701) [-1163.400] -- 0:00:40
      344500 -- (-1164.749) (-1162.926) (-1167.569) [-1162.743] * (-1161.892) [-1161.807] (-1161.463) (-1170.511) -- 0:00:39
      345000 -- (-1171.901) [-1163.564] (-1164.255) (-1162.216) * (-1162.956) (-1164.563) [-1161.340] (-1165.182) -- 0:00:39

      Average standard deviation of split frequencies: 0.010082

      345500 -- (-1165.658) (-1162.870) [-1164.460] (-1167.497) * (-1164.954) (-1162.569) (-1163.801) [-1164.112] -- 0:00:39
      346000 -- (-1166.856) [-1165.942] (-1162.299) (-1163.632) * [-1163.302] (-1166.337) (-1162.383) (-1168.338) -- 0:00:39
      346500 -- (-1161.562) (-1162.050) (-1162.559) [-1161.788] * (-1162.471) (-1166.710) (-1164.007) [-1168.944] -- 0:00:39
      347000 -- (-1163.217) (-1164.087) (-1163.294) [-1163.800] * (-1160.905) (-1164.047) (-1165.523) [-1165.268] -- 0:00:39
      347500 -- (-1166.550) (-1162.119) (-1166.759) [-1162.650] * (-1163.869) (-1167.097) [-1162.276] (-1168.040) -- 0:00:39
      348000 -- [-1161.455] (-1162.934) (-1165.913) (-1165.539) * (-1163.794) (-1162.030) [-1161.376] (-1164.308) -- 0:00:39
      348500 -- (-1162.903) [-1162.228] (-1163.376) (-1165.207) * (-1164.890) [-1162.065] (-1162.027) (-1165.079) -- 0:00:39
      349000 -- (-1162.070) [-1163.631] (-1164.217) (-1166.079) * (-1162.266) [-1163.232] (-1164.155) (-1163.080) -- 0:00:39
      349500 -- (-1163.387) [-1162.399] (-1166.951) (-1162.865) * [-1165.945] (-1162.245) (-1163.354) (-1163.910) -- 0:00:40
      350000 -- (-1163.685) (-1163.205) (-1162.225) [-1162.293] * (-1164.322) (-1167.001) (-1162.189) [-1164.080] -- 0:00:40

      Average standard deviation of split frequencies: 0.008066

      350500 -- (-1163.035) (-1165.774) (-1161.332) [-1161.745] * (-1161.938) (-1163.743) [-1163.590] (-1168.712) -- 0:00:40
      351000 -- [-1162.306] (-1162.718) (-1162.636) (-1161.495) * [-1163.411] (-1164.577) (-1161.957) (-1163.408) -- 0:00:40
      351500 -- (-1162.672) (-1167.331) [-1162.632] (-1163.408) * (-1166.896) (-1164.467) (-1163.544) [-1162.328] -- 0:00:40
      352000 -- (-1168.054) (-1164.073) [-1163.129] (-1161.272) * (-1164.146) (-1162.797) (-1162.158) [-1162.536] -- 0:00:40
      352500 -- (-1163.709) (-1162.623) (-1161.093) [-1161.222] * [-1162.650] (-1162.906) (-1164.552) (-1162.820) -- 0:00:40
      353000 -- (-1162.922) (-1165.731) (-1162.110) [-1163.243] * [-1162.444] (-1162.384) (-1164.087) (-1163.926) -- 0:00:40
      353500 -- [-1162.904] (-1162.116) (-1164.136) (-1163.620) * (-1165.000) (-1165.161) [-1164.183] (-1165.914) -- 0:00:40
      354000 -- (-1163.378) [-1162.550] (-1164.002) (-1162.958) * (-1165.972) (-1162.563) [-1162.191] (-1163.426) -- 0:00:40
      354500 -- (-1161.888) (-1162.346) [-1161.210] (-1163.520) * (-1164.606) [-1163.354] (-1161.342) (-1164.803) -- 0:00:40
      355000 -- [-1161.685] (-1163.729) (-1161.503) (-1163.616) * (-1169.978) (-1162.417) [-1161.406] (-1163.016) -- 0:00:39

      Average standard deviation of split frequencies: 0.008210

      355500 -- [-1161.307] (-1165.122) (-1161.503) (-1165.961) * (-1166.795) (-1164.330) [-1162.194] (-1161.872) -- 0:00:39
      356000 -- [-1162.158] (-1162.320) (-1161.503) (-1162.281) * (-1165.167) (-1166.091) (-1164.272) [-1161.793] -- 0:00:39
      356500 -- [-1163.167] (-1163.832) (-1164.209) (-1162.768) * [-1162.802] (-1164.543) (-1163.449) (-1161.566) -- 0:00:39
      357000 -- (-1166.668) [-1161.798] (-1164.010) (-1166.114) * (-1163.682) (-1164.716) (-1162.186) [-1163.611] -- 0:00:39
      357500 -- (-1163.370) (-1160.987) (-1166.310) [-1163.886] * (-1165.124) (-1166.175) [-1163.737] (-1161.302) -- 0:00:39
      358000 -- (-1162.311) [-1160.987] (-1163.957) (-1176.666) * [-1164.110] (-1163.661) (-1163.823) (-1161.300) -- 0:00:39
      358500 -- [-1163.991] (-1162.198) (-1163.243) (-1165.626) * (-1162.481) [-1162.768] (-1164.437) (-1161.491) -- 0:00:39
      359000 -- (-1165.720) (-1162.406) [-1163.275] (-1165.481) * (-1160.987) [-1164.451] (-1160.891) (-1161.748) -- 0:00:39
      359500 -- (-1165.589) (-1162.541) (-1166.332) [-1161.335] * (-1165.637) (-1161.602) [-1162.957] (-1166.031) -- 0:00:39
      360000 -- [-1163.662] (-1168.292) (-1163.132) (-1163.960) * (-1163.111) (-1163.899) (-1163.729) [-1163.407] -- 0:00:39

      Average standard deviation of split frequencies: 0.008626

      360500 -- (-1163.416) [-1169.755] (-1161.764) (-1161.669) * (-1162.980) (-1164.762) (-1162.797) [-1163.297] -- 0:00:39
      361000 -- (-1163.126) [-1163.419] (-1161.627) (-1163.924) * (-1165.541) [-1164.391] (-1161.619) (-1164.467) -- 0:00:38
      361500 -- (-1163.621) (-1162.904) (-1162.787) [-1163.838] * (-1162.396) [-1164.054] (-1161.365) (-1162.678) -- 0:00:38
      362000 -- (-1165.951) [-1162.241] (-1161.892) (-1162.865) * [-1163.737] (-1163.115) (-1161.462) (-1161.832) -- 0:00:38
      362500 -- (-1162.828) (-1162.822) [-1161.790] (-1162.725) * [-1164.943] (-1166.159) (-1161.424) (-1163.749) -- 0:00:38
      363000 -- (-1161.348) (-1166.899) (-1161.850) [-1164.129] * (-1163.054) (-1165.903) (-1162.305) [-1162.525] -- 0:00:38
      363500 -- (-1162.711) (-1163.101) [-1162.308] (-1161.780) * (-1162.739) (-1166.181) (-1161.936) [-1165.532] -- 0:00:38
      364000 -- [-1163.820] (-1162.029) (-1162.639) (-1161.918) * (-1163.127) (-1161.190) [-1163.072] (-1161.096) -- 0:00:38
      364500 -- (-1164.807) (-1162.375) [-1162.915] (-1162.926) * (-1162.361) [-1161.241] (-1168.381) (-1162.783) -- 0:00:40
      365000 -- (-1166.721) (-1162.812) [-1165.760] (-1164.251) * (-1162.226) (-1162.374) (-1164.816) [-1167.501] -- 0:00:40

      Average standard deviation of split frequencies: 0.007213

      365500 -- (-1168.755) (-1161.389) (-1162.272) [-1164.998] * (-1163.324) (-1166.378) [-1161.836] (-1164.805) -- 0:00:39
      366000 -- [-1163.627] (-1163.758) (-1161.511) (-1163.461) * (-1162.163) (-1166.568) [-1164.300] (-1163.560) -- 0:00:39
      366500 -- (-1164.636) [-1163.580] (-1163.955) (-1165.864) * [-1162.866] (-1163.648) (-1166.430) (-1164.302) -- 0:00:39
      367000 -- [-1162.390] (-1163.898) (-1164.049) (-1162.321) * [-1163.452] (-1163.055) (-1168.865) (-1162.592) -- 0:00:39
      367500 -- [-1161.238] (-1166.397) (-1166.362) (-1161.501) * (-1163.933) [-1168.418] (-1164.738) (-1165.067) -- 0:00:39
      368000 -- (-1162.678) (-1161.646) (-1162.333) [-1162.843] * (-1162.784) (-1163.877) (-1163.897) [-1164.830] -- 0:00:39
      368500 -- (-1167.034) (-1169.576) [-1163.203] (-1163.433) * (-1163.768) [-1166.374] (-1163.698) (-1166.323) -- 0:00:39
      369000 -- (-1162.837) [-1164.661] (-1164.053) (-1161.841) * (-1163.335) (-1165.196) [-1161.424] (-1163.917) -- 0:00:39
      369500 -- (-1163.789) (-1163.983) [-1163.885] (-1161.760) * (-1162.674) (-1167.227) [-1161.803] (-1165.148) -- 0:00:39
      370000 -- (-1162.805) [-1162.495] (-1162.235) (-1161.687) * [-1161.854] (-1165.038) (-1162.459) (-1163.555) -- 0:00:39

      Average standard deviation of split frequencies: 0.007376

      370500 -- (-1163.635) (-1162.139) [-1163.154] (-1161.132) * (-1161.956) (-1165.684) [-1162.522] (-1163.336) -- 0:00:39
      371000 -- (-1163.262) [-1168.789] (-1162.700) (-1162.181) * (-1164.987) [-1163.523] (-1162.572) (-1162.757) -- 0:00:38
      371500 -- (-1164.159) (-1168.836) [-1162.759] (-1161.025) * (-1161.121) (-1162.523) (-1162.621) [-1161.950] -- 0:00:38
      372000 -- (-1166.904) (-1162.532) [-1161.738] (-1160.936) * (-1163.277) (-1162.605) [-1162.725] (-1161.452) -- 0:00:38
      372500 -- (-1165.131) [-1161.943] (-1161.495) (-1164.240) * (-1167.682) (-1163.155) (-1163.208) [-1162.897] -- 0:00:38
      373000 -- (-1162.768) (-1161.409) (-1165.025) [-1161.648] * (-1161.982) (-1162.219) [-1162.499] (-1162.903) -- 0:00:38
      373500 -- (-1164.199) (-1162.276) (-1161.639) [-1164.348] * (-1162.614) (-1162.083) (-1164.618) [-1161.869] -- 0:00:38
      374000 -- (-1166.407) [-1162.231] (-1161.417) (-1165.201) * (-1162.550) (-1162.094) [-1163.415] (-1165.357) -- 0:00:38
      374500 -- [-1162.124] (-1163.665) (-1163.416) (-1164.324) * (-1162.070) (-1165.476) (-1163.999) [-1162.214] -- 0:00:38
      375000 -- (-1162.009) [-1164.590] (-1161.474) (-1166.350) * (-1161.078) [-1163.165] (-1164.671) (-1162.537) -- 0:00:38

      Average standard deviation of split frequencies: 0.008275

      375500 -- [-1164.498] (-1168.105) (-1161.566) (-1164.505) * (-1163.254) (-1163.655) [-1167.253] (-1162.846) -- 0:00:38
      376000 -- (-1167.655) [-1161.283] (-1164.286) (-1164.055) * (-1161.039) (-1161.207) (-1163.841) [-1163.658] -- 0:00:38
      376500 -- (-1165.596) [-1161.281] (-1163.374) (-1163.035) * (-1161.323) [-1161.328] (-1161.479) (-1166.172) -- 0:00:38
      377000 -- (-1163.863) [-1161.074] (-1163.669) (-1163.001) * (-1162.344) (-1161.448) (-1164.108) [-1163.396] -- 0:00:38
      377500 -- (-1165.623) (-1161.545) [-1161.626] (-1163.121) * [-1165.142] (-1164.299) (-1161.566) (-1163.608) -- 0:00:37
      378000 -- (-1162.350) [-1161.790] (-1161.240) (-1164.173) * (-1170.205) (-1166.836) (-1161.442) [-1163.388] -- 0:00:37
      378500 -- [-1163.800] (-1162.976) (-1167.061) (-1163.576) * (-1168.422) (-1165.743) (-1161.834) [-1164.116] -- 0:00:37
      379000 -- (-1162.051) [-1162.279] (-1164.058) (-1164.747) * (-1169.723) [-1162.330] (-1161.785) (-1161.923) -- 0:00:37
      379500 -- (-1164.504) [-1165.981] (-1164.513) (-1164.230) * [-1164.244] (-1162.638) (-1161.449) (-1161.831) -- 0:00:39
      380000 -- (-1166.363) (-1163.460) (-1165.167) [-1161.566] * (-1163.023) [-1162.491] (-1161.564) (-1162.152) -- 0:00:39

      Average standard deviation of split frequencies: 0.008421

      380500 -- (-1163.286) (-1162.966) (-1161.141) [-1161.549] * (-1163.710) (-1162.798) (-1162.553) [-1162.373] -- 0:00:39
      381000 -- [-1163.063] (-1163.203) (-1160.970) (-1161.941) * (-1161.683) (-1164.062) [-1162.769] (-1164.992) -- 0:00:38
      381500 -- (-1162.018) (-1165.078) (-1161.030) [-1161.870] * (-1163.394) (-1165.153) (-1163.813) [-1162.046] -- 0:00:38
      382000 -- [-1160.994] (-1164.168) (-1163.057) (-1162.151) * (-1163.586) (-1163.950) [-1164.661] (-1164.556) -- 0:00:38
      382500 -- (-1163.974) (-1164.414) (-1163.926) [-1163.285] * (-1162.172) [-1162.688] (-1167.315) (-1161.796) -- 0:00:38
      383000 -- (-1161.191) (-1164.622) (-1161.482) [-1163.952] * (-1161.815) (-1165.338) (-1167.507) [-1163.768] -- 0:00:38
      383500 -- (-1165.697) (-1163.320) [-1161.591] (-1165.631) * (-1162.861) (-1167.450) (-1162.279) [-1162.314] -- 0:00:38
      384000 -- (-1162.277) (-1163.890) [-1162.865] (-1165.620) * (-1165.167) (-1162.911) [-1164.521] (-1162.036) -- 0:00:38
      384500 -- [-1162.862] (-1164.488) (-1162.286) (-1166.702) * (-1163.132) (-1167.155) [-1166.873] (-1161.074) -- 0:00:38
      385000 -- (-1165.157) [-1163.963] (-1163.262) (-1163.467) * (-1165.133) (-1163.885) [-1165.687] (-1164.725) -- 0:00:38

      Average standard deviation of split frequencies: 0.008549

      385500 -- (-1163.773) [-1162.805] (-1161.730) (-1165.099) * [-1162.614] (-1163.302) (-1162.015) (-1169.453) -- 0:00:38
      386000 -- (-1163.119) (-1163.714) (-1162.797) [-1162.800] * (-1163.848) (-1162.194) [-1163.241] (-1167.870) -- 0:00:38
      386500 -- (-1163.732) (-1163.182) (-1162.661) [-1165.007] * [-1163.310] (-1162.087) (-1161.693) (-1170.733) -- 0:00:38
      387000 -- (-1162.152) (-1161.277) (-1161.999) [-1163.286] * (-1164.369) (-1163.602) (-1162.219) [-1161.830] -- 0:00:38
      387500 -- [-1163.722] (-1163.713) (-1165.892) (-1165.215) * (-1161.628) (-1162.818) [-1161.927] (-1161.120) -- 0:00:37
      388000 -- (-1163.559) (-1162.052) (-1161.453) [-1161.185] * (-1168.781) [-1163.493] (-1164.761) (-1161.123) -- 0:00:37
      388500 -- (-1162.544) (-1162.985) (-1162.828) [-1161.678] * [-1161.133] (-1165.182) (-1166.281) (-1168.251) -- 0:00:37
      389000 -- (-1163.234) (-1162.216) [-1161.963] (-1161.265) * (-1162.479) [-1161.853] (-1166.844) (-1162.687) -- 0:00:37
      389500 -- (-1169.333) [-1161.239] (-1161.920) (-1165.080) * (-1163.829) [-1166.387] (-1164.474) (-1163.048) -- 0:00:37
      390000 -- (-1162.022) (-1161.845) (-1162.205) [-1163.772] * (-1165.133) [-1168.265] (-1163.386) (-1163.372) -- 0:00:37

      Average standard deviation of split frequencies: 0.009412

      390500 -- [-1162.936] (-1162.936) (-1164.344) (-1163.871) * (-1168.666) (-1164.644) [-1161.497] (-1162.518) -- 0:00:37
      391000 -- [-1163.583] (-1162.995) (-1164.237) (-1163.592) * (-1170.267) (-1160.815) [-1161.179] (-1163.588) -- 0:00:37
      391500 -- (-1166.992) (-1163.693) [-1163.631] (-1161.991) * [-1161.723] (-1161.116) (-1161.820) (-1161.921) -- 0:00:37
      392000 -- (-1165.375) (-1163.823) [-1162.869] (-1162.551) * [-1165.446] (-1165.107) (-1163.684) (-1162.255) -- 0:00:37
      392500 -- (-1162.659) (-1162.175) [-1167.673] (-1161.997) * [-1161.758] (-1162.820) (-1161.551) (-1162.692) -- 0:00:37
      393000 -- (-1167.873) [-1161.738] (-1161.619) (-1166.309) * [-1162.608] (-1161.479) (-1163.121) (-1163.223) -- 0:00:37
      393500 -- (-1163.142) (-1162.319) [-1162.345] (-1170.415) * (-1162.216) (-1165.005) (-1162.296) [-1163.604] -- 0:00:36
      394000 -- [-1163.960] (-1162.723) (-1164.070) (-1163.040) * [-1163.039] (-1167.257) (-1162.385) (-1162.202) -- 0:00:36
      394500 -- [-1167.619] (-1163.744) (-1162.617) (-1163.335) * (-1166.619) (-1164.242) (-1163.958) [-1162.486] -- 0:00:36
      395000 -- [-1162.347] (-1165.849) (-1163.969) (-1164.732) * [-1164.118] (-1162.713) (-1163.121) (-1163.076) -- 0:00:36

      Average standard deviation of split frequencies: 0.009523

      395500 -- (-1166.045) (-1165.982) [-1163.868] (-1163.277) * (-1163.159) (-1161.970) [-1164.505] (-1162.712) -- 0:00:36
      396000 -- (-1161.554) [-1165.999] (-1162.291) (-1162.446) * (-1164.095) [-1161.960] (-1162.414) (-1162.102) -- 0:00:36
      396500 -- (-1162.034) (-1167.171) (-1161.748) [-1165.169] * (-1162.246) (-1161.199) (-1166.847) [-1165.203] -- 0:00:38
      397000 -- [-1161.895] (-1163.147) (-1162.936) (-1162.905) * (-1162.716) [-1163.869] (-1164.219) (-1161.686) -- 0:00:37
      397500 -- [-1162.106] (-1162.230) (-1163.498) (-1163.851) * (-1162.262) [-1163.309] (-1163.268) (-1160.903) -- 0:00:37
      398000 -- (-1161.092) [-1161.812] (-1163.624) (-1165.519) * [-1165.682] (-1165.856) (-1163.864) (-1161.655) -- 0:00:37
      398500 -- [-1160.783] (-1161.415) (-1164.389) (-1164.314) * [-1165.043] (-1165.361) (-1161.791) (-1161.163) -- 0:00:37
      399000 -- [-1161.868] (-1161.178) (-1162.154) (-1162.890) * (-1161.963) [-1168.102] (-1161.738) (-1161.257) -- 0:00:37
      399500 -- (-1167.788) (-1162.144) [-1162.774] (-1162.025) * (-1163.544) [-1164.674] (-1162.147) (-1165.113) -- 0:00:37
      400000 -- (-1164.667) (-1166.345) (-1163.013) [-1161.341] * (-1166.189) (-1161.033) [-1163.048] (-1163.869) -- 0:00:37

      Average standard deviation of split frequencies: 0.009648

      400500 -- (-1163.859) (-1163.815) [-1163.743] (-1162.497) * [-1167.789] (-1164.319) (-1163.667) (-1163.017) -- 0:00:37
      401000 -- [-1162.977] (-1164.057) (-1162.727) (-1162.776) * (-1167.090) [-1161.291] (-1161.810) (-1161.312) -- 0:00:37
      401500 -- (-1163.834) (-1162.315) [-1162.730] (-1163.807) * (-1165.574) (-1164.580) [-1165.004] (-1164.253) -- 0:00:37
      402000 -- (-1166.270) (-1162.886) (-1162.182) [-1164.336] * [-1165.041] (-1164.170) (-1163.291) (-1162.787) -- 0:00:37
      402500 -- (-1166.902) (-1162.321) (-1162.210) [-1166.368] * (-1162.422) [-1163.292] (-1162.701) (-1163.074) -- 0:00:37
      403000 -- (-1164.308) (-1164.033) [-1162.285] (-1165.832) * (-1165.740) [-1162.490] (-1163.345) (-1161.173) -- 0:00:37
      403500 -- (-1161.696) (-1165.640) (-1161.406) [-1167.239] * (-1164.787) (-1162.022) [-1162.698] (-1162.760) -- 0:00:36
      404000 -- (-1165.323) (-1167.959) [-1161.406] (-1162.413) * [-1162.530] (-1161.993) (-1164.308) (-1166.646) -- 0:00:36
      404500 -- (-1161.752) (-1163.720) [-1161.575] (-1162.334) * (-1161.284) (-1162.268) [-1163.418] (-1162.995) -- 0:00:36
      405000 -- [-1161.642] (-1164.110) (-1162.068) (-1161.483) * [-1161.736] (-1162.012) (-1162.738) (-1167.165) -- 0:00:36

      Average standard deviation of split frequencies: 0.009521

      405500 -- (-1167.423) (-1163.453) [-1162.433] (-1164.798) * (-1164.522) [-1161.807] (-1163.252) (-1165.900) -- 0:00:36
      406000 -- (-1165.759) [-1160.736] (-1161.824) (-1165.231) * (-1163.800) (-1162.996) [-1163.185] (-1162.966) -- 0:00:36
      406500 -- [-1163.909] (-1163.618) (-1161.954) (-1174.449) * [-1163.751] (-1163.323) (-1162.560) (-1162.638) -- 0:00:36
      407000 -- (-1163.009) (-1162.590) [-1163.046] (-1163.357) * (-1164.876) [-1162.713] (-1163.285) (-1164.455) -- 0:00:36
      407500 -- (-1161.642) (-1163.225) (-1166.535) [-1164.349] * (-1164.784) (-1163.457) (-1163.396) [-1163.100] -- 0:00:36
      408000 -- (-1163.759) [-1163.142] (-1165.373) (-1163.281) * [-1161.363] (-1163.543) (-1161.653) (-1161.871) -- 0:00:36
      408500 -- (-1161.503) [-1161.096] (-1162.613) (-1162.219) * [-1162.300] (-1164.631) (-1161.959) (-1163.494) -- 0:00:36
      409000 -- (-1161.300) [-1161.595] (-1164.242) (-1161.343) * [-1162.356] (-1161.280) (-1164.418) (-1161.537) -- 0:00:36
      409500 -- [-1164.136] (-1163.547) (-1165.832) (-1161.658) * [-1162.020] (-1164.601) (-1162.717) (-1164.321) -- 0:00:36
      410000 -- (-1165.990) (-1161.917) (-1162.411) [-1162.985] * (-1162.343) (-1164.829) [-1164.943] (-1161.707) -- 0:00:35

      Average standard deviation of split frequencies: 0.009872

      410500 -- [-1165.106] (-1161.513) (-1164.940) (-1163.544) * (-1161.452) (-1162.755) (-1165.059) [-1164.753] -- 0:00:35
      411000 -- (-1162.820) [-1161.475] (-1161.660) (-1163.843) * [-1161.915] (-1163.107) (-1163.266) (-1162.973) -- 0:00:35
      411500 -- (-1163.934) (-1161.095) [-1161.383] (-1164.863) * (-1162.876) [-1164.143] (-1161.907) (-1162.400) -- 0:00:35
      412000 -- (-1161.016) (-1163.090) [-1161.493] (-1162.590) * (-1166.187) (-1164.166) [-1164.657] (-1162.326) -- 0:00:35
      412500 -- (-1160.905) (-1162.408) (-1165.699) [-1162.041] * (-1164.144) (-1162.332) [-1162.593] (-1163.042) -- 0:00:35
      413000 -- (-1164.185) (-1162.250) (-1165.555) [-1161.377] * (-1161.714) (-1163.388) (-1160.971) [-1161.603] -- 0:00:35
      413500 -- (-1167.160) (-1162.237) (-1168.418) [-1161.324] * (-1162.598) (-1162.871) (-1166.778) [-1162.080] -- 0:00:36
      414000 -- (-1163.763) (-1162.539) (-1166.013) [-1161.680] * (-1164.878) [-1161.459] (-1162.579) (-1163.043) -- 0:00:36
      414500 -- (-1166.916) [-1162.558] (-1166.053) (-1161.934) * (-1161.682) (-1167.498) (-1162.721) [-1164.728] -- 0:00:36
      415000 -- [-1163.507] (-1161.463) (-1164.875) (-1161.899) * (-1161.742) [-1161.905] (-1164.046) (-1162.535) -- 0:00:36

      Average standard deviation of split frequencies: 0.011558

      415500 -- (-1163.808) (-1164.455) [-1167.062] (-1162.261) * [-1162.988] (-1161.796) (-1170.378) (-1161.998) -- 0:00:36
      416000 -- (-1162.141) [-1164.397] (-1164.391) (-1161.751) * (-1162.919) (-1161.725) (-1163.486) [-1162.028] -- 0:00:36
      416500 -- (-1161.409) (-1164.881) [-1163.038] (-1163.844) * [-1162.805] (-1162.352) (-1165.500) (-1167.893) -- 0:00:36
      417000 -- (-1161.457) [-1169.187] (-1164.302) (-1162.575) * (-1161.256) (-1162.385) [-1162.197] (-1163.003) -- 0:00:36
      417500 -- [-1164.295] (-1164.343) (-1162.438) (-1162.702) * (-1161.759) (-1165.631) [-1164.836] (-1163.447) -- 0:00:36
      418000 -- (-1162.947) (-1162.153) [-1164.132] (-1161.975) * (-1166.712) [-1162.471] (-1161.701) (-1164.829) -- 0:00:36
      418500 -- (-1164.295) [-1163.836] (-1163.614) (-1162.288) * (-1162.999) [-1164.961] (-1165.956) (-1161.476) -- 0:00:36
      419000 -- (-1166.176) [-1162.005] (-1161.537) (-1164.471) * (-1164.415) (-1165.061) (-1161.686) [-1162.120] -- 0:00:36
      419500 -- (-1166.105) (-1166.425) [-1162.476] (-1163.236) * [-1163.664] (-1165.348) (-1164.096) (-1162.813) -- 0:00:35
      420000 -- [-1163.852] (-1165.600) (-1163.945) (-1162.131) * (-1162.044) (-1165.287) (-1163.815) [-1161.281] -- 0:00:35

      Average standard deviation of split frequencies: 0.010534

      420500 -- [-1162.564] (-1165.715) (-1161.759) (-1166.675) * [-1164.345] (-1163.445) (-1164.342) (-1165.164) -- 0:00:35
      421000 -- (-1167.980) [-1162.975] (-1162.723) (-1162.008) * [-1161.960] (-1161.252) (-1162.131) (-1162.976) -- 0:00:35
      421500 -- (-1165.740) (-1165.895) [-1161.452] (-1161.987) * [-1164.414] (-1164.138) (-1164.518) (-1162.848) -- 0:00:35
      422000 -- (-1169.799) (-1165.605) [-1161.292] (-1164.307) * (-1162.980) (-1166.634) (-1163.601) [-1162.561] -- 0:00:35
      422500 -- (-1161.527) [-1162.565] (-1161.042) (-1163.626) * (-1165.627) (-1165.633) (-1161.665) [-1161.938] -- 0:00:35
      423000 -- (-1161.499) (-1164.291) (-1164.463) [-1161.887] * [-1167.635] (-1165.029) (-1162.160) (-1164.238) -- 0:00:35
      423500 -- [-1163.141] (-1164.850) (-1163.326) (-1162.051) * (-1163.052) [-1164.337] (-1166.769) (-1162.564) -- 0:00:35
      424000 -- [-1164.055] (-1166.332) (-1162.730) (-1164.639) * (-1163.982) [-1163.006] (-1164.397) (-1162.520) -- 0:00:35
      424500 -- (-1164.468) [-1164.875] (-1164.250) (-1166.653) * (-1163.557) [-1161.519] (-1162.925) (-1161.689) -- 0:00:35
      425000 -- (-1164.730) (-1166.201) (-1164.862) [-1163.001] * [-1162.562] (-1162.293) (-1162.179) (-1163.953) -- 0:00:35

      Average standard deviation of split frequencies: 0.010181

      425500 -- (-1163.428) (-1164.867) (-1165.455) [-1161.914] * (-1165.644) (-1164.250) (-1163.483) [-1161.367] -- 0:00:35
      426000 -- (-1166.359) [-1161.283] (-1162.630) (-1163.850) * (-1165.260) (-1164.030) [-1165.304] (-1162.834) -- 0:00:35
      426500 -- (-1165.519) (-1162.421) [-1164.887] (-1161.988) * (-1168.430) (-1164.388) (-1164.165) [-1162.778] -- 0:00:34
      427000 -- (-1163.365) [-1161.747] (-1163.491) (-1162.195) * (-1164.319) (-1164.393) (-1161.394) [-1163.669] -- 0:00:34
      427500 -- (-1163.130) (-1161.058) [-1164.130] (-1162.277) * (-1166.707) [-1164.469] (-1163.216) (-1162.093) -- 0:00:34
      428000 -- (-1162.839) [-1163.518] (-1164.270) (-1163.851) * (-1163.746) (-1162.745) [-1162.167] (-1163.146) -- 0:00:34
      428500 -- (-1162.859) [-1162.997] (-1162.894) (-1167.169) * [-1162.966] (-1165.618) (-1163.067) (-1161.876) -- 0:00:34
      429000 -- (-1161.695) [-1161.740] (-1165.552) (-1162.658) * [-1161.535] (-1162.650) (-1162.040) (-1162.220) -- 0:00:34
      429500 -- (-1164.469) (-1165.542) (-1161.971) [-1161.250] * (-1162.600) (-1162.148) [-1163.376] (-1162.073) -- 0:00:35
      430000 -- [-1162.123] (-1165.885) (-1165.725) (-1163.491) * (-1161.815) (-1162.582) (-1162.942) [-1162.439] -- 0:00:35

      Average standard deviation of split frequencies: 0.010508

      430500 -- (-1163.198) (-1163.803) (-1163.382) [-1161.150] * (-1162.382) [-1161.115] (-1165.000) (-1161.814) -- 0:00:35
      431000 -- [-1164.519] (-1164.870) (-1162.828) (-1161.628) * (-1161.176) (-1164.059) (-1164.554) [-1162.234] -- 0:00:35
      431500 -- (-1163.637) (-1162.698) (-1162.539) [-1161.524] * (-1161.778) [-1161.231] (-1162.624) (-1164.178) -- 0:00:35
      432000 -- [-1161.933] (-1164.239) (-1163.742) (-1161.579) * (-1165.817) (-1164.277) [-1163.011] (-1164.372) -- 0:00:35
      432500 -- (-1162.818) (-1162.054) (-1163.104) [-1163.959] * (-1161.935) [-1164.434] (-1163.877) (-1164.819) -- 0:00:35
      433000 -- (-1165.581) (-1164.368) (-1162.588) [-1162.027] * [-1161.010] (-1165.428) (-1162.793) (-1164.711) -- 0:00:35
      433500 -- (-1164.403) (-1163.021) [-1161.315] (-1162.275) * (-1162.092) (-1162.400) [-1162.236] (-1164.111) -- 0:00:35
      434000 -- [-1162.134] (-1170.405) (-1161.907) (-1161.870) * (-1162.476) [-1161.864] (-1161.777) (-1165.734) -- 0:00:35
      434500 -- (-1162.425) (-1163.837) (-1163.183) [-1167.836] * (-1162.937) (-1164.351) (-1163.620) [-1164.470] -- 0:00:35
      435000 -- [-1161.095] (-1162.314) (-1162.239) (-1164.335) * (-1163.826) (-1161.645) [-1166.236] (-1163.335) -- 0:00:35

      Average standard deviation of split frequencies: 0.011677

      435500 -- [-1161.433] (-1162.060) (-1164.212) (-1162.384) * (-1162.772) [-1162.699] (-1163.888) (-1163.312) -- 0:00:34
      436000 -- (-1161.436) (-1162.272) [-1163.370] (-1162.512) * (-1160.991) (-1165.031) (-1165.502) [-1163.365] -- 0:00:34
      436500 -- [-1163.149] (-1161.741) (-1166.217) (-1163.838) * (-1162.403) (-1165.751) [-1162.068] (-1164.476) -- 0:00:34
      437000 -- (-1162.703) [-1161.483] (-1163.667) (-1164.136) * (-1162.256) (-1169.419) [-1163.425] (-1164.612) -- 0:00:34
      437500 -- [-1164.778] (-1164.089) (-1163.848) (-1162.801) * (-1161.535) [-1163.773] (-1161.868) (-1163.663) -- 0:00:34
      438000 -- (-1163.864) (-1162.991) (-1164.533) [-1162.495] * (-1163.650) (-1163.677) [-1162.346] (-1163.167) -- 0:00:34
      438500 -- (-1162.269) (-1165.195) (-1165.097) [-1163.101] * (-1162.593) [-1163.541] (-1163.356) (-1162.139) -- 0:00:34
      439000 -- [-1161.169] (-1171.557) (-1163.326) (-1163.099) * (-1164.264) [-1163.271] (-1165.336) (-1171.049) -- 0:00:34
      439500 -- [-1165.838] (-1165.601) (-1162.510) (-1161.629) * (-1164.876) (-1163.652) (-1162.947) [-1165.826] -- 0:00:34
      440000 -- (-1164.053) [-1163.269] (-1166.690) (-1164.747) * (-1163.861) (-1164.010) (-1161.939) [-1165.354] -- 0:00:34

      Average standard deviation of split frequencies: 0.011125

      440500 -- (-1162.573) (-1162.712) [-1163.359] (-1162.582) * (-1166.102) (-1164.974) [-1162.528] (-1163.300) -- 0:00:34
      441000 -- (-1165.426) [-1162.101] (-1168.699) (-1169.495) * (-1161.224) (-1165.508) [-1163.038] (-1165.319) -- 0:00:34
      441500 -- (-1166.150) (-1163.226) [-1166.379] (-1169.503) * [-1161.304] (-1161.884) (-1163.277) (-1163.975) -- 0:00:34
      442000 -- (-1163.878) [-1163.290] (-1163.640) (-1163.887) * (-1165.943) (-1163.908) [-1162.065] (-1164.130) -- 0:00:34
      442500 -- (-1161.503) (-1162.714) (-1163.027) [-1162.150] * (-1166.223) [-1161.377] (-1164.044) (-1164.413) -- 0:00:34
      443000 -- (-1163.444) (-1163.475) (-1162.447) [-1161.909] * (-1169.609) (-1162.402) (-1163.233) [-1163.309] -- 0:00:33
      443500 -- (-1163.743) [-1162.300] (-1162.913) (-1162.007) * (-1162.457) (-1162.793) (-1163.549) [-1164.469] -- 0:00:33
      444000 -- [-1163.701] (-1164.650) (-1164.293) (-1161.999) * (-1162.736) [-1161.648] (-1166.575) (-1167.663) -- 0:00:33
      444500 -- (-1163.749) (-1163.299) (-1169.301) [-1162.717] * (-1162.381) (-1161.951) (-1165.944) [-1164.373] -- 0:00:33
      445000 -- (-1163.479) [-1163.087] (-1162.748) (-1162.179) * [-1164.490] (-1163.175) (-1161.645) (-1164.978) -- 0:00:33

      Average standard deviation of split frequencies: 0.011415

      445500 -- (-1162.920) (-1163.174) [-1162.050] (-1161.712) * (-1166.916) [-1161.218] (-1162.440) (-1164.118) -- 0:00:34
      446000 -- [-1165.957] (-1162.236) (-1162.620) (-1166.304) * [-1162.462] (-1161.122) (-1163.804) (-1162.394) -- 0:00:34
      446500 -- (-1162.077) [-1161.774] (-1163.225) (-1164.322) * (-1164.841) (-1162.652) [-1165.691] (-1162.012) -- 0:00:34
      447000 -- [-1163.549] (-1163.820) (-1164.254) (-1165.214) * (-1164.477) (-1162.598) [-1167.354] (-1161.313) -- 0:00:34
      447500 -- [-1165.458] (-1164.345) (-1163.636) (-1162.356) * (-1165.414) [-1163.677] (-1164.437) (-1161.504) -- 0:00:34
      448000 -- (-1164.328) (-1164.396) [-1161.713] (-1162.912) * (-1164.995) [-1161.428] (-1162.800) (-1162.884) -- 0:00:34
      448500 -- (-1167.114) (-1162.430) (-1162.882) [-1164.120] * (-1163.315) (-1165.022) (-1162.964) [-1162.691] -- 0:00:34
      449000 -- (-1162.147) (-1161.921) (-1161.341) [-1163.436] * (-1170.452) (-1165.727) (-1162.372) [-1166.899] -- 0:00:34
      449500 -- (-1163.008) [-1161.361] (-1163.792) (-1163.419) * (-1166.518) (-1164.394) (-1162.062) [-1163.645] -- 0:00:34
      450000 -- (-1161.983) (-1164.373) (-1165.205) [-1162.858] * (-1165.419) (-1165.783) [-1162.458] (-1164.067) -- 0:00:34

      Average standard deviation of split frequencies: 0.012134

      450500 -- (-1166.411) [-1162.782] (-1166.461) (-1165.440) * (-1162.127) [-1164.384] (-1161.901) (-1165.155) -- 0:00:34
      451000 -- [-1162.416] (-1166.033) (-1162.100) (-1163.824) * (-1163.907) [-1164.826] (-1163.837) (-1164.074) -- 0:00:34
      451500 -- [-1164.116] (-1162.705) (-1161.727) (-1163.004) * (-1165.050) [-1164.676] (-1163.548) (-1163.518) -- 0:00:34
      452000 -- (-1163.833) (-1161.705) [-1164.688] (-1163.892) * (-1162.138) (-1164.673) (-1162.988) [-1161.543] -- 0:00:33
      452500 -- (-1164.864) [-1163.422] (-1164.427) (-1161.947) * (-1162.463) [-1163.330] (-1161.420) (-1160.827) -- 0:00:33
      453000 -- [-1162.571] (-1162.164) (-1163.538) (-1162.156) * [-1162.350] (-1166.009) (-1163.236) (-1161.208) -- 0:00:33
      453500 -- (-1162.971) [-1162.341] (-1162.197) (-1165.701) * (-1164.597) (-1161.836) [-1164.154] (-1161.860) -- 0:00:33
      454000 -- (-1161.795) [-1162.211] (-1162.424) (-1167.576) * [-1161.452] (-1163.876) (-1163.823) (-1161.654) -- 0:00:33
      454500 -- (-1163.836) [-1163.984] (-1163.051) (-1165.881) * (-1162.008) (-1162.321) [-1161.141] (-1163.694) -- 0:00:33
      455000 -- [-1164.760] (-1161.794) (-1166.153) (-1169.707) * (-1165.593) (-1162.888) (-1161.830) [-1162.199] -- 0:00:33

      Average standard deviation of split frequencies: 0.012819

      455500 -- (-1161.412) [-1161.706] (-1165.119) (-1167.380) * (-1162.289) [-1163.738] (-1165.585) (-1164.013) -- 0:00:33
      456000 -- [-1162.335] (-1161.251) (-1162.886) (-1162.329) * (-1164.631) [-1164.598] (-1164.142) (-1163.154) -- 0:00:33
      456500 -- (-1163.319) [-1163.671] (-1162.161) (-1164.855) * [-1163.448] (-1164.319) (-1165.760) (-1163.897) -- 0:00:33
      457000 -- [-1166.480] (-1161.551) (-1165.546) (-1162.376) * (-1166.099) (-1164.561) (-1168.382) [-1163.063] -- 0:00:33
      457500 -- (-1164.165) (-1165.232) [-1162.610] (-1164.810) * (-1164.640) [-1161.586] (-1163.820) (-1166.309) -- 0:00:33
      458000 -- (-1163.076) (-1161.973) (-1162.076) [-1166.362] * (-1164.218) [-1161.901] (-1165.650) (-1164.596) -- 0:00:33
      458500 -- (-1163.749) (-1167.871) [-1165.625] (-1162.302) * (-1161.812) (-1163.829) (-1162.930) [-1161.378] -- 0:00:33
      459000 -- [-1162.563] (-1166.026) (-1163.454) (-1162.831) * (-1168.069) (-1164.990) (-1169.369) [-1161.378] -- 0:00:33
      459500 -- (-1162.134) (-1168.934) (-1164.250) [-1165.445] * (-1162.654) (-1162.818) [-1163.508] (-1163.551) -- 0:00:32
      460000 -- (-1163.273) (-1166.126) [-1163.185] (-1165.155) * (-1164.861) (-1162.303) (-1161.478) [-1162.029] -- 0:00:32

      Average standard deviation of split frequencies: 0.013098

      460500 -- (-1162.908) (-1164.572) [-1164.091] (-1164.289) * (-1164.626) (-1162.285) (-1163.223) [-1163.166] -- 0:00:32
      461000 -- (-1161.542) (-1164.486) [-1163.343] (-1163.279) * (-1163.254) (-1161.286) [-1163.973] (-1163.111) -- 0:00:32
      461500 -- [-1161.278] (-1164.288) (-1168.037) (-1164.396) * (-1163.446) (-1161.943) (-1162.333) [-1163.061] -- 0:00:32
      462000 -- (-1164.578) (-1163.773) (-1167.544) [-1165.896] * [-1164.700] (-1161.390) (-1162.304) (-1163.900) -- 0:00:32
      462500 -- (-1166.737) [-1162.762] (-1166.505) (-1165.508) * (-1164.053) (-1160.728) [-1162.425] (-1162.121) -- 0:00:33
      463000 -- (-1165.586) (-1163.489) [-1162.808] (-1165.433) * [-1163.510] (-1164.886) (-1161.328) (-1161.205) -- 0:00:33
      463500 -- [-1162.083] (-1166.487) (-1161.928) (-1165.200) * [-1161.367] (-1167.443) (-1165.298) (-1163.011) -- 0:00:33
      464000 -- [-1163.320] (-1164.924) (-1163.528) (-1167.612) * (-1162.654) [-1163.697] (-1162.202) (-1163.790) -- 0:00:33
      464500 -- (-1161.614) (-1165.952) [-1168.942] (-1169.227) * (-1162.942) [-1161.187] (-1163.342) (-1164.172) -- 0:00:33
      465000 -- [-1162.993] (-1164.732) (-1164.917) (-1166.663) * (-1162.915) [-1161.364] (-1162.118) (-1162.867) -- 0:00:33

      Average standard deviation of split frequencies: 0.012948

      465500 -- (-1162.644) (-1164.720) [-1163.597] (-1165.012) * (-1163.097) [-1160.746] (-1161.313) (-1162.219) -- 0:00:33
      466000 -- (-1164.040) (-1161.997) [-1162.070] (-1164.406) * (-1166.262) (-1166.057) (-1162.225) [-1162.986] -- 0:00:33
      466500 -- [-1165.832] (-1164.300) (-1162.182) (-1161.409) * (-1161.498) [-1161.170] (-1161.790) (-1165.963) -- 0:00:33
      467000 -- [-1164.465] (-1166.109) (-1163.190) (-1162.434) * (-1161.856) (-1165.235) (-1161.792) [-1162.204] -- 0:00:33
      467500 -- (-1162.102) [-1163.588] (-1164.891) (-1162.852) * (-1160.950) [-1163.171] (-1161.337) (-1161.706) -- 0:00:33
      468000 -- (-1161.508) (-1163.613) (-1164.346) [-1163.535] * [-1161.966] (-1164.367) (-1163.353) (-1164.974) -- 0:00:32
      468500 -- (-1164.592) [-1162.106] (-1164.599) (-1162.586) * (-1163.458) [-1162.107] (-1165.397) (-1166.334) -- 0:00:32
      469000 -- (-1162.009) (-1168.202) (-1165.191) [-1161.330] * [-1163.029] (-1167.668) (-1162.882) (-1164.707) -- 0:00:32
      469500 -- (-1161.353) [-1163.217] (-1163.417) (-1164.759) * (-1161.882) (-1164.300) (-1163.492) [-1161.977] -- 0:00:32
      470000 -- (-1160.859) [-1161.970] (-1164.989) (-1165.763) * [-1165.233] (-1162.685) (-1163.254) (-1162.392) -- 0:00:32

      Average standard deviation of split frequencies: 0.013822

      470500 -- (-1161.700) [-1162.972] (-1163.327) (-1164.003) * (-1168.188) (-1163.531) [-1163.208] (-1165.135) -- 0:00:32
      471000 -- [-1161.689] (-1162.043) (-1166.809) (-1166.962) * [-1161.556] (-1162.182) (-1162.965) (-1163.575) -- 0:00:32
      471500 -- [-1163.462] (-1165.358) (-1163.890) (-1167.571) * (-1161.593) (-1162.213) [-1161.893] (-1162.793) -- 0:00:32
      472000 -- (-1164.100) (-1166.083) [-1164.558] (-1165.554) * (-1163.241) [-1162.826] (-1161.109) (-1162.593) -- 0:00:32
      472500 -- (-1163.844) (-1163.531) (-1164.575) [-1162.366] * [-1162.283] (-1165.477) (-1161.137) (-1162.946) -- 0:00:32
      473000 -- (-1164.797) (-1164.348) [-1163.246] (-1161.692) * (-1162.805) (-1163.554) (-1168.215) [-1161.170] -- 0:00:32
      473500 -- (-1163.286) (-1162.570) (-1162.534) [-1161.443] * [-1161.260] (-1163.459) (-1168.799) (-1163.114) -- 0:00:32
      474000 -- (-1162.069) [-1161.660] (-1169.516) (-1163.744) * (-1161.454) (-1163.977) (-1164.474) [-1162.802] -- 0:00:32
      474500 -- (-1162.566) [-1161.709] (-1165.642) (-1166.178) * (-1163.086) (-1164.997) [-1163.665] (-1163.008) -- 0:00:32
      475000 -- (-1162.058) [-1162.315] (-1166.937) (-1161.949) * (-1165.676) (-1165.216) [-1166.527] (-1164.101) -- 0:00:32

      Average standard deviation of split frequencies: 0.012874

      475500 -- (-1162.995) (-1163.774) [-1161.885] (-1162.687) * (-1163.070) (-1162.393) [-1162.027] (-1162.204) -- 0:00:31
      476000 -- [-1163.188] (-1165.611) (-1164.349) (-1163.438) * (-1163.408) (-1166.800) (-1162.927) [-1163.183] -- 0:00:31
      476500 -- (-1162.134) [-1161.198] (-1161.890) (-1164.830) * (-1163.107) (-1164.410) [-1162.296] (-1163.824) -- 0:00:31
      477000 -- (-1163.079) [-1165.559] (-1162.513) (-1166.950) * (-1163.070) [-1165.421] (-1168.980) (-1161.757) -- 0:00:31
      477500 -- (-1164.949) [-1165.838] (-1164.519) (-1166.461) * (-1168.677) (-1161.400) [-1161.566] (-1162.309) -- 0:00:31
      478000 -- (-1164.125) (-1164.343) [-1163.317] (-1161.951) * (-1162.851) [-1164.662] (-1163.389) (-1163.580) -- 0:00:31
      478500 -- [-1165.310] (-1165.396) (-1168.498) (-1161.522) * (-1162.778) (-1163.511) (-1165.157) [-1161.348] -- 0:00:31
      479000 -- (-1163.459) (-1163.022) (-1161.226) [-1161.590] * (-1162.522) [-1162.646] (-1162.886) (-1162.551) -- 0:00:31
      479500 -- [-1163.147] (-1161.140) (-1162.814) (-1164.932) * (-1163.741) (-1161.260) [-1161.031] (-1163.081) -- 0:00:32
      480000 -- (-1163.450) [-1161.319] (-1162.100) (-1161.714) * (-1162.310) (-1161.356) [-1160.972] (-1166.649) -- 0:00:32

      Average standard deviation of split frequencies: 0.012161

      480500 -- (-1165.093) [-1162.866] (-1160.927) (-1162.408) * (-1165.572) (-1161.395) [-1160.958] (-1161.984) -- 0:00:32
      481000 -- (-1163.542) (-1163.916) (-1161.013) [-1160.999] * (-1162.962) (-1168.249) (-1160.970) [-1165.457] -- 0:00:32
      481500 -- (-1168.399) (-1163.257) (-1161.033) [-1160.935] * (-1163.241) [-1165.640] (-1161.578) (-1166.125) -- 0:00:32
      482000 -- (-1162.166) [-1163.007] (-1161.383) (-1162.666) * (-1163.795) [-1163.254] (-1164.825) (-1165.724) -- 0:00:32
      482500 -- (-1163.462) (-1162.347) [-1161.293] (-1166.850) * (-1166.985) (-1165.189) (-1164.800) [-1163.788] -- 0:00:32
      483000 -- (-1162.918) [-1161.696] (-1166.289) (-1162.385) * [-1164.391] (-1163.922) (-1165.343) (-1162.391) -- 0:00:32
      483500 -- (-1162.148) [-1163.190] (-1166.321) (-1162.395) * (-1163.018) (-1161.215) (-1164.836) [-1162.250] -- 0:00:32
      484000 -- (-1163.837) [-1161.744] (-1164.812) (-1163.091) * [-1162.436] (-1162.569) (-1165.018) (-1163.961) -- 0:00:31
      484500 -- (-1162.459) (-1162.082) (-1162.942) [-1165.184] * [-1164.755] (-1163.855) (-1162.912) (-1162.814) -- 0:00:31
      485000 -- (-1165.682) (-1162.889) [-1162.751] (-1161.609) * [-1166.149] (-1162.151) (-1161.679) (-1162.132) -- 0:00:31

      Average standard deviation of split frequencies: 0.013386

      485500 -- [-1165.721] (-1163.504) (-1162.674) (-1161.509) * (-1165.833) (-1162.162) [-1161.853] (-1162.038) -- 0:00:31
      486000 -- (-1163.440) (-1163.924) [-1164.621] (-1165.154) * (-1168.520) (-1162.682) [-1161.842] (-1169.529) -- 0:00:31
      486500 -- [-1162.549] (-1168.777) (-1162.179) (-1164.906) * (-1166.840) (-1164.990) [-1162.810] (-1162.830) -- 0:00:31
      487000 -- (-1164.004) (-1163.381) [-1163.317] (-1162.595) * [-1164.795] (-1164.967) (-1166.688) (-1162.935) -- 0:00:31
      487500 -- (-1165.549) (-1161.209) (-1162.765) [-1164.880] * (-1166.532) [-1162.511] (-1164.669) (-1162.372) -- 0:00:31
      488000 -- (-1163.355) [-1162.916] (-1162.432) (-1167.439) * (-1166.646) [-1164.771] (-1165.687) (-1162.255) -- 0:00:31
      488500 -- (-1163.201) [-1161.478] (-1163.257) (-1164.343) * (-1162.981) (-1163.662) [-1165.026] (-1163.289) -- 0:00:31
      489000 -- (-1162.890) [-1164.144] (-1167.452) (-1162.187) * (-1165.435) (-1162.269) [-1165.084] (-1162.628) -- 0:00:31
      489500 -- (-1163.145) (-1165.707) (-1163.197) [-1163.189] * (-1163.862) (-1161.972) [-1167.422] (-1162.458) -- 0:00:31
      490000 -- (-1167.124) (-1163.409) (-1162.470) [-1161.832] * [-1168.448] (-1168.006) (-1167.650) (-1162.102) -- 0:00:31

      Average standard deviation of split frequencies: 0.011721

      490500 -- (-1164.592) [-1163.008] (-1161.771) (-1162.629) * (-1165.892) (-1162.846) [-1161.887] (-1164.048) -- 0:00:31
      491000 -- (-1163.632) (-1161.364) (-1163.757) [-1161.369] * (-1164.140) (-1164.125) [-1162.436] (-1164.281) -- 0:00:31
      491500 -- (-1163.317) (-1161.749) [-1163.457] (-1161.753) * [-1163.922] (-1167.000) (-1164.623) (-1161.960) -- 0:00:31
      492000 -- [-1162.683] (-1163.644) (-1162.104) (-1161.501) * (-1163.106) [-1164.895] (-1164.729) (-1164.610) -- 0:00:30
      492500 -- (-1165.428) (-1161.614) [-1166.966] (-1166.224) * (-1163.593) (-1164.057) [-1164.112] (-1161.496) -- 0:00:30
      493000 -- (-1170.388) (-1161.509) [-1163.983] (-1163.134) * (-1161.852) (-1161.893) (-1162.328) [-1163.240] -- 0:00:30
      493500 -- [-1162.148] (-1161.881) (-1163.343) (-1165.850) * [-1161.928] (-1165.594) (-1162.289) (-1163.084) -- 0:00:30
      494000 -- (-1161.438) (-1167.963) (-1163.255) [-1165.550] * (-1161.672) (-1164.563) (-1164.164) [-1164.818] -- 0:00:30
      494500 -- (-1164.180) [-1161.866] (-1160.973) (-1165.792) * (-1162.840) [-1164.801] (-1161.427) (-1165.349) -- 0:00:30
      495000 -- (-1164.380) (-1162.333) [-1163.492] (-1163.375) * [-1163.685] (-1164.131) (-1161.519) (-1166.061) -- 0:00:30

      Average standard deviation of split frequencies: 0.011215

      495500 -- [-1163.892] (-1162.859) (-1163.249) (-1162.558) * (-1164.699) (-1167.985) (-1163.986) [-1163.854] -- 0:00:30
      496000 -- (-1161.718) [-1162.240] (-1161.305) (-1163.552) * (-1163.711) (-1166.427) (-1162.056) [-1163.091] -- 0:00:31
      496500 -- (-1165.316) (-1163.467) (-1161.409) [-1163.204] * [-1166.453] (-1160.965) (-1163.253) (-1162.777) -- 0:00:31
      497000 -- [-1163.118] (-1161.419) (-1161.128) (-1162.201) * (-1162.409) [-1162.382] (-1163.033) (-1171.121) -- 0:00:31
      497500 -- (-1162.223) (-1161.990) [-1161.285] (-1162.651) * (-1163.912) (-1162.934) [-1166.630] (-1164.458) -- 0:00:31
      498000 -- (-1164.670) (-1164.916) [-1161.052] (-1162.483) * (-1163.446) (-1162.968) (-1168.604) [-1162.764] -- 0:00:31
      498500 -- (-1163.960) (-1162.032) (-1164.612) [-1162.320] * (-1163.775) (-1163.760) [-1165.425] (-1161.739) -- 0:00:31
      499000 -- (-1162.517) (-1161.513) (-1164.903) [-1162.211] * (-1162.724) [-1164.004] (-1163.041) (-1163.443) -- 0:00:31
      499500 -- (-1166.203) [-1160.978] (-1164.599) (-1162.613) * [-1161.571] (-1162.638) (-1163.404) (-1163.610) -- 0:00:31
      500000 -- (-1165.033) (-1162.458) [-1165.499] (-1162.302) * (-1161.677) (-1162.327) (-1162.249) [-1163.015] -- 0:00:31

      Average standard deviation of split frequencies: 0.010734

      500500 -- (-1164.016) (-1165.554) [-1163.750] (-1163.424) * [-1162.462] (-1161.959) (-1162.013) (-1162.998) -- 0:00:30
      501000 -- (-1162.302) (-1163.967) (-1164.870) [-1161.408] * [-1164.632] (-1161.839) (-1161.792) (-1164.317) -- 0:00:30
      501500 -- (-1165.810) (-1161.398) (-1165.950) [-1161.775] * (-1162.685) (-1166.156) [-1161.005] (-1161.062) -- 0:00:30
      502000 -- (-1164.338) (-1162.525) (-1162.823) [-1163.036] * (-1164.764) (-1162.400) [-1162.242] (-1161.565) -- 0:00:30
      502500 -- [-1162.043] (-1163.051) (-1162.600) (-1162.489) * (-1162.967) [-1163.446] (-1162.897) (-1162.130) -- 0:00:30
      503000 -- (-1161.310) (-1161.082) [-1162.502] (-1165.765) * (-1164.736) [-1164.476] (-1162.992) (-1163.387) -- 0:00:30
      503500 -- (-1161.145) (-1162.973) [-1166.528] (-1165.443) * (-1161.780) [-1166.047] (-1164.482) (-1164.311) -- 0:00:30
      504000 -- (-1161.946) (-1162.463) (-1166.548) [-1162.028] * (-1163.594) (-1162.810) [-1165.091] (-1163.763) -- 0:00:30
      504500 -- [-1162.137] (-1163.857) (-1163.753) (-1162.161) * (-1163.092) (-1166.353) [-1163.650] (-1163.794) -- 0:00:30
      505000 -- (-1164.358) (-1163.488) (-1162.749) [-1162.916] * (-1165.288) (-1162.181) (-1163.463) [-1163.422] -- 0:00:30

      Average standard deviation of split frequencies: 0.009503

      505500 -- (-1163.590) (-1165.070) (-1162.133) [-1164.439] * (-1164.521) (-1161.398) (-1164.700) [-1162.040] -- 0:00:30
      506000 -- (-1162.694) [-1163.240] (-1163.939) (-1166.321) * [-1162.790] (-1163.050) (-1165.660) (-1162.867) -- 0:00:30
      506500 -- (-1162.042) (-1164.240) [-1163.397] (-1165.289) * (-1163.289) (-1166.657) [-1166.939] (-1164.730) -- 0:00:30
      507000 -- (-1161.768) (-1164.046) (-1162.651) [-1162.342] * [-1164.360] (-1164.032) (-1165.251) (-1164.952) -- 0:00:30
      507500 -- [-1161.073] (-1161.652) (-1162.472) (-1164.271) * [-1164.262] (-1169.208) (-1162.996) (-1167.738) -- 0:00:30
      508000 -- (-1161.949) [-1165.588] (-1162.306) (-1161.891) * (-1162.177) (-1168.927) [-1164.423] (-1163.200) -- 0:00:30
      508500 -- [-1162.908] (-1166.872) (-1162.064) (-1162.474) * (-1162.707) (-1163.422) (-1165.323) [-1164.497] -- 0:00:29
      509000 -- (-1162.625) (-1169.645) [-1162.322] (-1164.377) * (-1162.414) (-1162.571) [-1163.942] (-1168.022) -- 0:00:29
      509500 -- (-1161.364) [-1167.563] (-1161.580) (-1162.378) * (-1162.235) [-1164.190] (-1165.538) (-1171.781) -- 0:00:29
      510000 -- (-1161.325) (-1164.273) (-1161.580) [-1163.630] * (-1161.306) (-1164.481) (-1168.248) [-1162.934] -- 0:00:29

      Average standard deviation of split frequencies: 0.009231

      510500 -- (-1163.087) (-1166.246) [-1163.521] (-1161.884) * [-1163.160] (-1163.379) (-1165.838) (-1161.980) -- 0:00:29
      511000 -- (-1163.602) (-1162.672) (-1164.130) [-1161.864] * (-1162.014) (-1162.057) (-1164.657) [-1162.111] -- 0:00:29
      511500 -- [-1162.496] (-1162.117) (-1169.009) (-1162.933) * (-1162.149) [-1162.875] (-1166.298) (-1165.831) -- 0:00:29
      512000 -- (-1162.970) (-1161.560) [-1162.007] (-1163.018) * (-1169.893) [-1163.396] (-1163.226) (-1164.654) -- 0:00:29
      512500 -- [-1163.682] (-1161.812) (-1166.019) (-1162.944) * (-1169.408) [-1162.123] (-1164.609) (-1162.852) -- 0:00:29
      513000 -- (-1167.055) (-1163.911) (-1164.346) [-1162.007] * (-1172.865) (-1162.137) [-1163.826] (-1163.306) -- 0:00:29
      513500 -- (-1162.709) [-1163.155] (-1166.163) (-1162.875) * [-1171.773] (-1161.626) (-1164.458) (-1163.443) -- 0:00:30
      514000 -- (-1162.321) [-1163.186] (-1164.334) (-1166.161) * (-1173.360) [-1163.493] (-1162.395) (-1164.251) -- 0:00:30
      514500 -- [-1163.633] (-1165.781) (-1163.901) (-1165.942) * (-1161.985) (-1162.962) [-1162.502] (-1162.161) -- 0:00:30
      515000 -- (-1164.674) [-1162.403] (-1162.789) (-1163.844) * (-1164.354) [-1162.910] (-1163.088) (-1163.358) -- 0:00:30

      Average standard deviation of split frequencies: 0.009318

      515500 -- [-1161.344] (-1162.367) (-1163.876) (-1164.472) * (-1163.425) (-1164.005) (-1162.696) [-1163.619] -- 0:00:30
      516000 -- (-1166.197) (-1162.415) [-1161.360] (-1162.848) * (-1162.822) (-1165.130) [-1161.817] (-1161.844) -- 0:00:30
      516500 -- (-1161.871) (-1163.805) [-1162.924] (-1163.643) * [-1164.934] (-1162.156) (-1161.598) (-1162.554) -- 0:00:29
      517000 -- (-1162.227) [-1163.610] (-1162.886) (-1160.976) * (-1164.696) (-1163.294) [-1161.739] (-1160.994) -- 0:00:29
      517500 -- (-1162.489) (-1162.112) (-1164.068) [-1161.469] * (-1171.642) (-1165.789) (-1167.188) [-1161.690] -- 0:00:29
      518000 -- (-1163.870) [-1162.112] (-1163.711) (-1162.851) * [-1162.384] (-1166.363) (-1163.712) (-1164.683) -- 0:00:29
      518500 -- (-1163.754) (-1161.880) (-1162.371) [-1164.959] * [-1163.094] (-1167.377) (-1163.444) (-1164.184) -- 0:00:29
      519000 -- [-1163.896] (-1161.360) (-1162.367) (-1163.624) * (-1163.371) (-1164.734) [-1161.711] (-1162.675) -- 0:00:29
      519500 -- (-1162.979) [-1161.369] (-1165.129) (-1163.067) * (-1165.435) (-1165.687) [-1162.466] (-1162.669) -- 0:00:29
      520000 -- (-1161.565) (-1163.179) (-1165.355) [-1168.180] * (-1163.987) [-1166.485] (-1162.449) (-1162.413) -- 0:00:29

      Average standard deviation of split frequencies: 0.009597

      520500 -- (-1161.948) (-1165.554) [-1163.779] (-1163.082) * (-1163.780) [-1164.333] (-1163.627) (-1162.250) -- 0:00:29
      521000 -- (-1161.754) (-1165.561) [-1162.915] (-1163.458) * (-1164.369) (-1163.896) (-1162.908) [-1163.075] -- 0:00:29
      521500 -- [-1164.557] (-1165.154) (-1161.617) (-1166.131) * (-1169.192) (-1162.174) [-1162.527] (-1163.280) -- 0:00:29
      522000 -- (-1164.092) [-1165.647] (-1161.941) (-1164.683) * (-1165.856) (-1171.033) [-1163.215] (-1163.594) -- 0:00:29
      522500 -- [-1163.082] (-1163.220) (-1162.438) (-1164.766) * (-1163.672) [-1162.094] (-1162.033) (-1162.747) -- 0:00:29
      523000 -- (-1162.985) (-1165.621) (-1163.343) [-1161.559] * (-1162.500) [-1164.061] (-1163.932) (-1163.818) -- 0:00:29
      523500 -- (-1162.976) (-1160.728) [-1161.941] (-1163.030) * (-1166.747) (-1162.833) [-1162.688] (-1162.583) -- 0:00:29
      524000 -- (-1161.412) (-1161.597) [-1161.886] (-1162.929) * (-1167.661) (-1163.689) (-1164.796) [-1166.017] -- 0:00:29
      524500 -- (-1162.507) (-1163.065) (-1165.646) [-1164.623] * [-1163.125] (-1163.321) (-1162.866) (-1162.258) -- 0:00:29
      525000 -- (-1163.873) [-1163.487] (-1169.239) (-1161.912) * [-1162.058] (-1165.633) (-1162.159) (-1163.707) -- 0:00:28

      Average standard deviation of split frequencies: 0.009858

      525500 -- (-1163.200) (-1163.476) [-1163.351] (-1162.480) * (-1164.683) (-1161.517) (-1163.531) [-1167.033] -- 0:00:28
      526000 -- [-1163.414] (-1166.874) (-1161.364) (-1166.962) * (-1162.500) [-1161.823] (-1162.029) (-1161.817) -- 0:00:28
      526500 -- (-1164.529) (-1165.231) (-1163.436) [-1162.321] * (-1165.154) (-1162.094) (-1164.077) [-1163.195] -- 0:00:28
      527000 -- (-1162.572) (-1163.326) (-1163.567) [-1164.509] * (-1163.322) (-1161.728) [-1163.371] (-1163.689) -- 0:00:28
      527500 -- (-1165.103) (-1169.534) (-1162.115) [-1162.459] * (-1164.291) (-1166.203) (-1162.233) [-1162.835] -- 0:00:28
      528000 -- (-1162.875) [-1163.600] (-1162.353) (-1162.364) * (-1162.845) (-1165.992) [-1161.737] (-1162.182) -- 0:00:28
      528500 -- (-1161.731) (-1163.740) (-1163.676) [-1161.726] * (-1162.922) [-1161.867] (-1167.197) (-1162.958) -- 0:00:28
      529000 -- (-1163.347) [-1164.511] (-1164.824) (-1162.202) * (-1164.268) [-1162.760] (-1161.415) (-1162.695) -- 0:00:28
      529500 -- (-1163.098) [-1164.757] (-1164.969) (-1163.740) * (-1164.341) [-1162.852] (-1161.460) (-1161.862) -- 0:00:29
      530000 -- [-1163.632] (-1162.991) (-1165.923) (-1162.830) * (-1164.030) (-1164.190) (-1163.315) [-1163.761] -- 0:00:29

      Average standard deviation of split frequencies: 0.010660

      530500 -- [-1162.528] (-1163.011) (-1163.035) (-1161.649) * (-1164.535) (-1168.496) (-1162.471) [-1165.275] -- 0:00:29
      531000 -- (-1161.780) (-1168.767) [-1162.488] (-1160.737) * (-1162.914) (-1165.809) [-1160.867] (-1164.480) -- 0:00:29
      531500 -- (-1162.825) (-1166.661) [-1163.699] (-1162.930) * (-1167.040) [-1165.016] (-1163.204) (-1163.113) -- 0:00:29
      532000 -- [-1161.480] (-1164.647) (-1161.103) (-1163.734) * [-1166.950] (-1162.209) (-1166.288) (-1162.938) -- 0:00:29
      532500 -- (-1162.290) [-1162.240] (-1161.043) (-1163.510) * (-1164.837) (-1163.798) [-1163.191] (-1162.379) -- 0:00:28
      533000 -- (-1162.105) (-1163.233) (-1163.633) [-1163.798] * (-1162.537) [-1163.248] (-1162.790) (-1162.565) -- 0:00:28
      533500 -- [-1163.479] (-1161.600) (-1165.615) (-1166.298) * (-1162.545) (-1163.180) [-1162.044] (-1162.995) -- 0:00:28
      534000 -- (-1164.276) (-1161.908) (-1163.854) [-1163.841] * (-1162.548) (-1164.974) (-1162.570) [-1161.996] -- 0:00:28
      534500 -- (-1163.319) [-1161.980] (-1162.077) (-1164.521) * [-1163.803] (-1165.215) (-1163.130) (-1162.657) -- 0:00:28
      535000 -- (-1164.361) [-1162.808] (-1162.834) (-1167.791) * (-1162.518) [-1161.763] (-1165.012) (-1162.335) -- 0:00:28

      Average standard deviation of split frequencies: 0.009498

      535500 -- (-1169.474) [-1163.690] (-1169.251) (-1164.865) * (-1163.240) (-1161.873) [-1161.877] (-1162.194) -- 0:00:28
      536000 -- (-1164.499) (-1164.305) (-1165.091) [-1162.723] * [-1162.889] (-1161.875) (-1162.668) (-1162.506) -- 0:00:28
      536500 -- (-1163.157) (-1168.944) (-1163.245) [-1164.683] * (-1163.177) [-1163.002] (-1162.429) (-1162.531) -- 0:00:28
      537000 -- (-1162.084) (-1162.913) [-1163.245] (-1162.939) * (-1161.843) (-1161.671) [-1162.607] (-1164.205) -- 0:00:28
      537500 -- (-1162.374) (-1166.927) (-1161.907) [-1161.992] * (-1162.382) (-1161.781) (-1162.592) [-1162.612] -- 0:00:28
      538000 -- [-1162.772] (-1165.926) (-1164.049) (-1165.118) * [-1162.705] (-1162.915) (-1163.624) (-1160.988) -- 0:00:28
      538500 -- (-1162.353) (-1165.903) [-1164.620] (-1162.390) * [-1165.960] (-1164.450) (-1163.696) (-1161.543) -- 0:00:28
      539000 -- (-1163.485) (-1162.868) [-1164.300] (-1164.018) * (-1163.402) (-1164.547) [-1163.100] (-1161.840) -- 0:00:28
      539500 -- (-1162.808) (-1161.780) (-1166.291) [-1163.666] * (-1162.060) (-1163.733) (-1162.689) [-1161.673] -- 0:00:28
      540000 -- (-1167.371) (-1163.914) [-1165.113] (-1164.789) * [-1163.682] (-1167.799) (-1163.394) (-1161.679) -- 0:00:28

      Average standard deviation of split frequencies: 0.009416

      540500 -- [-1163.530] (-1163.063) (-1162.552) (-1163.246) * [-1162.634] (-1166.807) (-1164.323) (-1163.758) -- 0:00:28
      541000 -- (-1165.881) (-1164.359) (-1162.324) [-1164.577] * (-1162.749) (-1165.095) [-1162.571] (-1163.200) -- 0:00:27
      541500 -- [-1164.259] (-1165.691) (-1163.073) (-1162.966) * (-1164.427) (-1167.382) [-1161.404] (-1164.003) -- 0:00:27
      542000 -- [-1163.764] (-1163.869) (-1164.192) (-1162.625) * (-1164.256) (-1161.353) (-1161.342) [-1167.301] -- 0:00:27
      542500 -- (-1165.255) [-1163.036] (-1161.715) (-1164.249) * (-1162.452) (-1163.936) (-1163.072) [-1171.778] -- 0:00:27
      543000 -- [-1164.795] (-1163.195) (-1161.752) (-1164.787) * [-1166.923] (-1162.416) (-1166.731) (-1162.363) -- 0:00:27
      543500 -- (-1165.680) (-1167.716) [-1161.462] (-1166.322) * (-1162.048) (-1163.345) (-1166.638) [-1161.507] -- 0:00:27
      544000 -- (-1162.177) (-1165.437) (-1162.280) [-1162.828] * (-1162.501) [-1161.164] (-1164.966) (-1164.879) -- 0:00:27
      544500 -- [-1163.112] (-1162.977) (-1165.120) (-1162.251) * (-1167.024) (-1161.756) (-1164.075) [-1163.431] -- 0:00:27
      545000 -- (-1163.152) (-1163.307) (-1161.056) [-1162.547] * (-1168.035) (-1162.629) (-1163.276) [-1162.658] -- 0:00:27

      Average standard deviation of split frequencies: 0.008288

      545500 -- (-1163.169) [-1163.594] (-1162.012) (-1162.311) * (-1169.583) (-1163.259) [-1166.306] (-1162.172) -- 0:00:27
      546000 -- (-1162.775) [-1162.261] (-1163.033) (-1164.830) * (-1167.402) (-1162.188) [-1163.753] (-1162.136) -- 0:00:27
      546500 -- [-1161.839] (-1162.574) (-1162.730) (-1163.798) * (-1164.546) (-1162.066) (-1168.115) [-1162.719] -- 0:00:27
      547000 -- (-1163.598) [-1162.983] (-1162.898) (-1162.968) * (-1164.556) [-1161.166] (-1162.513) (-1162.269) -- 0:00:28
      547500 -- (-1164.671) [-1162.801] (-1162.493) (-1165.500) * (-1163.987) (-1162.369) [-1161.310] (-1163.083) -- 0:00:28
      548000 -- (-1163.695) [-1162.760] (-1164.763) (-1168.590) * (-1162.171) (-1162.587) [-1163.706] (-1162.606) -- 0:00:28
      548500 -- (-1167.032) (-1162.866) [-1164.381] (-1163.679) * (-1162.776) [-1163.698] (-1164.303) (-1169.680) -- 0:00:27
      549000 -- (-1166.973) (-1163.524) [-1162.442] (-1166.032) * [-1163.760] (-1162.091) (-1164.103) (-1167.400) -- 0:00:27
      549500 -- (-1161.372) [-1162.275] (-1165.281) (-1160.883) * (-1166.898) (-1166.440) (-1164.874) [-1162.274] -- 0:00:27
      550000 -- (-1161.655) (-1167.506) [-1162.755] (-1162.230) * [-1167.246] (-1162.736) (-1164.660) (-1163.802) -- 0:00:27

      Average standard deviation of split frequencies: 0.008047

      550500 -- [-1161.847] (-1164.575) (-1162.770) (-1165.004) * (-1162.642) (-1164.766) (-1162.095) [-1162.962] -- 0:00:27
      551000 -- (-1163.270) [-1165.072] (-1161.082) (-1165.442) * (-1162.133) (-1162.831) (-1162.112) [-1165.426] -- 0:00:27
      551500 -- (-1161.575) [-1163.478] (-1163.483) (-1164.684) * (-1162.616) (-1162.580) (-1163.111) [-1165.313] -- 0:00:27
      552000 -- (-1161.643) [-1161.272] (-1162.871) (-1162.974) * (-1161.998) (-1163.196) [-1161.110] (-1162.066) -- 0:00:27
      552500 -- (-1161.647) [-1161.870] (-1163.559) (-1162.542) * (-1164.107) (-1162.533) [-1164.696] (-1164.070) -- 0:00:27
      553000 -- (-1163.646) [-1163.804] (-1161.446) (-1166.951) * (-1162.050) (-1166.059) [-1162.094] (-1165.113) -- 0:00:27
      553500 -- (-1164.917) [-1164.518] (-1162.885) (-1165.204) * (-1162.927) (-1163.555) (-1162.569) [-1163.785] -- 0:00:27
      554000 -- (-1163.157) (-1162.202) (-1166.271) [-1161.186] * (-1165.932) [-1163.364] (-1162.611) (-1163.582) -- 0:00:27
      554500 -- [-1161.689] (-1161.300) (-1163.813) (-1164.002) * (-1168.282) (-1162.967) [-1165.962] (-1164.753) -- 0:00:27
      555000 -- (-1162.016) [-1161.574] (-1163.495) (-1161.666) * [-1164.716] (-1164.411) (-1162.497) (-1162.645) -- 0:00:27

      Average standard deviation of split frequencies: 0.007461

      555500 -- (-1162.845) [-1163.247] (-1163.809) (-1166.756) * (-1163.173) (-1164.053) (-1165.956) [-1161.163] -- 0:00:27
      556000 -- (-1164.288) [-1162.805] (-1164.222) (-1164.434) * (-1161.237) (-1162.394) [-1161.241] (-1162.327) -- 0:00:27
      556500 -- [-1162.293] (-1164.232) (-1163.995) (-1164.759) * (-1161.228) (-1166.035) [-1161.745] (-1162.074) -- 0:00:27
      557000 -- [-1162.204] (-1164.806) (-1160.911) (-1164.748) * [-1161.474] (-1164.196) (-1161.625) (-1161.610) -- 0:00:27
      557500 -- (-1163.962) [-1161.125] (-1162.291) (-1164.368) * (-1161.500) (-1164.041) (-1164.858) [-1162.437] -- 0:00:26
      558000 -- (-1164.824) [-1161.452] (-1161.724) (-1164.255) * (-1164.810) (-1163.823) (-1161.329) [-1166.787] -- 0:00:26
      558500 -- (-1166.420) (-1164.358) (-1165.803) [-1161.755] * (-1162.276) [-1161.646] (-1163.376) (-1167.074) -- 0:00:26
      559000 -- (-1165.791) (-1164.549) (-1163.739) [-1163.414] * (-1162.220) (-1165.592) [-1166.238] (-1164.804) -- 0:00:26
      559500 -- (-1163.225) (-1164.374) (-1166.575) [-1161.069] * (-1163.607) (-1166.468) (-1163.930) [-1165.457] -- 0:00:26
      560000 -- (-1164.847) (-1165.506) (-1163.935) [-1161.893] * (-1164.456) (-1162.815) (-1166.433) [-1162.866] -- 0:00:26

      Average standard deviation of split frequencies: 0.007567

      560500 -- [-1162.287] (-1164.938) (-1161.667) (-1161.732) * (-1167.194) (-1166.843) (-1162.961) [-1164.116] -- 0:00:26
      561000 -- (-1165.099) (-1162.637) (-1161.711) [-1162.681] * [-1164.911] (-1164.483) (-1163.844) (-1163.134) -- 0:00:26
      561500 -- (-1164.826) [-1164.098] (-1161.671) (-1162.173) * (-1165.728) (-1169.221) (-1163.345) [-1167.308] -- 0:00:26
      562000 -- (-1163.081) [-1161.931] (-1161.986) (-1164.481) * (-1164.641) (-1162.492) [-1163.379] (-1165.043) -- 0:00:26
      562500 -- (-1166.035) [-1162.360] (-1162.773) (-1162.898) * (-1162.849) (-1161.746) [-1162.475] (-1163.345) -- 0:00:26
      563000 -- (-1161.021) [-1161.462] (-1164.838) (-1163.635) * (-1162.102) [-1163.485] (-1163.370) (-1165.157) -- 0:00:27
      563500 -- (-1161.188) (-1162.386) (-1163.763) [-1162.978] * (-1161.459) [-1161.767] (-1162.684) (-1161.772) -- 0:00:27
      564000 -- (-1162.348) (-1160.979) [-1164.324] (-1164.037) * (-1162.267) [-1161.710] (-1166.793) (-1162.519) -- 0:00:27
      564500 -- (-1162.021) (-1161.791) (-1165.036) [-1163.172] * [-1162.948] (-1163.827) (-1165.166) (-1165.807) -- 0:00:27
      565000 -- (-1162.163) (-1161.234) [-1164.345] (-1166.722) * (-1162.296) (-1167.053) (-1163.178) [-1163.679] -- 0:00:26

      Average standard deviation of split frequencies: 0.007496

      565500 -- (-1161.447) [-1161.199] (-1165.434) (-1162.297) * (-1162.053) (-1166.495) (-1164.476) [-1161.883] -- 0:00:26
      566000 -- (-1161.335) (-1161.344) [-1165.104] (-1161.795) * (-1163.280) [-1163.462] (-1163.936) (-1162.933) -- 0:00:26
      566500 -- (-1163.721) [-1161.424] (-1161.204) (-1163.017) * (-1164.187) (-1165.085) [-1162.150] (-1161.136) -- 0:00:26
      567000 -- (-1170.071) (-1169.716) [-1161.080] (-1162.618) * (-1164.527) (-1169.376) (-1163.830) [-1161.156] -- 0:00:26
      567500 -- (-1166.527) (-1164.196) (-1162.126) [-1162.922] * (-1164.831) (-1166.512) [-1161.547] (-1162.831) -- 0:00:26
      568000 -- [-1163.224] (-1165.017) (-1163.277) (-1162.817) * [-1164.176] (-1165.669) (-1162.808) (-1162.233) -- 0:00:26
      568500 -- (-1166.362) (-1162.802) (-1163.583) [-1162.334] * [-1161.481] (-1168.361) (-1162.924) (-1162.031) -- 0:00:26
      569000 -- (-1161.976) [-1163.532] (-1161.846) (-1164.837) * (-1161.532) (-1162.738) [-1161.554] (-1166.074) -- 0:00:26
      569500 -- (-1162.146) (-1163.721) [-1162.317] (-1161.549) * (-1165.881) (-1162.298) (-1161.543) [-1164.564] -- 0:00:26
      570000 -- (-1164.056) (-1161.877) (-1162.724) [-1162.382] * (-1163.301) (-1165.217) [-1161.396] (-1163.734) -- 0:00:26

      Average standard deviation of split frequencies: 0.007435

      570500 -- [-1162.565] (-1167.015) (-1161.789) (-1162.491) * (-1161.607) (-1162.123) [-1163.781] (-1163.138) -- 0:00:26
      571000 -- [-1164.316] (-1165.197) (-1162.943) (-1166.017) * (-1162.080) [-1162.088] (-1161.611) (-1163.929) -- 0:00:26
      571500 -- (-1163.314) [-1163.043] (-1164.677) (-1161.736) * (-1165.005) [-1164.838] (-1162.301) (-1168.899) -- 0:00:26
      572000 -- (-1162.398) (-1162.114) (-1166.283) [-1163.060] * [-1161.874] (-1164.154) (-1165.432) (-1164.362) -- 0:00:26
      572500 -- (-1162.053) (-1163.264) [-1162.478] (-1163.033) * (-1162.116) [-1162.247] (-1164.438) (-1161.880) -- 0:00:26
      573000 -- [-1164.476] (-1162.953) (-1161.750) (-1161.421) * (-1162.467) [-1162.304] (-1167.308) (-1162.334) -- 0:00:26
      573500 -- (-1167.062) (-1162.567) (-1162.952) [-1163.538] * (-1162.385) [-1164.066] (-1164.527) (-1162.779) -- 0:00:26
      574000 -- (-1162.025) (-1162.052) [-1165.959] (-1162.692) * (-1161.574) (-1162.217) (-1163.324) [-1161.622] -- 0:00:25
      574500 -- (-1164.519) (-1162.291) [-1164.378] (-1163.029) * (-1162.638) [-1163.392] (-1162.887) (-1164.451) -- 0:00:25
      575000 -- (-1163.700) (-1161.491) [-1162.402] (-1163.626) * (-1161.908) (-1163.181) (-1165.385) [-1163.328] -- 0:00:25

      Average standard deviation of split frequencies: 0.008020

      575500 -- (-1164.385) [-1162.030] (-1160.945) (-1163.436) * (-1162.579) [-1164.778] (-1164.288) (-1163.330) -- 0:00:25
      576000 -- (-1167.715) [-1163.660] (-1162.271) (-1163.037) * (-1162.876) (-1164.052) [-1161.759] (-1165.471) -- 0:00:25
      576500 -- (-1165.912) [-1167.229] (-1163.046) (-1162.656) * (-1165.187) (-1162.659) (-1163.050) [-1163.885] -- 0:00:25
      577000 -- (-1162.987) (-1161.147) (-1161.595) [-1163.478] * (-1163.368) (-1164.702) (-1165.186) [-1165.892] -- 0:00:25
      577500 -- [-1163.090] (-1161.243) (-1161.578) (-1162.172) * [-1162.301] (-1163.627) (-1161.644) (-1163.542) -- 0:00:25
      578000 -- [-1164.312] (-1162.854) (-1161.603) (-1162.843) * (-1161.848) (-1161.649) (-1163.830) [-1164.293] -- 0:00:25
      578500 -- (-1162.563) [-1162.118] (-1162.051) (-1163.342) * (-1161.719) [-1162.464] (-1163.747) (-1162.743) -- 0:00:25
      579000 -- [-1164.146] (-1163.234) (-1164.414) (-1163.556) * (-1160.807) (-1162.378) [-1162.069] (-1163.360) -- 0:00:26
      579500 -- (-1163.075) (-1161.429) [-1163.451] (-1161.472) * (-1161.865) (-1163.164) [-1163.058] (-1163.408) -- 0:00:26
      580000 -- (-1161.879) [-1162.392] (-1166.063) (-1161.372) * (-1163.069) [-1161.819] (-1161.258) (-1162.426) -- 0:00:26

      Average standard deviation of split frequencies: 0.008768

      580500 -- (-1162.787) (-1161.569) [-1162.367] (-1161.094) * (-1164.534) (-1161.442) (-1162.554) [-1162.625] -- 0:00:26
      581000 -- (-1164.653) [-1162.250] (-1164.766) (-1162.456) * (-1162.791) (-1162.824) [-1162.279] (-1162.302) -- 0:00:25
      581500 -- (-1162.355) (-1164.518) [-1161.849] (-1168.020) * (-1164.554) [-1161.587] (-1163.608) (-1163.916) -- 0:00:25
      582000 -- [-1162.311] (-1167.333) (-1164.585) (-1165.632) * (-1166.405) (-1162.371) (-1164.008) [-1162.239] -- 0:00:25
      582500 -- (-1161.840) (-1163.301) [-1161.579] (-1166.411) * (-1162.372) (-1162.653) (-1165.397) [-1163.592] -- 0:00:25
      583000 -- (-1161.820) (-1161.414) [-1165.264] (-1172.074) * (-1162.966) [-1162.734] (-1164.782) (-1164.924) -- 0:00:25
      583500 -- (-1162.896) (-1161.486) [-1162.468] (-1167.582) * [-1162.884] (-1161.462) (-1166.867) (-1163.496) -- 0:00:25
      584000 -- (-1163.063) (-1162.297) (-1163.037) [-1161.308] * (-1163.301) [-1161.373] (-1167.391) (-1161.040) -- 0:00:25
      584500 -- [-1165.485] (-1164.435) (-1162.788) (-1162.361) * [-1164.398] (-1160.989) (-1164.344) (-1162.458) -- 0:00:25
      585000 -- (-1163.369) [-1162.899] (-1164.816) (-1163.089) * (-1164.534) (-1162.104) [-1163.018] (-1162.771) -- 0:00:25

      Average standard deviation of split frequencies: 0.008366

      585500 -- (-1164.028) [-1162.458] (-1161.082) (-1162.018) * [-1165.094] (-1161.256) (-1168.438) (-1161.599) -- 0:00:25
      586000 -- [-1163.273] (-1161.351) (-1164.703) (-1163.732) * (-1164.743) (-1161.699) [-1162.043] (-1163.936) -- 0:00:25
      586500 -- [-1163.090] (-1161.272) (-1168.665) (-1161.676) * (-1165.470) [-1161.032] (-1161.642) (-1161.667) -- 0:00:25
      587000 -- [-1163.865] (-1161.557) (-1161.986) (-1165.359) * (-1165.012) (-1161.299) (-1165.555) [-1161.217] -- 0:00:25
      587500 -- (-1165.586) [-1161.946] (-1165.738) (-1170.477) * (-1161.578) [-1163.601] (-1160.960) (-1161.239) -- 0:00:25
      588000 -- (-1163.338) (-1165.057) [-1164.577] (-1166.302) * (-1161.178) (-1163.870) [-1161.121] (-1162.743) -- 0:00:25
      588500 -- (-1161.925) [-1162.960] (-1166.135) (-1163.491) * (-1162.767) (-1162.392) [-1162.653] (-1162.686) -- 0:00:25
      589000 -- (-1162.311) (-1161.867) [-1162.952] (-1162.592) * (-1161.456) (-1161.416) (-1161.865) [-1161.982] -- 0:00:25
      589500 -- (-1163.995) (-1164.725) [-1161.727] (-1162.404) * (-1161.209) [-1161.689] (-1161.817) (-1162.435) -- 0:00:25
      590000 -- (-1161.216) [-1162.937] (-1165.209) (-1161.586) * (-1164.542) (-1163.026) [-1163.357] (-1163.527) -- 0:00:25

      Average standard deviation of split frequencies: 0.008939

      590500 -- [-1161.761] (-1162.108) (-1165.505) (-1164.794) * [-1162.727] (-1164.398) (-1163.426) (-1164.169) -- 0:00:24
      591000 -- [-1162.751] (-1164.254) (-1165.732) (-1166.489) * (-1167.716) (-1161.495) [-1164.372] (-1161.571) -- 0:00:24
      591500 -- (-1162.084) [-1163.150] (-1165.806) (-1164.902) * (-1165.378) (-1162.539) [-1162.998] (-1161.944) -- 0:00:24
      592000 -- [-1163.085] (-1169.813) (-1167.234) (-1161.572) * (-1163.660) (-1161.843) (-1162.553) [-1161.339] -- 0:00:24
      592500 -- (-1164.602) (-1162.630) [-1164.546] (-1163.269) * (-1163.988) [-1161.664] (-1162.612) (-1161.929) -- 0:00:24
      593000 -- (-1165.738) (-1162.895) (-1162.966) [-1161.869] * (-1171.222) [-1162.309] (-1162.759) (-1163.271) -- 0:00:24
      593500 -- (-1161.800) (-1162.368) [-1163.551] (-1162.908) * [-1161.354] (-1161.430) (-1162.879) (-1164.226) -- 0:00:24
      594000 -- (-1165.459) (-1162.271) [-1163.900] (-1166.699) * (-1165.743) (-1162.056) [-1161.332] (-1162.426) -- 0:00:24
      594500 -- [-1162.753] (-1163.381) (-1163.998) (-1164.989) * (-1167.211) (-1162.011) [-1161.176] (-1163.312) -- 0:00:24
      595000 -- (-1165.879) (-1162.087) [-1164.100] (-1163.547) * (-1164.490) (-1162.346) [-1161.227] (-1162.536) -- 0:00:24

      Average standard deviation of split frequencies: 0.008700

      595500 -- (-1165.822) [-1164.436] (-1165.953) (-1162.899) * (-1164.913) (-1162.352) (-1162.072) [-1161.180] -- 0:00:25
      596000 -- (-1169.772) (-1164.060) [-1162.365] (-1164.590) * (-1162.120) (-1163.465) [-1162.263] (-1166.658) -- 0:00:25
      596500 -- (-1162.646) (-1164.069) (-1163.223) [-1161.318] * (-1163.974) (-1162.783) (-1162.824) [-1163.401] -- 0:00:25
      597000 -- [-1164.138] (-1163.409) (-1165.892) (-1166.726) * (-1164.504) (-1168.701) (-1161.587) [-1161.595] -- 0:00:24
      597500 -- [-1162.544] (-1162.454) (-1163.298) (-1162.268) * [-1168.925] (-1163.567) (-1161.877) (-1161.774) -- 0:00:24
      598000 -- [-1162.986] (-1166.595) (-1163.510) (-1164.501) * (-1164.176) (-1165.647) (-1167.018) [-1161.768] -- 0:00:24
      598500 -- (-1164.623) (-1162.656) [-1164.895] (-1164.514) * (-1163.801) (-1162.063) (-1165.181) [-1164.968] -- 0:00:24
      599000 -- (-1169.831) [-1162.728] (-1170.560) (-1160.916) * [-1162.114] (-1162.330) (-1164.745) (-1162.072) -- 0:00:24
      599500 -- [-1169.534] (-1162.938) (-1169.898) (-1161.502) * (-1163.687) (-1171.882) [-1164.117] (-1161.865) -- 0:00:24
      600000 -- (-1169.624) [-1161.475] (-1161.377) (-1162.531) * (-1163.856) (-1165.260) [-1164.608] (-1165.295) -- 0:00:24

      Average standard deviation of split frequencies: 0.008633

      600500 -- [-1168.982] (-1167.259) (-1163.670) (-1162.395) * [-1163.261] (-1164.260) (-1162.767) (-1161.874) -- 0:00:24
      601000 -- (-1162.849) (-1163.087) [-1166.441] (-1162.476) * [-1162.381] (-1162.635) (-1161.323) (-1162.267) -- 0:00:24
      601500 -- (-1161.913) [-1162.182] (-1161.823) (-1162.890) * (-1162.688) (-1161.567) (-1162.494) [-1161.861] -- 0:00:24
      602000 -- [-1162.165] (-1161.400) (-1162.508) (-1163.673) * (-1162.737) [-1164.283] (-1161.496) (-1163.717) -- 0:00:24
      602500 -- (-1163.793) [-1164.878] (-1167.134) (-1167.398) * (-1162.195) (-1163.548) [-1162.452] (-1163.964) -- 0:00:24
      603000 -- (-1163.019) (-1165.909) (-1165.335) [-1163.098] * (-1163.744) [-1162.134] (-1161.222) (-1164.195) -- 0:00:24
      603500 -- [-1163.902] (-1163.914) (-1162.247) (-1162.287) * (-1162.495) [-1163.599] (-1161.027) (-1165.550) -- 0:00:24
      604000 -- (-1163.459) (-1165.570) (-1164.145) [-1163.636] * (-1162.951) [-1162.904] (-1162.040) (-1162.461) -- 0:00:24
      604500 -- [-1162.270] (-1163.035) (-1168.352) (-1163.532) * (-1162.297) [-1163.085] (-1162.824) (-1163.066) -- 0:00:24
      605000 -- (-1164.180) [-1164.252] (-1164.867) (-1164.684) * (-1164.884) (-1163.949) (-1162.368) [-1162.274] -- 0:00:24

      Average standard deviation of split frequencies: 0.008712

      605500 -- [-1162.786] (-1162.552) (-1164.384) (-1163.108) * (-1163.403) [-1162.721] (-1162.293) (-1162.268) -- 0:00:24
      606000 -- (-1162.368) [-1165.988] (-1166.213) (-1163.246) * (-1162.024) (-1164.470) [-1163.790] (-1163.141) -- 0:00:24
      606500 -- (-1165.194) [-1162.133] (-1161.813) (-1163.715) * (-1161.332) (-1163.958) [-1164.980] (-1163.297) -- 0:00:24
      607000 -- (-1164.911) (-1161.175) (-1162.335) [-1164.733] * (-1161.552) [-1163.609] (-1163.148) (-1168.428) -- 0:00:23
      607500 -- [-1164.900] (-1162.339) (-1162.029) (-1162.121) * (-1164.570) [-1164.944] (-1165.000) (-1173.549) -- 0:00:23
      608000 -- [-1162.861] (-1165.995) (-1162.407) (-1161.410) * (-1167.092) [-1169.026] (-1164.715) (-1173.779) -- 0:00:23
      608500 -- (-1161.633) (-1162.388) (-1160.714) [-1161.492] * (-1163.620) (-1161.655) [-1161.930] (-1162.145) -- 0:00:23
      609000 -- (-1165.824) (-1162.883) [-1161.741] (-1162.613) * [-1165.874] (-1161.704) (-1163.249) (-1163.450) -- 0:00:23
      609500 -- [-1166.422] (-1162.318) (-1163.998) (-1161.184) * (-1163.785) (-1163.577) (-1161.184) [-1162.252] -- 0:00:23
      610000 -- (-1165.260) (-1162.748) (-1166.302) [-1163.108] * (-1163.124) (-1166.548) (-1165.560) [-1162.341] -- 0:00:23

      Average standard deviation of split frequencies: 0.007874

      610500 -- (-1161.629) [-1162.307] (-1163.648) (-1162.069) * (-1161.732) [-1163.516] (-1164.315) (-1164.026) -- 0:00:23
      611000 -- (-1162.363) (-1163.813) (-1164.633) [-1161.606] * (-1162.069) (-1162.953) (-1164.161) [-1161.856] -- 0:00:23
      611500 -- (-1162.426) (-1162.532) [-1164.578] (-1161.959) * (-1161.043) (-1163.728) (-1163.968) [-1166.626] -- 0:00:24
      612000 -- (-1163.464) (-1164.499) (-1161.623) [-1162.046] * [-1162.100] (-1162.253) (-1162.230) (-1164.136) -- 0:00:24
      612500 -- (-1163.912) (-1164.615) [-1168.278] (-1164.260) * [-1165.938] (-1161.874) (-1163.760) (-1163.265) -- 0:00:24
      613000 -- [-1163.491] (-1163.769) (-1161.836) (-1163.269) * (-1163.440) (-1161.709) (-1166.941) [-1161.980] -- 0:00:23
      613500 -- (-1162.589) (-1162.963) (-1163.614) [-1162.532] * [-1162.332] (-1161.602) (-1165.202) (-1164.516) -- 0:00:23
      614000 -- (-1163.482) [-1165.143] (-1163.631) (-1164.176) * [-1163.211] (-1169.506) (-1168.668) (-1162.624) -- 0:00:23
      614500 -- (-1163.680) (-1162.815) [-1165.170] (-1166.007) * [-1163.229] (-1164.470) (-1168.683) (-1163.089) -- 0:00:23
      615000 -- [-1163.327] (-1163.203) (-1163.871) (-1166.505) * [-1163.063] (-1162.055) (-1165.312) (-1162.714) -- 0:00:23

      Average standard deviation of split frequencies: 0.008418

      615500 -- [-1163.440] (-1162.255) (-1164.409) (-1163.903) * (-1164.614) [-1161.976] (-1163.027) (-1164.885) -- 0:00:23
      616000 -- [-1163.886] (-1164.450) (-1162.335) (-1166.810) * [-1164.087] (-1163.571) (-1165.782) (-1163.534) -- 0:00:23
      616500 -- [-1163.230] (-1161.385) (-1162.391) (-1163.225) * [-1165.268] (-1165.028) (-1163.857) (-1164.260) -- 0:00:23
      617000 -- [-1164.186] (-1164.060) (-1165.253) (-1163.350) * (-1164.056) [-1166.045] (-1163.085) (-1164.797) -- 0:00:23
      617500 -- [-1161.463] (-1162.477) (-1161.574) (-1163.390) * [-1165.341] (-1166.272) (-1165.774) (-1163.888) -- 0:00:23
      618000 -- (-1160.966) [-1162.317] (-1161.904) (-1164.376) * (-1164.465) (-1164.373) [-1164.896] (-1164.975) -- 0:00:23
      618500 -- (-1162.511) (-1162.021) [-1161.410] (-1162.797) * (-1168.964) (-1165.973) [-1163.808] (-1162.691) -- 0:00:23
      619000 -- (-1163.398) (-1161.548) (-1164.416) [-1162.070] * (-1162.179) (-1163.783) (-1161.305) [-1163.967] -- 0:00:23
      619500 -- [-1164.928] (-1161.920) (-1163.553) (-1161.408) * (-1161.234) (-1162.643) (-1162.625) [-1167.044] -- 0:00:23
      620000 -- (-1166.751) (-1162.237) [-1163.977] (-1165.425) * (-1161.972) (-1162.767) [-1162.600] (-1165.482) -- 0:00:23

      Average standard deviation of split frequencies: 0.008051

      620500 -- (-1164.454) [-1162.186] (-1164.782) (-1164.160) * (-1161.648) (-1162.665) [-1160.886] (-1164.544) -- 0:00:23
      621000 -- [-1164.208] (-1162.048) (-1163.433) (-1162.685) * (-1166.568) (-1163.167) (-1163.475) [-1164.367] -- 0:00:23
      621500 -- (-1162.943) [-1165.375] (-1164.743) (-1161.253) * (-1162.738) (-1161.127) [-1161.701] (-1164.259) -- 0:00:23
      622000 -- (-1162.913) (-1161.544) [-1163.811] (-1162.859) * (-1163.291) [-1161.713] (-1162.981) (-1161.652) -- 0:00:23
      622500 -- [-1163.182] (-1165.879) (-1162.201) (-1163.727) * (-1164.790) (-1163.252) (-1161.322) [-1161.465] -- 0:00:23
      623000 -- [-1161.978] (-1164.313) (-1163.318) (-1161.638) * (-1166.980) [-1164.474] (-1162.501) (-1161.776) -- 0:00:22
      623500 -- (-1163.987) (-1163.033) (-1170.887) [-1161.375] * (-1165.151) (-1165.884) (-1162.106) [-1162.372] -- 0:00:22
      624000 -- (-1166.648) (-1163.011) [-1166.827] (-1162.412) * (-1163.380) (-1163.882) [-1165.307] (-1163.293) -- 0:00:22
      624500 -- [-1161.263] (-1162.576) (-1163.751) (-1163.414) * (-1162.110) (-1162.352) [-1162.612] (-1163.471) -- 0:00:22
      625000 -- (-1161.767) (-1163.157) (-1163.337) [-1162.561] * [-1162.545] (-1162.987) (-1164.289) (-1166.005) -- 0:00:22

      Average standard deviation of split frequencies: 0.008283

      625500 -- (-1165.011) [-1161.926] (-1168.616) (-1164.258) * [-1161.818] (-1162.701) (-1164.330) (-1161.589) -- 0:00:22
      626000 -- (-1161.776) (-1163.159) [-1166.311] (-1164.020) * (-1166.524) [-1161.797] (-1163.795) (-1164.650) -- 0:00:22
      626500 -- (-1162.128) (-1161.029) [-1161.650] (-1161.543) * (-1162.328) [-1162.901] (-1164.793) (-1165.093) -- 0:00:22
      627000 -- [-1163.554] (-1161.776) (-1164.796) (-1163.865) * (-1161.749) [-1162.476] (-1166.189) (-1161.163) -- 0:00:22
      627500 -- (-1163.798) [-1162.331] (-1162.782) (-1163.411) * [-1162.115] (-1162.468) (-1162.964) (-1160.851) -- 0:00:22
      628000 -- (-1161.286) (-1161.291) (-1166.368) [-1164.639] * (-1161.573) [-1163.325] (-1163.130) (-1160.817) -- 0:00:22
      628500 -- (-1163.537) (-1162.589) [-1167.788] (-1165.161) * (-1162.421) (-1162.557) [-1166.616] (-1164.903) -- 0:00:23
      629000 -- (-1164.300) [-1163.323] (-1165.976) (-1162.766) * [-1164.499] (-1162.109) (-1161.047) (-1167.946) -- 0:00:23
      629500 -- (-1164.622) (-1163.061) (-1162.651) [-1161.403] * (-1165.945) (-1162.700) [-1161.261] (-1162.916) -- 0:00:22
      630000 -- (-1166.744) (-1163.248) [-1163.549] (-1162.029) * (-1162.881) [-1162.360] (-1162.349) (-1163.054) -- 0:00:22

      Average standard deviation of split frequencies: 0.008073

      630500 -- (-1163.843) (-1164.066) (-1162.670) [-1162.391] * (-1164.224) [-1162.676] (-1165.058) (-1162.585) -- 0:00:22
      631000 -- [-1162.130] (-1162.646) (-1163.744) (-1161.252) * (-1165.301) (-1164.609) (-1164.454) [-1161.861] -- 0:00:22
      631500 -- (-1163.486) (-1162.024) [-1167.462] (-1163.219) * [-1163.056] (-1163.891) (-1166.696) (-1162.958) -- 0:00:22
      632000 -- (-1164.275) (-1160.924) [-1165.321] (-1164.901) * (-1161.944) [-1163.087] (-1168.345) (-1162.488) -- 0:00:22
      632500 -- (-1161.976) [-1164.193] (-1164.714) (-1162.254) * (-1163.210) (-1161.696) [-1162.014] (-1162.565) -- 0:00:22
      633000 -- (-1162.012) (-1165.046) (-1167.374) [-1161.463] * (-1162.341) [-1161.429] (-1165.171) (-1163.655) -- 0:00:22
      633500 -- (-1162.653) (-1162.185) (-1165.009) [-1162.437] * [-1163.414] (-1161.807) (-1163.581) (-1162.062) -- 0:00:22
      634000 -- (-1162.949) [-1162.187] (-1171.171) (-1161.643) * (-1164.563) (-1165.268) [-1162.728] (-1161.394) -- 0:00:22
      634500 -- [-1162.756] (-1163.918) (-1167.269) (-1164.758) * (-1162.259) [-1162.485] (-1162.434) (-1162.675) -- 0:00:22
      635000 -- (-1161.407) (-1162.296) (-1163.890) [-1162.739] * [-1166.162] (-1161.832) (-1163.181) (-1165.407) -- 0:00:22

      Average standard deviation of split frequencies: 0.009191

      635500 -- (-1161.246) [-1161.464] (-1160.784) (-1166.016) * [-1162.888] (-1162.245) (-1162.966) (-1162.464) -- 0:00:22
      636000 -- [-1168.940] (-1161.294) (-1164.414) (-1161.831) * (-1162.212) (-1164.723) [-1161.487] (-1160.911) -- 0:00:22
      636500 -- (-1165.068) [-1161.356] (-1162.099) (-1161.325) * (-1163.855) (-1162.770) (-1162.096) [-1161.950] -- 0:00:22
      637000 -- (-1167.442) (-1165.158) (-1170.237) [-1163.576] * (-1167.662) (-1162.996) [-1161.308] (-1163.959) -- 0:00:22
      637500 -- (-1165.478) (-1165.298) [-1161.851] (-1163.653) * (-1163.083) (-1162.563) (-1164.251) [-1162.054] -- 0:00:22
      638000 -- [-1164.787] (-1166.546) (-1164.718) (-1165.344) * (-1162.500) [-1165.561] (-1163.976) (-1163.728) -- 0:00:22
      638500 -- (-1165.126) (-1169.249) [-1163.579] (-1165.537) * (-1164.905) [-1162.536] (-1161.844) (-1164.913) -- 0:00:22
      639000 -- (-1166.361) (-1164.312) (-1162.443) [-1163.032] * (-1161.986) (-1164.630) (-1166.244) [-1160.838] -- 0:00:22
      639500 -- [-1167.995] (-1163.312) (-1163.957) (-1162.701) * (-1164.987) (-1168.044) (-1163.520) [-1160.854] -- 0:00:21
      640000 -- [-1161.532] (-1162.357) (-1170.531) (-1161.847) * [-1162.574] (-1166.429) (-1162.397) (-1164.242) -- 0:00:21

      Average standard deviation of split frequencies: 0.009713

      640500 -- [-1161.499] (-1162.838) (-1167.873) (-1164.992) * [-1162.261] (-1167.710) (-1162.828) (-1163.449) -- 0:00:21
      641000 -- (-1161.217) [-1161.460] (-1164.839) (-1162.253) * (-1164.332) (-1170.450) (-1166.542) [-1162.373] -- 0:00:21
      641500 -- (-1161.854) (-1162.971) [-1162.696] (-1162.823) * (-1163.232) (-1166.661) [-1162.845] (-1164.065) -- 0:00:21
      642000 -- (-1162.614) (-1162.645) (-1162.355) [-1162.389] * (-1165.161) [-1162.503] (-1161.953) (-1161.996) -- 0:00:21
      642500 -- [-1164.166] (-1162.637) (-1163.498) (-1162.998) * (-1166.105) (-1169.113) (-1163.422) [-1163.727] -- 0:00:21
      643000 -- (-1161.335) (-1162.644) [-1162.039] (-1163.520) * [-1164.273] (-1163.452) (-1162.771) (-1162.451) -- 0:00:21
      643500 -- (-1161.798) [-1161.074] (-1165.257) (-1162.517) * (-1165.982) (-1165.864) [-1164.611] (-1164.992) -- 0:00:21
      644000 -- [-1162.929] (-1163.173) (-1163.928) (-1164.213) * (-1164.636) (-1164.050) [-1162.259] (-1165.187) -- 0:00:21
      644500 -- (-1162.599) (-1164.154) [-1165.389] (-1167.855) * [-1163.271] (-1165.193) (-1166.803) (-1167.944) -- 0:00:21
      645000 -- (-1163.945) (-1164.247) (-1163.233) [-1161.345] * [-1162.457] (-1164.031) (-1166.489) (-1165.392) -- 0:00:21

      Average standard deviation of split frequencies: 0.010362

      645500 -- (-1165.560) (-1166.990) [-1162.704] (-1161.018) * (-1168.530) (-1164.074) (-1163.609) [-1163.031] -- 0:00:21
      646000 -- [-1162.733] (-1165.659) (-1162.920) (-1161.673) * (-1166.610) (-1163.657) (-1163.589) [-1162.040] -- 0:00:21
      646500 -- (-1167.619) [-1165.748] (-1166.657) (-1162.861) * (-1162.154) (-1163.630) (-1164.092) [-1163.054] -- 0:00:21
      647000 -- (-1161.637) (-1165.870) (-1161.839) [-1161.927] * [-1161.335] (-1165.599) (-1162.538) (-1162.257) -- 0:00:21
      647500 -- (-1163.665) (-1166.246) (-1162.503) [-1161.766] * [-1161.476] (-1167.777) (-1163.311) (-1162.681) -- 0:00:21
      648000 -- (-1165.888) (-1165.229) (-1163.502) [-1162.018] * (-1164.483) (-1165.766) [-1162.640] (-1163.550) -- 0:00:21
      648500 -- (-1162.863) (-1162.924) [-1166.505] (-1164.221) * (-1165.914) (-1163.147) [-1162.421] (-1161.971) -- 0:00:21
      649000 -- (-1164.994) (-1163.727) [-1161.727] (-1162.104) * (-1162.484) (-1162.444) (-1162.498) [-1160.911] -- 0:00:21
      649500 -- (-1164.344) (-1164.646) [-1161.418] (-1162.817) * (-1165.436) (-1165.083) (-1161.925) [-1162.782] -- 0:00:21
      650000 -- (-1161.707) [-1162.645] (-1162.064) (-1163.073) * (-1173.547) (-1162.490) (-1162.625) [-1162.142] -- 0:00:21

      Average standard deviation of split frequencies: 0.009418

      650500 -- (-1161.592) (-1170.416) [-1162.708] (-1163.383) * (-1166.030) (-1166.648) [-1163.336] (-1163.353) -- 0:00:21
      651000 -- (-1169.173) (-1164.589) (-1162.093) [-1161.684] * (-1163.767) (-1162.731) [-1162.417] (-1163.097) -- 0:00:21
      651500 -- (-1164.819) [-1163.687] (-1163.339) (-1161.320) * (-1161.833) [-1162.548] (-1162.979) (-1164.382) -- 0:00:21
      652000 -- [-1162.702] (-1163.698) (-1162.548) (-1161.204) * [-1165.537] (-1163.689) (-1165.927) (-1164.100) -- 0:00:21
      652500 -- (-1161.410) (-1162.629) (-1161.788) [-1160.906] * (-1162.674) (-1163.968) (-1162.614) [-1163.531] -- 0:00:21
      653000 -- [-1161.176] (-1164.797) (-1163.892) (-1161.687) * (-1164.321) [-1163.252] (-1165.506) (-1164.458) -- 0:00:21
      653500 -- (-1162.132) (-1160.956) [-1164.229] (-1162.242) * (-1165.263) [-1161.592] (-1163.078) (-1166.786) -- 0:00:21
      654000 -- (-1164.305) (-1167.342) (-1162.915) [-1164.009] * (-1164.935) (-1167.239) (-1162.671) [-1161.514] -- 0:00:21
      654500 -- [-1163.421] (-1163.988) (-1163.806) (-1165.830) * (-1165.689) (-1164.156) [-1166.393] (-1161.632) -- 0:00:21
      655000 -- (-1162.587) [-1163.481] (-1166.711) (-1166.805) * (-1165.911) (-1166.493) (-1163.069) [-1163.487] -- 0:00:21

      Average standard deviation of split frequencies: 0.009629

      655500 -- (-1161.724) (-1164.093) (-1163.266) [-1163.098] * [-1164.915] (-1161.922) (-1163.324) (-1162.898) -- 0:00:21
      656000 -- (-1163.187) [-1163.836] (-1162.142) (-1161.914) * (-1166.428) (-1161.419) [-1166.559] (-1166.887) -- 0:00:20
      656500 -- (-1161.837) [-1162.055] (-1165.058) (-1162.520) * (-1162.515) (-1162.126) (-1163.696) [-1161.341] -- 0:00:20
      657000 -- (-1163.266) [-1161.430] (-1161.881) (-1163.008) * (-1161.516) (-1161.322) (-1161.470) [-1164.201] -- 0:00:20
      657500 -- (-1164.450) [-1164.460] (-1164.063) (-1163.031) * (-1162.907) [-1162.001] (-1162.138) (-1162.973) -- 0:00:20
      658000 -- [-1162.749] (-1162.927) (-1167.087) (-1172.127) * (-1170.220) (-1161.856) [-1163.649] (-1161.754) -- 0:00:20
      658500 -- [-1162.977] (-1163.283) (-1162.606) (-1168.228) * (-1165.834) [-1164.152] (-1164.506) (-1162.319) -- 0:00:20
      659000 -- (-1161.736) (-1162.988) (-1163.771) [-1165.682] * (-1166.326) (-1164.328) (-1162.779) [-1162.408] -- 0:00:20
      659500 -- (-1163.202) (-1161.523) (-1166.291) [-1161.814] * [-1162.874] (-1165.902) (-1163.679) (-1164.261) -- 0:00:20
      660000 -- (-1162.344) (-1162.120) (-1163.938) [-1162.115] * (-1162.483) (-1162.646) (-1161.958) [-1165.927] -- 0:00:20

      Average standard deviation of split frequencies: 0.010275

      660500 -- (-1167.114) (-1164.426) (-1162.032) [-1163.275] * (-1162.757) (-1163.877) [-1161.548] (-1163.399) -- 0:00:20
      661000 -- [-1168.671] (-1165.819) (-1165.199) (-1165.884) * (-1165.898) [-1161.215] (-1163.188) (-1164.685) -- 0:00:21
      661500 -- [-1163.508] (-1163.358) (-1165.047) (-1163.767) * [-1167.120] (-1161.788) (-1166.409) (-1163.975) -- 0:00:20
      662000 -- (-1162.544) (-1163.151) (-1162.675) [-1167.060] * [-1161.294] (-1165.567) (-1164.501) (-1163.169) -- 0:00:20
      662500 -- (-1163.417) (-1162.137) [-1163.825] (-1163.637) * (-1161.972) (-1164.118) [-1161.812] (-1164.179) -- 0:00:20
      663000 -- (-1163.377) [-1163.125] (-1164.627) (-1165.240) * (-1162.445) (-1163.426) [-1162.004] (-1162.083) -- 0:00:20
      663500 -- (-1163.703) [-1162.609] (-1165.236) (-1164.616) * (-1166.063) (-1162.269) (-1162.503) [-1162.083] -- 0:00:20
      664000 -- [-1162.477] (-1162.453) (-1166.110) (-1162.279) * (-1161.860) (-1161.346) (-1164.407) [-1165.129] -- 0:00:20
      664500 -- (-1161.314) (-1163.837) [-1161.717] (-1165.506) * (-1162.122) (-1164.585) [-1162.403] (-1164.199) -- 0:00:20
      665000 -- (-1161.337) [-1162.324] (-1161.307) (-1168.896) * (-1162.247) [-1166.288] (-1162.402) (-1163.017) -- 0:00:20

      Average standard deviation of split frequencies: 0.009485

      665500 -- (-1163.242) (-1163.074) [-1163.157] (-1164.998) * (-1162.171) (-1163.224) (-1162.699) [-1164.309] -- 0:00:20
      666000 -- (-1165.623) [-1161.682] (-1163.595) (-1164.229) * [-1161.782] (-1162.841) (-1162.837) (-1164.209) -- 0:00:20
      666500 -- (-1164.727) (-1163.122) [-1162.919] (-1164.012) * (-1161.658) (-1163.544) (-1162.572) [-1162.995] -- 0:00:20
      667000 -- [-1164.748] (-1161.537) (-1162.898) (-1163.586) * [-1161.743] (-1163.085) (-1165.394) (-1161.431) -- 0:00:20
      667500 -- (-1165.259) [-1163.150] (-1163.120) (-1162.895) * (-1161.153) (-1165.542) (-1170.446) [-1162.138] -- 0:00:20
      668000 -- (-1161.770) [-1161.905] (-1161.970) (-1165.961) * (-1162.928) (-1165.356) (-1168.008) [-1164.647] -- 0:00:20
      668500 -- (-1162.087) (-1162.181) [-1161.968] (-1164.378) * (-1165.437) [-1162.724] (-1163.036) (-1163.711) -- 0:00:20
      669000 -- (-1163.346) [-1163.311] (-1162.339) (-1161.441) * (-1161.627) [-1162.331] (-1163.709) (-1162.015) -- 0:00:20
      669500 -- (-1163.573) (-1161.923) (-1162.037) [-1161.600] * (-1164.755) (-1163.649) [-1161.577] (-1162.511) -- 0:00:20
      670000 -- (-1162.737) [-1162.139] (-1162.163) (-1162.917) * (-1165.581) (-1161.705) [-1161.540] (-1166.041) -- 0:00:20

      Average standard deviation of split frequencies: 0.009559

      670500 -- (-1165.069) [-1164.166] (-1161.662) (-1162.024) * (-1162.732) [-1161.166] (-1165.338) (-1162.058) -- 0:00:20
      671000 -- (-1167.340) (-1163.228) [-1162.846] (-1162.209) * (-1160.921) (-1162.556) (-1161.428) [-1164.472] -- 0:00:20
      671500 -- (-1162.133) (-1164.973) (-1165.279) [-1162.093] * [-1162.885] (-1169.697) (-1161.477) (-1164.340) -- 0:00:20
      672000 -- (-1161.969) (-1163.460) [-1166.449] (-1162.168) * (-1163.632) (-1164.175) [-1163.213] (-1162.991) -- 0:00:20
      672500 -- (-1161.546) (-1162.271) [-1160.936] (-1165.309) * (-1162.770) (-1161.898) (-1161.947) [-1161.399] -- 0:00:19
      673000 -- (-1164.902) (-1161.211) (-1165.620) [-1161.378] * (-1164.322) (-1161.824) [-1162.213] (-1165.281) -- 0:00:19
      673500 -- (-1164.608) (-1163.827) (-1169.150) [-1162.628] * (-1163.439) (-1160.993) [-1161.573] (-1164.784) -- 0:00:19
      674000 -- (-1163.919) (-1163.265) (-1166.218) [-1162.418] * [-1161.559] (-1161.626) (-1162.350) (-1162.608) -- 0:00:19
      674500 -- (-1166.050) (-1161.886) (-1167.117) [-1161.785] * (-1163.280) (-1164.987) (-1164.164) [-1166.555] -- 0:00:19
      675000 -- [-1162.678] (-1166.876) (-1162.773) (-1165.480) * (-1165.853) (-1164.828) (-1163.152) [-1163.818] -- 0:00:19

      Average standard deviation of split frequencies: 0.008647

      675500 -- (-1163.879) (-1163.090) (-1162.684) [-1163.747] * (-1163.519) [-1167.890] (-1161.875) (-1166.375) -- 0:00:19
      676000 -- (-1163.243) (-1163.891) (-1165.164) [-1165.126] * (-1162.060) (-1163.958) (-1161.154) [-1167.413] -- 0:00:19
      676500 -- (-1161.043) (-1163.000) (-1161.036) [-1162.551] * (-1164.716) [-1163.360] (-1164.667) (-1163.381) -- 0:00:19
      677000 -- (-1163.793) [-1162.421] (-1161.221) (-1165.961) * (-1162.372) (-1162.674) (-1163.021) [-1163.197] -- 0:00:19
      677500 -- (-1166.530) [-1163.492] (-1167.333) (-1161.944) * (-1167.454) (-1163.168) (-1161.826) [-1164.191] -- 0:00:19
      678000 -- (-1161.067) (-1162.416) (-1161.242) [-1162.965] * (-1166.259) (-1164.327) [-1162.123] (-1162.615) -- 0:00:19
      678500 -- (-1161.370) [-1162.966] (-1169.541) (-1164.631) * [-1162.256] (-1162.874) (-1161.291) (-1163.764) -- 0:00:19
      679000 -- (-1161.930) (-1163.711) (-1163.422) [-1164.472] * (-1165.222) (-1161.701) (-1161.531) [-1162.049] -- 0:00:19
      679500 -- [-1163.665] (-1162.648) (-1161.367) (-1161.604) * (-1163.862) [-1161.404] (-1164.398) (-1162.581) -- 0:00:19
      680000 -- (-1162.083) (-1161.160) (-1161.888) [-1164.702] * [-1161.036] (-1167.918) (-1163.745) (-1164.331) -- 0:00:19

      Average standard deviation of split frequencies: 0.009003

      680500 -- [-1162.765] (-1162.174) (-1165.794) (-1162.886) * [-1163.463