--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:30:40 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/tesB/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/12res/tesB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/tesB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/12res/tesB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1316.16         -1328.95
2      -1316.39         -1328.56
--------------------------------------
TOTAL    -1316.27         -1328.77
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/12res/tesB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/tesB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/tesB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.701047    0.086359    0.218721    1.300675    0.661655   1428.18   1460.98    1.000
r(A<->C){all}   0.231841    0.019457    0.000122    0.488507    0.209669    197.77    220.12    1.024
r(A<->G){all}   0.224469    0.020303    0.000028    0.496733    0.202088    142.71    209.85    1.000
r(A<->T){all}   0.099492    0.008472    0.000183    0.294965    0.072488    301.65    309.17    1.001
r(C<->G){all}   0.138901    0.012692    0.000024    0.364934    0.109521    211.50    232.05    1.001
r(C<->T){all}   0.151620    0.016149    0.000189    0.408371    0.119336    271.40    300.72    1.005
r(G<->T){all}   0.153677    0.016320    0.000044    0.405816    0.122274    271.39    293.52    1.000
pi(A){all}      0.198879    0.000177    0.172541    0.223534    0.198860   1301.38   1316.31    1.000
pi(C){all}      0.265167    0.000216    0.237232    0.294178    0.265281   1225.88   1333.94    1.002
pi(G){all}      0.292764    0.000229    0.263386    0.321423    0.292807   1258.50   1316.10    1.002
pi(T){all}      0.243190    0.000199    0.217090    0.271691    0.243288   1263.52   1382.26    1.000
alpha{1,2}      0.132177    0.013120    0.046158    0.346418    0.090933   1198.17   1261.77    1.000
alpha{3}        0.245141    0.044708    0.047668    0.642768    0.182650   1085.95   1187.55    1.000
pinvar{all}     0.972660    0.000094    0.955206    0.989634    0.973695   1028.81   1191.96    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1255.982048
Model 2: PositiveSelection	-1247.431626
Model 0: one-ratio	-1257.489296
Model 7: beta	-1256.085775
Model 8: beta&w>1	-1247.431647


Model 0 vs 1	3.014495999999781

Model 2 vs 1	17.100844000000052

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908244_1_1346_MLBR_RS06325)

            Pr(w>1)     post mean +- SE for w

     2 K      1.000**       998.629
     4 L      0.998**       996.969
     5 W      0.997**       996.214

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908244_1_1346_MLBR_RS06325)

            Pr(w>1)     post mean +- SE for w

     1 V      0.543         4.334 +- 3.780
     2 K      0.872         6.645 +- 3.245
     4 L      0.774         6.014 +- 3.582
     5 W      0.770         5.988 +- 3.593


Model 8 vs 7	17.3082559999998

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908244_1_1346_MLBR_RS06325)

            Pr(w>1)     post mean +- SE for w

     2 K      1.000**       998.609
     4 L      0.998**       996.962
     5 W      0.997**       996.205

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908244_1_1346_MLBR_RS06325)

            Pr(w>1)     post mean +- SE for w

     1 V      0.662         5.070 +- 3.853
     2 K      0.940         7.096 +- 2.988
     4 L      0.866         6.606 +- 3.361
     5 W      0.863         6.584 +- 3.376

>C1
VKRLWEKKTMSDFEELLAVLDLNRVADDLFIGSHPSKNPLRTFGGQLVAQ
SFVASSRTLIRDDLPPSAFSVHFINGGDTAKEIEFHVVRLRDERRFANRR
VDAIQDGMLLSSAMASYMSGGCGLEHAVEPPEAAEPHTRPPIGELLRGYE
QIVQHFVNALQPVEWRYVNDPSWVMRNKGQRLAYNRVWVKALGALPNDPT
LHTAAMLYSTDTTVLDSVITTHGLSWGFDRIFAVSANHSVWFHRQVNFDD
WVLYSTSSPVAADSRGLGTGHLFDRSGQLIATVVQEGVLKYFPASHRooo
o
>C2
VKRLWEKKTMSDFEELLAVLDLNRVADDLFIGSHPSKNPLRTFGGQLVAQ
SFVASSRTLIRDDLPPSAFSVHFINGGDTAKEIEFHVVRLRDERRFANRR
VDAIQDGMLLSSAMASYMSGGCGLEHAVEPPEAAEPHTRPPIGELLRGYE
QIVQHFVNALQPVEWRYVNDPSWVMRNKGQRLAYNRVWVKALGALPNDPT
LHTAAMLYSTDTTVLDSVITTHGLSWGFDRIFAVSANHSVWFHRQVNFDD
WVLYSTSSPVAADSRGLGTGHLFDRSGQLIATVVQEGVLKYFPASHRooo
o
>C3
MSRMREKTLGKKTMSDFEELLAVLDLNRVADDLFIGSHPSKNPLRTFGGQ
LVAQSFVASSRTLIRDDLPPSAFSVHFINGGDTAKEIEFHVVRLRDERRF
ANRRVDAIQDGMLLSSAMASYMSGGCGLEHAVEPPEAAEPHTRPPIGELL
RGYEQIVQHFVNALQPVEWRYVNDPSWVMRNKGQRLAYNRVWVKALGALP
NDPTLHTAAMLYSTDTTVLDSVITTHGLSWGFDRIFAVSANHSVWFHRQV
NFDDWVLYSTSSPVAADSRGLGTGHLFDRSGQLIATVVQEGVLKYFPASH
R
>C4
MSRMREKTLGKKTMSDFEELLAVLDLNRVADDLFIGSHPSKNPLRTFGGQ
LVAQSFVASSRTLIRDDLPPSAFSVHFINGGDTAKEIEFHVVRLRDERRF
ANRRVDAIQDGMLLSSAMASYMSGGCGLEHAVEPPEAAEPHTRPPIGELL
RGYEQIVQHFVNALQPVEWRYVNDPSWVMRNKGQRLAYNRVWVKALGALP
NDPTLHTAAMLYSTDTTVLDSVITTHGLSWGFDRIFAVSANHSVWFHRQV
NFDDWVLYSTSSPVAADSRGLGTGHLFDRSGQLIATVVQEGVLKYFPASH
R
>C5
VKRLWEKKTMSDFEELLAVLDLNRVADDLFIGSHPSKNPLRTFGGQLVAQ
SFVASSRTLIRDDLPPSAFSVHFINGGDTAKEIEFHVVRLRDERRFANRR
VDAIQDGMLLSSAMASYMSGGCGLEHAVEPPEAAEPHTRPPIGELLRGYE
QIVQHFVNALQPVEWRYVNDPSWVMRNKGQRLAYNRVWVKALGALPNDPT
LHTAAMLYSTDTTVLDSVITTHGLSWGFDRIFAVSANHSVWFHRQVNFDD
WVLYSTSSPVAADSRGLGTGHLFDRSGQLIATVVQEGVLKYFPASHRooo
o
>C6
VKRLWEKKTMSDFEELLAVLDLNRVADDLFIGSHPSKNPLRTFGGQLVAQ
SFVASSRTLIRDDLPPSAFSVHFINGGDTAKEIEFHVVRLRDERRFANRR
VDAIQDGMLLSSAMASYMSGGCGLEHAVEPPEAAEPHTRPPIGELLRGYE
QIVQHFVNALQPVEWRYVNDPSWVMRNKGQRLAYNRVWVKALGALPNDPT
LHTAAMLYSTDTTVLDSVITTHGLSWGFDRIFAVSANHSVWFHRQVNFDD
WVLYSTSSPVAADSRGLGTGHLFDRSGQLIATVVQEGVLKYFPASHRooo
o
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=305 

C1              VKRLWEK----KTMSDFEELLAVLDLNRVADDLFIGSHPSKNPLRTFGGQ
C2              VKRLWEK----KTMSDFEELLAVLDLNRVADDLFIGSHPSKNPLRTFGGQ
C3              MSRMREKTLGKKTMSDFEELLAVLDLNRVADDLFIGSHPSKNPLRTFGGQ
C4              MSRMREKTLGKKTMSDFEELLAVLDLNRVADDLFIGSHPSKNPLRTFGGQ
C5              VKRLWEK----KTMSDFEELLAVLDLNRVADDLFIGSHPSKNPLRTFGGQ
C6              VKRLWEK----KTMSDFEELLAVLDLNRVADDLFIGSHPSKNPLRTFGGQ
                :.*: **    ***************************************

C1              LVAQSFVASSRTLIRDDLPPSAFSVHFINGGDTAKEIEFHVVRLRDERRF
C2              LVAQSFVASSRTLIRDDLPPSAFSVHFINGGDTAKEIEFHVVRLRDERRF
C3              LVAQSFVASSRTLIRDDLPPSAFSVHFINGGDTAKEIEFHVVRLRDERRF
C4              LVAQSFVASSRTLIRDDLPPSAFSVHFINGGDTAKEIEFHVVRLRDERRF
C5              LVAQSFVASSRTLIRDDLPPSAFSVHFINGGDTAKEIEFHVVRLRDERRF
C6              LVAQSFVASSRTLIRDDLPPSAFSVHFINGGDTAKEIEFHVVRLRDERRF
                **************************************************

C1              ANRRVDAIQDGMLLSSAMASYMSGGCGLEHAVEPPEAAEPHTRPPIGELL
C2              ANRRVDAIQDGMLLSSAMASYMSGGCGLEHAVEPPEAAEPHTRPPIGELL
C3              ANRRVDAIQDGMLLSSAMASYMSGGCGLEHAVEPPEAAEPHTRPPIGELL
C4              ANRRVDAIQDGMLLSSAMASYMSGGCGLEHAVEPPEAAEPHTRPPIGELL
C5              ANRRVDAIQDGMLLSSAMASYMSGGCGLEHAVEPPEAAEPHTRPPIGELL
C6              ANRRVDAIQDGMLLSSAMASYMSGGCGLEHAVEPPEAAEPHTRPPIGELL
                **************************************************

C1              RGYEQIVQHFVNALQPVEWRYVNDPSWVMRNKGQRLAYNRVWVKALGALP
C2              RGYEQIVQHFVNALQPVEWRYVNDPSWVMRNKGQRLAYNRVWVKALGALP
C3              RGYEQIVQHFVNALQPVEWRYVNDPSWVMRNKGQRLAYNRVWVKALGALP
C4              RGYEQIVQHFVNALQPVEWRYVNDPSWVMRNKGQRLAYNRVWVKALGALP
C5              RGYEQIVQHFVNALQPVEWRYVNDPSWVMRNKGQRLAYNRVWVKALGALP
C6              RGYEQIVQHFVNALQPVEWRYVNDPSWVMRNKGQRLAYNRVWVKALGALP
                **************************************************

C1              NDPTLHTAAMLYSTDTTVLDSVITTHGLSWGFDRIFAVSANHSVWFHRQV
C2              NDPTLHTAAMLYSTDTTVLDSVITTHGLSWGFDRIFAVSANHSVWFHRQV
C3              NDPTLHTAAMLYSTDTTVLDSVITTHGLSWGFDRIFAVSANHSVWFHRQV
C4              NDPTLHTAAMLYSTDTTVLDSVITTHGLSWGFDRIFAVSANHSVWFHRQV
C5              NDPTLHTAAMLYSTDTTVLDSVITTHGLSWGFDRIFAVSANHSVWFHRQV
C6              NDPTLHTAAMLYSTDTTVLDSVITTHGLSWGFDRIFAVSANHSVWFHRQV
                **************************************************

C1              NFDDWVLYSTSSPVAADSRGLGTGHLFDRSGQLIATVVQEGVLKYFPASH
C2              NFDDWVLYSTSSPVAADSRGLGTGHLFDRSGQLIATVVQEGVLKYFPASH
C3              NFDDWVLYSTSSPVAADSRGLGTGHLFDRSGQLIATVVQEGVLKYFPASH
C4              NFDDWVLYSTSSPVAADSRGLGTGHLFDRSGQLIATVVQEGVLKYFPASH
C5              NFDDWVLYSTSSPVAADSRGLGTGHLFDRSGQLIATVVQEGVLKYFPASH
C6              NFDDWVLYSTSSPVAADSRGLGTGHLFDRSGQLIATVVQEGVLKYFPASH
                **************************************************

C1              Roooo
C2              Roooo
C3              R----
C4              R----
C5              Roooo
C6              Roooo
                *    




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  301 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  301 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9222]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [9222]--->[9158]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.498 Mb, Max= 30.857 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VKRLWEKKTMSDFEELLAVLDLNRVADDLFIGSHPSKNPLRTFGGQLVAQ
C2              VKRLWEKKTMSDFEELLAVLDLNRVADDLFIGSHPSKNPLRTFGGQLVAQ
C3              MSRMREKKTMSDFEELLAVLDLNRVADDLFIGSHPSKNPLRTFGGQLVAQ
C4              MSRMREKKTMSDFEELLAVLDLNRVADDLFIGSHPSKNPLRTFGGQLVAQ
C5              VKRLWEKKTMSDFEELLAVLDLNRVADDLFIGSHPSKNPLRTFGGQLVAQ
C6              VKRLWEKKTMSDFEELLAVLDLNRVADDLFIGSHPSKNPLRTFGGQLVAQ
                :.*: *********************************************

C1              SFVASSRTLIRDDLPPSAFSVHFINGGDTAKEIEFHVVRLRDERRFANRR
C2              SFVASSRTLIRDDLPPSAFSVHFINGGDTAKEIEFHVVRLRDERRFANRR
C3              SFVASSRTLIRDDLPPSAFSVHFINGGDTAKEIEFHVVRLRDERRFANRR
C4              SFVASSRTLIRDDLPPSAFSVHFINGGDTAKEIEFHVVRLRDERRFANRR
C5              SFVASSRTLIRDDLPPSAFSVHFINGGDTAKEIEFHVVRLRDERRFANRR
C6              SFVASSRTLIRDDLPPSAFSVHFINGGDTAKEIEFHVVRLRDERRFANRR
                **************************************************

C1              VDAIQDGMLLSSAMASYMSGGCGLEHAVEPPEAAEPHTRPPIGELLRGYE
C2              VDAIQDGMLLSSAMASYMSGGCGLEHAVEPPEAAEPHTRPPIGELLRGYE
C3              VDAIQDGMLLSSAMASYMSGGCGLEHAVEPPEAAEPHTRPPIGELLRGYE
C4              VDAIQDGMLLSSAMASYMSGGCGLEHAVEPPEAAEPHTRPPIGELLRGYE
C5              VDAIQDGMLLSSAMASYMSGGCGLEHAVEPPEAAEPHTRPPIGELLRGYE
C6              VDAIQDGMLLSSAMASYMSGGCGLEHAVEPPEAAEPHTRPPIGELLRGYE
                **************************************************

C1              QIVQHFVNALQPVEWRYVNDPSWVMRNKGQRLAYNRVWVKALGALPNDPT
C2              QIVQHFVNALQPVEWRYVNDPSWVMRNKGQRLAYNRVWVKALGALPNDPT
C3              QIVQHFVNALQPVEWRYVNDPSWVMRNKGQRLAYNRVWVKALGALPNDPT
C4              QIVQHFVNALQPVEWRYVNDPSWVMRNKGQRLAYNRVWVKALGALPNDPT
C5              QIVQHFVNALQPVEWRYVNDPSWVMRNKGQRLAYNRVWVKALGALPNDPT
C6              QIVQHFVNALQPVEWRYVNDPSWVMRNKGQRLAYNRVWVKALGALPNDPT
                **************************************************

C1              LHTAAMLYSTDTTVLDSVITTHGLSWGFDRIFAVSANHSVWFHRQVNFDD
C2              LHTAAMLYSTDTTVLDSVITTHGLSWGFDRIFAVSANHSVWFHRQVNFDD
C3              LHTAAMLYSTDTTVLDSVITTHGLSWGFDRIFAVSANHSVWFHRQVNFDD
C4              LHTAAMLYSTDTTVLDSVITTHGLSWGFDRIFAVSANHSVWFHRQVNFDD
C5              LHTAAMLYSTDTTVLDSVITTHGLSWGFDRIFAVSANHSVWFHRQVNFDD
C6              LHTAAMLYSTDTTVLDSVITTHGLSWGFDRIFAVSANHSVWFHRQVNFDD
                **************************************************

C1              WVLYSTSSPVAADSRGLGTGHLFDRSGQLIATVVQEGVLKYFPASHR
C2              WVLYSTSSPVAADSRGLGTGHLFDRSGQLIATVVQEGVLKYFPASHR
C3              WVLYSTSSPVAADSRGLGTGHLFDRSGQLIATVVQEGVLKYFPASHR
C4              WVLYSTSSPVAADSRGLGTGHLFDRSGQLIATVVQEGVLKYFPASHR
C5              WVLYSTSSPVAADSRGLGTGHLFDRSGQLIATVVQEGVLKYFPASHR
C6              WVLYSTSSPVAADSRGLGTGHLFDRSGQLIATVVQEGVLKYFPASHR
                ***********************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:99 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 98.65 C1	 C3	 98.65
TOP	    2    0	 98.65 C3	 C1	 98.65
BOT	    0    3	 98.65 C1	 C4	 98.65
TOP	    3    0	 98.65 C4	 C1	 98.65
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 98.65 C2	 C3	 98.65
TOP	    2    1	 98.65 C3	 C2	 98.65
BOT	    1    3	 98.65 C2	 C4	 98.65
TOP	    3    1	 98.65 C4	 C2	 98.65
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 98.65 C3	 C5	 98.65
TOP	    4    2	 98.65 C5	 C3	 98.65
BOT	    2    5	 98.65 C3	 C6	 98.65
TOP	    5    2	 98.65 C6	 C3	 98.65
BOT	    3    4	 98.65 C4	 C5	 98.65
TOP	    4    3	 98.65 C5	 C4	 98.65
BOT	    3    5	 98.65 C4	 C6	 98.65
TOP	    5    3	 98.65 C6	 C4	 98.65
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 99.46
AVG	 1	 C2	  *	 99.46
AVG	 2	 C3	  *	 98.92
AVG	 3	 C4	  *	 98.92
AVG	 4	 C5	  *	 99.46
AVG	 5	 C6	  *	 99.46
TOT	 TOT	  *	 99.28
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGAAAAGACTCTGGGAAAAA------------AAGACTATGTCTGACTT
C2              GTGAAAAGACTCTGGGAAAAA------------AAGACTATGTCTGACTT
C3              ATGAGCCGAATGCGTGAAAAGACTCTGGGAAAAAAGACTATGTCTGACTT
C4              ATGAGCCGAATGCGTGAAAAGACTCTGGGAAAAAAGACTATGTCTGACTT
C5              GTGAAAAGACTCTGGGAAAAA------------AAGACTATGTCTGACTT
C6              GTGAAAAGACTCTGGGAAAAA------------AAGACTATGTCTGACTT
                .***...**.*  * *****.            *****************

C1              CGAGGAACTGCTTGCGGTATTAGATCTCAACCGCGTCGCCGATGACCTAT
C2              CGAGGAACTGCTTGCGGTATTAGATCTCAACCGCGTCGCCGATGACCTAT
C3              CGAGGAACTGCTTGCGGTATTAGATCTCAACCGCGTCGCCGATGACCTAT
C4              CGAGGAACTGCTTGCGGTATTAGATCTCAACCGCGTCGCCGATGACCTAT
C5              CGAGGAACTGCTTGCGGTATTAGATCTCAACCGCGTCGCCGATGACCTAT
C6              CGAGGAACTGCTTGCGGTATTAGATCTCAACCGCGTCGCCGATGACCTAT
                **************************************************

C1              TCATCGGATCCCATCCCAGCAAGAACCCGCTGCGGACATTCGGCGGGCAG
C2              TCATCGGATCCCATCCCAGCAAGAACCCGCTGCGGACATTCGGCGGGCAG
C3              TCATCGGATCCCATCCCAGCAAGAACCCGCTGCGGACATTCGGCGGGCAG
C4              TCATCGGATCCCATCCCAGCAAGAACCCGCTGCGGACATTCGGCGGGCAG
C5              TCATCGGATCCCATCCCAGCAAGAACCCGCTGCGGACATTCGGCGGGCAG
C6              TCATCGGATCCCATCCCAGCAAGAACCCGCTGCGGACATTCGGCGGGCAG
                **************************************************

C1              CTCGTGGCGCAGTCCTTTGTGGCTAGTAGCCGCACGCTGATCCGAGACGA
C2              CTCGTGGCGCAGTCCTTTGTGGCTAGTAGCCGCACGCTGATCCGAGACGA
C3              CTCGTGGCGCAGTCCTTTGTGGCTAGTAGCCGCACGCTGATCCGAGACGA
C4              CTCGTGGCGCAGTCCTTTGTGGCTAGTAGCCGCACGCTGATCCGAGACGA
C5              CTCGTGGCGCAGTCCTTTGTGGCTAGTAGCCGCACGCTGATCCGAGACGA
C6              CTCGTGGCGCAGTCCTTTGTGGCTAGTAGCCGCACGCTGATCCGAGACGA
                **************************************************

C1              CCTGCCGCCCAGCGCATTTTCAGTGCACTTTATCAATGGTGGTGATACAG
C2              CCTGCCGCCCAGCGCATTTTCAGTGCACTTTATCAATGGTGGTGATACAG
C3              CCTGCCGCCCAGCGCATTTTCAGTGCACTTTATCAATGGTGGTGATACAG
C4              CCTGCCGCCCAGCGCATTTTCAGTGCACTTTATCAATGGTGGTGATACAG
C5              CCTGCCGCCCAGCGCATTTTCAGTGCACTTTATCAATGGTGGTGATACAG
C6              CCTGCCGCCCAGCGCATTTTCAGTGCACTTTATCAATGGTGGTGATACAG
                **************************************************

C1              CCAAGGAAATCGAGTTTCACGTTGTACGGCTGCGTGACGAGCGGCGCTTC
C2              CCAAGGAAATCGAGTTTCACGTTGTACGGCTGCGTGACGAGCGGCGCTTC
C3              CCAAGGAAATCGAGTTTCACGTTGTACGGCTGCGTGACGAGCGGCGCTTC
C4              CCAAGGAAATCGAGTTTCACGTTGTACGGCTGCGTGACGAGCGGCGCTTC
C5              CCAAGGAAATCGAGTTTCACGTTGTACGGCTGCGTGACGAGCGGCGCTTC
C6              CCAAGGAAATCGAGTTTCACGTTGTACGGCTGCGTGACGAGCGGCGCTTC
                **************************************************

C1              GCCAACCGTCGTGTCGATGCGATTCAGGACGGCATGTTGTTGTCCTCAGC
C2              GCCAACCGTCGTGTCGATGCGATTCAGGACGGCATGTTGTTGTCCTCAGC
C3              GCCAACCGTCGTGTCGATGCGATTCAGGACGGCATGTTGTTGTCCTCAGC
C4              GCCAACCGTCGTGTCGATGCGATTCAGGACGGCATGTTGTTGTCCTCAGC
C5              GCCAACCGTCGTGTCGATGCGATTCAGGACGGCATGTTGTTGTCCTCAGC
C6              GCCAACCGTCGTGTCGATGCGATTCAGGACGGCATGTTGTTGTCCTCAGC
                **************************************************

C1              GATGGCTTCCTACATGTCTGGCGGGTGTGGGCTTGAGCATGCTGTCGAGC
C2              GATGGCTTCCTACATGTCTGGCGGGTGTGGGCTTGAGCATGCTGTCGAGC
C3              GATGGCTTCCTACATGTCTGGCGGGTGTGGGCTTGAGCATGCTGTCGAGC
C4              GATGGCTTCCTACATGTCTGGCGGGTGTGGGCTTGAGCATGCTGTCGAGC
C5              GATGGCTTCCTACATGTCTGGCGGGTGTGGGCTTGAGCATGCTGTCGAGC
C6              GATGGCTTCCTACATGTCTGGCGGGTGTGGGCTTGAGCATGCTGTCGAGC
                **************************************************

C1              CGCCGGAGGCGGCCGAACCTCATACCCGGCCGCCGATAGGCGAGCTGTTA
C2              CGCCGGAGGCGGCCGAACCTCATACCCGGCCGCCGATAGGCGAGCTGTTA
C3              CGCCGGAGGCGGCCGAACCTCATACCCGGCCGCCGATAGGCGAGCTGTTA
C4              CGCCGGAGGCGGCCGAACCTCATACCCGGCCGCCGATAGGCGAGCTGTTA
C5              CGCCGGAGGCGGCCGAACCTCATACCCGGCCGCCGATAGGCGAGCTGTTA
C6              CGCCGGAGGCGGCCGAACCTCATACCCGGCCGCCGATAGGCGAGCTGTTA
                **************************************************

C1              CGCGGCTACGAGCAGATTGTGCAGCATTTCGTCAATGCGTTGCAACCGGT
C2              CGCGGCTACGAGCAGATTGTGCAGCATTTCGTCAATGCGTTGCAACCGGT
C3              CGCGGCTACGAGCAGATTGTGCAGCATTTCGTCAATGCGTTGCAACCGGT
C4              CGCGGCTACGAGCAGATTGTGCAGCATTTCGTCAATGCGTTGCAACCGGT
C5              CGCGGCTACGAGCAGATTGTGCAGCATTTCGTCAATGCGTTGCAACCGGT
C6              CGCGGCTACGAGCAGATTGTGCAGCATTTCGTCAATGCGTTGCAACCGGT
                **************************************************

C1              CGAGTGGCGCTACGTCAATGACCCGTCTTGGGTTATGCGTAACAAAGGCC
C2              CGAGTGGCGCTACGTCAATGACCCGTCTTGGGTTATGCGTAACAAAGGCC
C3              CGAGTGGCGCTACGTCAATGACCCGTCTTGGGTTATGCGTAACAAAGGCC
C4              CGAGTGGCGCTACGTCAATGACCCGTCTTGGGTTATGCGTAACAAAGGCC
C5              CGAGTGGCGCTACGTCAATGACCCGTCTTGGGTTATGCGTAACAAAGGCC
C6              CGAGTGGCGCTACGTCAATGACCCGTCTTGGGTTATGCGTAACAAAGGCC
                **************************************************

C1              AACGGCTTGCCTACAATCGGGTCTGGGTAAAGGCGTTGGGGGCACTGCCC
C2              AACGGCTTGCCTACAATCGGGTCTGGGTAAAGGCGTTGGGGGCACTGCCC
C3              AACGGCTTGCCTACAATCGGGTCTGGGTAAAGGCGTTGGGGGCACTGCCC
C4              AACGGCTTGCCTACAATCGGGTCTGGGTAAAGGCGTTGGGGGCACTGCCC
C5              AACGGCTTGCCTACAATCGGGTCTGGGTAAAGGCGTTGGGGGCACTGCCC
C6              AACGGCTTGCCTACAATCGGGTCTGGGTAAAGGCGTTGGGGGCACTGCCC
                **************************************************

C1              AACGATCCTACCTTGCACACCGCGGCGATGCTGTATTCTACTGACACCAC
C2              AACGATCCTACCTTGCACACCGCGGCGATGCTGTATTCTACTGACACCAC
C3              AACGATCCTACCTTGCACACCGCGGCGATGCTGTATTCTACTGACACCAC
C4              AACGATCCTACCTTGCACACCGCGGCGATGCTGTATTCTACTGACACCAC
C5              AACGATCCTACCTTGCACACCGCGGCGATGCTGTATTCTACTGACACCAC
C6              AACGATCCTACCTTGCACACCGCGGCGATGCTGTATTCTACTGACACCAC
                **************************************************

C1              CGTGTTGGATTCAGTTATAACTACTCATGGGCTGTCGTGGGGCTTCGACC
C2              CGTGTTGGATTCAGTTATAACTACTCATGGGCTGTCGTGGGGCTTCGACC
C3              CGTGTTGGATTCAGTTATAACTACTCATGGGCTGTCGTGGGGCTTCGACC
C4              CGTGTTGGATTCAGTTATAACTACTCATGGGCTGTCGTGGGGCTTCGACC
C5              CGTGTTGGATTCAGTTATAACTACTCATGGGCTGTCGTGGGGCTTCGACC
C6              CGTGTTGGATTCAGTTATAACTACTCATGGGCTGTCGTGGGGCTTCGACC
                **************************************************

C1              GTATTTTTGCTGTTTCCGCTAACCATTCGGTGTGGTTTCACCGACAGGTG
C2              GTATTTTTGCTGTTTCCGCTAACCATTCGGTGTGGTTTCACCGACAGGTG
C3              GTATTTTTGCTGTTTCCGCTAACCATTCGGTGTGGTTTCACCGACAGGTG
C4              GTATTTTTGCTGTTTCCGCTAACCATTCGGTGTGGTTTCACCGACAGGTG
C5              GTATTTTTGCTGTTTCCGCTAACCATTCGGTGTGGTTTCACCGACAGGTG
C6              GTATTTTTGCTGTTTCCGCTAACCATTCGGTGTGGTTTCACCGACAGGTG
                **************************************************

C1              AACTTCGATGACTGGGTGTTGTATTCGACGTCGTCTCCGGTAGCTGCAGA
C2              AACTTCGATGACTGGGTGTTGTATTCGACGTCGTCTCCGGTAGCTGCAGA
C3              AACTTCGATGACTGGGTGTTGTATTCGACGTCGTCTCCGGTAGCTGCAGA
C4              AACTTCGATGACTGGGTGTTGTATTCGACGTCGTCTCCGGTAGCTGCAGA
C5              AACTTCGATGACTGGGTGTTGTATTCGACGTCGTCTCCGGTAGCTGCAGA
C6              AACTTCGATGACTGGGTGTTGTATTCGACGTCGTCTCCGGTAGCTGCAGA
                **************************************************

C1              TTCGCGCGGACTGGGTACTGGGCATTTGTTTGATCGCTCGGGGCAACTAA
C2              TTCGCGCGGACTGGGTACTGGGCATTTGTTTGATCGCTCGGGGCAACTAA
C3              TTCGCGCGGACTGGGTACTGGGCATTTGTTTGATCGCTCGGGGCAACTAA
C4              TTCGCGCGGACTGGGTACTGGGCATTTGTTTGATCGCTCGGGGCAACTAA
C5              TTCGCGCGGACTGGGTACTGGGCATTTGTTTGATCGCTCGGGGCAACTAA
C6              TTCGCGCGGACTGGGTACTGGGCATTTGTTTGATCGCTCGGGGCAACTAA
                **************************************************

C1              TTGCCACGGTGGTCCAAGAAGGGGTATTGAAATACTTTCCTGCCTCCCAT
C2              TTGCCACGGTGGTCCAAGAAGGGGTATTGAAATACTTTCCTGCCTCCCAT
C3              TTGCCACGGTGGTCCAAGAAGGGGTATTGAAATACTTTCCTGCCTCCCAT
C4              TTGCCACGGTGGTCCAAGAAGGGGTATTGAAATACTTTCCTGCCTCCCAT
C5              TTGCCACGGTGGTCCAAGAAGGGGTATTGAAATACTTTCCTGCCTCCCAT
C6              TTGCCACGGTGGTCCAAGAAGGGGTATTGAAATACTTTCCTGCCTCCCAT
                **************************************************

C1              CGA------------
C2              CGA------------
C3              CGA------------
C4              CGA------------
C5              CGA------------
C6              CGA------------
                ***            



>C1
GTGAAAAGACTCTGGGAAAAA------------AAGACTATGTCTGACTT
CGAGGAACTGCTTGCGGTATTAGATCTCAACCGCGTCGCCGATGACCTAT
TCATCGGATCCCATCCCAGCAAGAACCCGCTGCGGACATTCGGCGGGCAG
CTCGTGGCGCAGTCCTTTGTGGCTAGTAGCCGCACGCTGATCCGAGACGA
CCTGCCGCCCAGCGCATTTTCAGTGCACTTTATCAATGGTGGTGATACAG
CCAAGGAAATCGAGTTTCACGTTGTACGGCTGCGTGACGAGCGGCGCTTC
GCCAACCGTCGTGTCGATGCGATTCAGGACGGCATGTTGTTGTCCTCAGC
GATGGCTTCCTACATGTCTGGCGGGTGTGGGCTTGAGCATGCTGTCGAGC
CGCCGGAGGCGGCCGAACCTCATACCCGGCCGCCGATAGGCGAGCTGTTA
CGCGGCTACGAGCAGATTGTGCAGCATTTCGTCAATGCGTTGCAACCGGT
CGAGTGGCGCTACGTCAATGACCCGTCTTGGGTTATGCGTAACAAAGGCC
AACGGCTTGCCTACAATCGGGTCTGGGTAAAGGCGTTGGGGGCACTGCCC
AACGATCCTACCTTGCACACCGCGGCGATGCTGTATTCTACTGACACCAC
CGTGTTGGATTCAGTTATAACTACTCATGGGCTGTCGTGGGGCTTCGACC
GTATTTTTGCTGTTTCCGCTAACCATTCGGTGTGGTTTCACCGACAGGTG
AACTTCGATGACTGGGTGTTGTATTCGACGTCGTCTCCGGTAGCTGCAGA
TTCGCGCGGACTGGGTACTGGGCATTTGTTTGATCGCTCGGGGCAACTAA
TTGCCACGGTGGTCCAAGAAGGGGTATTGAAATACTTTCCTGCCTCCCAT
CGA------------
>C2
GTGAAAAGACTCTGGGAAAAA------------AAGACTATGTCTGACTT
CGAGGAACTGCTTGCGGTATTAGATCTCAACCGCGTCGCCGATGACCTAT
TCATCGGATCCCATCCCAGCAAGAACCCGCTGCGGACATTCGGCGGGCAG
CTCGTGGCGCAGTCCTTTGTGGCTAGTAGCCGCACGCTGATCCGAGACGA
CCTGCCGCCCAGCGCATTTTCAGTGCACTTTATCAATGGTGGTGATACAG
CCAAGGAAATCGAGTTTCACGTTGTACGGCTGCGTGACGAGCGGCGCTTC
GCCAACCGTCGTGTCGATGCGATTCAGGACGGCATGTTGTTGTCCTCAGC
GATGGCTTCCTACATGTCTGGCGGGTGTGGGCTTGAGCATGCTGTCGAGC
CGCCGGAGGCGGCCGAACCTCATACCCGGCCGCCGATAGGCGAGCTGTTA
CGCGGCTACGAGCAGATTGTGCAGCATTTCGTCAATGCGTTGCAACCGGT
CGAGTGGCGCTACGTCAATGACCCGTCTTGGGTTATGCGTAACAAAGGCC
AACGGCTTGCCTACAATCGGGTCTGGGTAAAGGCGTTGGGGGCACTGCCC
AACGATCCTACCTTGCACACCGCGGCGATGCTGTATTCTACTGACACCAC
CGTGTTGGATTCAGTTATAACTACTCATGGGCTGTCGTGGGGCTTCGACC
GTATTTTTGCTGTTTCCGCTAACCATTCGGTGTGGTTTCACCGACAGGTG
AACTTCGATGACTGGGTGTTGTATTCGACGTCGTCTCCGGTAGCTGCAGA
TTCGCGCGGACTGGGTACTGGGCATTTGTTTGATCGCTCGGGGCAACTAA
TTGCCACGGTGGTCCAAGAAGGGGTATTGAAATACTTTCCTGCCTCCCAT
CGA------------
>C3
ATGAGCCGAATGCGTGAAAAGACTCTGGGAAAAAAGACTATGTCTGACTT
CGAGGAACTGCTTGCGGTATTAGATCTCAACCGCGTCGCCGATGACCTAT
TCATCGGATCCCATCCCAGCAAGAACCCGCTGCGGACATTCGGCGGGCAG
CTCGTGGCGCAGTCCTTTGTGGCTAGTAGCCGCACGCTGATCCGAGACGA
CCTGCCGCCCAGCGCATTTTCAGTGCACTTTATCAATGGTGGTGATACAG
CCAAGGAAATCGAGTTTCACGTTGTACGGCTGCGTGACGAGCGGCGCTTC
GCCAACCGTCGTGTCGATGCGATTCAGGACGGCATGTTGTTGTCCTCAGC
GATGGCTTCCTACATGTCTGGCGGGTGTGGGCTTGAGCATGCTGTCGAGC
CGCCGGAGGCGGCCGAACCTCATACCCGGCCGCCGATAGGCGAGCTGTTA
CGCGGCTACGAGCAGATTGTGCAGCATTTCGTCAATGCGTTGCAACCGGT
CGAGTGGCGCTACGTCAATGACCCGTCTTGGGTTATGCGTAACAAAGGCC
AACGGCTTGCCTACAATCGGGTCTGGGTAAAGGCGTTGGGGGCACTGCCC
AACGATCCTACCTTGCACACCGCGGCGATGCTGTATTCTACTGACACCAC
CGTGTTGGATTCAGTTATAACTACTCATGGGCTGTCGTGGGGCTTCGACC
GTATTTTTGCTGTTTCCGCTAACCATTCGGTGTGGTTTCACCGACAGGTG
AACTTCGATGACTGGGTGTTGTATTCGACGTCGTCTCCGGTAGCTGCAGA
TTCGCGCGGACTGGGTACTGGGCATTTGTTTGATCGCTCGGGGCAACTAA
TTGCCACGGTGGTCCAAGAAGGGGTATTGAAATACTTTCCTGCCTCCCAT
CGA------------
>C4
ATGAGCCGAATGCGTGAAAAGACTCTGGGAAAAAAGACTATGTCTGACTT
CGAGGAACTGCTTGCGGTATTAGATCTCAACCGCGTCGCCGATGACCTAT
TCATCGGATCCCATCCCAGCAAGAACCCGCTGCGGACATTCGGCGGGCAG
CTCGTGGCGCAGTCCTTTGTGGCTAGTAGCCGCACGCTGATCCGAGACGA
CCTGCCGCCCAGCGCATTTTCAGTGCACTTTATCAATGGTGGTGATACAG
CCAAGGAAATCGAGTTTCACGTTGTACGGCTGCGTGACGAGCGGCGCTTC
GCCAACCGTCGTGTCGATGCGATTCAGGACGGCATGTTGTTGTCCTCAGC
GATGGCTTCCTACATGTCTGGCGGGTGTGGGCTTGAGCATGCTGTCGAGC
CGCCGGAGGCGGCCGAACCTCATACCCGGCCGCCGATAGGCGAGCTGTTA
CGCGGCTACGAGCAGATTGTGCAGCATTTCGTCAATGCGTTGCAACCGGT
CGAGTGGCGCTACGTCAATGACCCGTCTTGGGTTATGCGTAACAAAGGCC
AACGGCTTGCCTACAATCGGGTCTGGGTAAAGGCGTTGGGGGCACTGCCC
AACGATCCTACCTTGCACACCGCGGCGATGCTGTATTCTACTGACACCAC
CGTGTTGGATTCAGTTATAACTACTCATGGGCTGTCGTGGGGCTTCGACC
GTATTTTTGCTGTTTCCGCTAACCATTCGGTGTGGTTTCACCGACAGGTG
AACTTCGATGACTGGGTGTTGTATTCGACGTCGTCTCCGGTAGCTGCAGA
TTCGCGCGGACTGGGTACTGGGCATTTGTTTGATCGCTCGGGGCAACTAA
TTGCCACGGTGGTCCAAGAAGGGGTATTGAAATACTTTCCTGCCTCCCAT
CGA------------
>C5
GTGAAAAGACTCTGGGAAAAA------------AAGACTATGTCTGACTT
CGAGGAACTGCTTGCGGTATTAGATCTCAACCGCGTCGCCGATGACCTAT
TCATCGGATCCCATCCCAGCAAGAACCCGCTGCGGACATTCGGCGGGCAG
CTCGTGGCGCAGTCCTTTGTGGCTAGTAGCCGCACGCTGATCCGAGACGA
CCTGCCGCCCAGCGCATTTTCAGTGCACTTTATCAATGGTGGTGATACAG
CCAAGGAAATCGAGTTTCACGTTGTACGGCTGCGTGACGAGCGGCGCTTC
GCCAACCGTCGTGTCGATGCGATTCAGGACGGCATGTTGTTGTCCTCAGC
GATGGCTTCCTACATGTCTGGCGGGTGTGGGCTTGAGCATGCTGTCGAGC
CGCCGGAGGCGGCCGAACCTCATACCCGGCCGCCGATAGGCGAGCTGTTA
CGCGGCTACGAGCAGATTGTGCAGCATTTCGTCAATGCGTTGCAACCGGT
CGAGTGGCGCTACGTCAATGACCCGTCTTGGGTTATGCGTAACAAAGGCC
AACGGCTTGCCTACAATCGGGTCTGGGTAAAGGCGTTGGGGGCACTGCCC
AACGATCCTACCTTGCACACCGCGGCGATGCTGTATTCTACTGACACCAC
CGTGTTGGATTCAGTTATAACTACTCATGGGCTGTCGTGGGGCTTCGACC
GTATTTTTGCTGTTTCCGCTAACCATTCGGTGTGGTTTCACCGACAGGTG
AACTTCGATGACTGGGTGTTGTATTCGACGTCGTCTCCGGTAGCTGCAGA
TTCGCGCGGACTGGGTACTGGGCATTTGTTTGATCGCTCGGGGCAACTAA
TTGCCACGGTGGTCCAAGAAGGGGTATTGAAATACTTTCCTGCCTCCCAT
CGA------------
>C6
GTGAAAAGACTCTGGGAAAAA------------AAGACTATGTCTGACTT
CGAGGAACTGCTTGCGGTATTAGATCTCAACCGCGTCGCCGATGACCTAT
TCATCGGATCCCATCCCAGCAAGAACCCGCTGCGGACATTCGGCGGGCAG
CTCGTGGCGCAGTCCTTTGTGGCTAGTAGCCGCACGCTGATCCGAGACGA
CCTGCCGCCCAGCGCATTTTCAGTGCACTTTATCAATGGTGGTGATACAG
CCAAGGAAATCGAGTTTCACGTTGTACGGCTGCGTGACGAGCGGCGCTTC
GCCAACCGTCGTGTCGATGCGATTCAGGACGGCATGTTGTTGTCCTCAGC
GATGGCTTCCTACATGTCTGGCGGGTGTGGGCTTGAGCATGCTGTCGAGC
CGCCGGAGGCGGCCGAACCTCATACCCGGCCGCCGATAGGCGAGCTGTTA
CGCGGCTACGAGCAGATTGTGCAGCATTTCGTCAATGCGTTGCAACCGGT
CGAGTGGCGCTACGTCAATGACCCGTCTTGGGTTATGCGTAACAAAGGCC
AACGGCTTGCCTACAATCGGGTCTGGGTAAAGGCGTTGGGGGCACTGCCC
AACGATCCTACCTTGCACACCGCGGCGATGCTGTATTCTACTGACACCAC
CGTGTTGGATTCAGTTATAACTACTCATGGGCTGTCGTGGGGCTTCGACC
GTATTTTTGCTGTTTCCGCTAACCATTCGGTGTGGTTTCACCGACAGGTG
AACTTCGATGACTGGGTGTTGTATTCGACGTCGTCTCCGGTAGCTGCAGA
TTCGCGCGGACTGGGTACTGGGCATTTGTTTGATCGCTCGGGGCAACTAA
TTGCCACGGTGGTCCAAGAAGGGGTATTGAAATACTTTCCTGCCTCCCAT
CGA------------
>C1
VKRLWEKooooKTMSDFEELLAVLDLNRVADDLFIGSHPSKNPLRTFGGQ
LVAQSFVASSRTLIRDDLPPSAFSVHFINGGDTAKEIEFHVVRLRDERRF
ANRRVDAIQDGMLLSSAMASYMSGGCGLEHAVEPPEAAEPHTRPPIGELL
RGYEQIVQHFVNALQPVEWRYVNDPSWVMRNKGQRLAYNRVWVKALGALP
NDPTLHTAAMLYSTDTTVLDSVITTHGLSWGFDRIFAVSANHSVWFHRQV
NFDDWVLYSTSSPVAADSRGLGTGHLFDRSGQLIATVVQEGVLKYFPASH
R
>C2
VKRLWEKooooKTMSDFEELLAVLDLNRVADDLFIGSHPSKNPLRTFGGQ
LVAQSFVASSRTLIRDDLPPSAFSVHFINGGDTAKEIEFHVVRLRDERRF
ANRRVDAIQDGMLLSSAMASYMSGGCGLEHAVEPPEAAEPHTRPPIGELL
RGYEQIVQHFVNALQPVEWRYVNDPSWVMRNKGQRLAYNRVWVKALGALP
NDPTLHTAAMLYSTDTTVLDSVITTHGLSWGFDRIFAVSANHSVWFHRQV
NFDDWVLYSTSSPVAADSRGLGTGHLFDRSGQLIATVVQEGVLKYFPASH
R
>C3
MSRMREKTLGKKTMSDFEELLAVLDLNRVADDLFIGSHPSKNPLRTFGGQ
LVAQSFVASSRTLIRDDLPPSAFSVHFINGGDTAKEIEFHVVRLRDERRF
ANRRVDAIQDGMLLSSAMASYMSGGCGLEHAVEPPEAAEPHTRPPIGELL
RGYEQIVQHFVNALQPVEWRYVNDPSWVMRNKGQRLAYNRVWVKALGALP
NDPTLHTAAMLYSTDTTVLDSVITTHGLSWGFDRIFAVSANHSVWFHRQV
NFDDWVLYSTSSPVAADSRGLGTGHLFDRSGQLIATVVQEGVLKYFPASH
R
>C4
MSRMREKTLGKKTMSDFEELLAVLDLNRVADDLFIGSHPSKNPLRTFGGQ
LVAQSFVASSRTLIRDDLPPSAFSVHFINGGDTAKEIEFHVVRLRDERRF
ANRRVDAIQDGMLLSSAMASYMSGGCGLEHAVEPPEAAEPHTRPPIGELL
RGYEQIVQHFVNALQPVEWRYVNDPSWVMRNKGQRLAYNRVWVKALGALP
NDPTLHTAAMLYSTDTTVLDSVITTHGLSWGFDRIFAVSANHSVWFHRQV
NFDDWVLYSTSSPVAADSRGLGTGHLFDRSGQLIATVVQEGVLKYFPASH
R
>C5
VKRLWEKooooKTMSDFEELLAVLDLNRVADDLFIGSHPSKNPLRTFGGQ
LVAQSFVASSRTLIRDDLPPSAFSVHFINGGDTAKEIEFHVVRLRDERRF
ANRRVDAIQDGMLLSSAMASYMSGGCGLEHAVEPPEAAEPHTRPPIGELL
RGYEQIVQHFVNALQPVEWRYVNDPSWVMRNKGQRLAYNRVWVKALGALP
NDPTLHTAAMLYSTDTTVLDSVITTHGLSWGFDRIFAVSANHSVWFHRQV
NFDDWVLYSTSSPVAADSRGLGTGHLFDRSGQLIATVVQEGVLKYFPASH
R
>C6
VKRLWEKooooKTMSDFEELLAVLDLNRVADDLFIGSHPSKNPLRTFGGQ
LVAQSFVASSRTLIRDDLPPSAFSVHFINGGDTAKEIEFHVVRLRDERRF
ANRRVDAIQDGMLLSSAMASYMSGGCGLEHAVEPPEAAEPHTRPPIGELL
RGYEQIVQHFVNALQPVEWRYVNDPSWVMRNKGQRLAYNRVWVKALGALP
NDPTLHTAAMLYSTDTTVLDSVITTHGLSWGFDRIFAVSANHSVWFHRQV
NFDDWVLYSTSSPVAADSRGLGTGHLFDRSGQLIATVVQEGVLKYFPASH
R


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/12res/tesB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 915 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579789692
      Setting output file names to "/data/12res/tesB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 926909643
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0826857971
      Seed = 609936316
      Swapseed = 1579789692
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 12 unique site patterns
      Division 2 has 10 unique site patterns
      Division 3 has 12 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2076.413612 -- -24.965149
         Chain 2 -- -2076.413499 -- -24.965149
         Chain 3 -- -2075.132846 -- -24.965149
         Chain 4 -- -2076.413499 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2076.413612 -- -24.965149
         Chain 2 -- -2043.333317 -- -24.965149
         Chain 3 -- -2075.146952 -- -24.965149
         Chain 4 -- -2076.413499 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2076.414] (-2076.413) (-2075.133) (-2076.413) * [-2076.414] (-2043.333) (-2075.147) (-2076.413) 
        500 -- [-1312.365] (-1310.737) (-1316.137) (-1325.622) * [-1311.094] (-1317.061) (-1313.956) (-1312.393) -- 0:00:00
       1000 -- (-1316.519) (-1317.868) [-1310.518] (-1322.086) * [-1314.938] (-1314.495) (-1317.333) (-1311.179) -- 0:00:00
       1500 -- (-1311.909) (-1314.082) [-1317.795] (-1319.537) * [-1313.735] (-1318.899) (-1314.396) (-1312.672) -- 0:00:00
       2000 -- (-1314.378) [-1311.619] (-1314.414) (-1311.524) * (-1312.137) [-1316.364] (-1318.031) (-1309.955) -- 0:00:00
       2500 -- (-1311.227) [-1318.891] (-1313.198) (-1310.882) * [-1314.883] (-1309.518) (-1320.815) (-1310.313) -- 0:00:00
       3000 -- (-1316.828) [-1312.323] (-1312.974) (-1316.577) * (-1320.401) (-1313.041) [-1309.163] (-1315.153) -- 0:00:00
       3500 -- (-1317.912) [-1312.747] (-1311.000) (-1313.027) * (-1313.769) (-1313.879) (-1317.756) [-1312.901] -- 0:00:00
       4000 -- (-1321.592) (-1311.504) (-1315.069) [-1312.735] * (-1313.653) (-1315.053) (-1324.320) [-1314.078] -- 0:00:00
       4500 -- (-1317.655) (-1318.557) (-1311.799) [-1311.744] * (-1321.072) (-1318.028) (-1319.241) [-1311.222] -- 0:00:00
       5000 -- (-1312.649) [-1312.821] (-1323.150) (-1314.064) * (-1316.659) [-1311.554] (-1316.657) (-1314.441) -- 0:03:19

      Average standard deviation of split frequencies: 0.057140

       5500 -- (-1311.776) (-1315.488) (-1317.764) [-1311.807] * [-1311.141] (-1320.973) (-1314.129) (-1319.218) -- 0:03:00
       6000 -- (-1312.033) (-1321.063) (-1308.858) [-1317.974] * (-1313.952) (-1317.682) (-1315.572) [-1312.456] -- 0:02:45
       6500 -- (-1314.956) (-1320.803) (-1312.187) [-1309.503] * [-1314.576] (-1329.883) (-1313.560) (-1311.403) -- 0:02:32
       7000 -- (-1330.960) [-1311.319] (-1316.949) (-1314.043) * [-1310.811] (-1334.881) (-1314.451) (-1321.732) -- 0:02:21
       7500 -- (-1324.135) [-1315.572] (-1316.020) (-1316.039) * [-1312.308] (-1322.531) (-1315.144) (-1315.414) -- 0:02:12
       8000 -- (-1321.030) [-1309.464] (-1314.260) (-1310.336) * (-1314.647) (-1322.969) [-1315.245] (-1309.701) -- 0:02:04
       8500 -- (-1328.338) [-1317.488] (-1320.999) (-1310.737) * (-1308.027) (-1320.783) (-1313.772) [-1316.165] -- 0:01:56
       9000 -- (-1323.368) [-1317.248] (-1317.537) (-1312.252) * (-1310.034) (-1326.728) [-1307.579] (-1309.873) -- 0:01:50
       9500 -- (-1316.883) [-1311.408] (-1312.134) (-1319.817) * (-1325.260) (-1323.125) [-1310.944] (-1312.680) -- 0:01:44
      10000 -- (-1324.069) (-1313.517) [-1308.125] (-1335.063) * [-1309.179] (-1320.419) (-1310.292) (-1313.374) -- 0:01:39

      Average standard deviation of split frequencies: 0.048614

      10500 -- (-1328.876) [-1320.199] (-1312.136) (-1319.518) * (-1312.540) (-1330.224) (-1317.530) [-1314.372] -- 0:01:34
      11000 -- (-1324.895) [-1312.866] (-1313.259) (-1318.354) * (-1310.913) (-1326.855) [-1310.498] (-1317.103) -- 0:01:29
      11500 -- (-1324.885) (-1310.615) [-1315.201] (-1326.412) * [-1313.608] (-1334.835) (-1320.911) (-1309.723) -- 0:01:25
      12000 -- (-1318.845) (-1313.715) [-1314.010] (-1319.443) * (-1321.414) (-1336.131) (-1316.766) [-1313.818] -- 0:01:22
      12500 -- (-1318.949) (-1313.178) [-1309.732] (-1326.224) * [-1320.014] (-1327.101) (-1327.664) (-1320.224) -- 0:01:19
      13000 -- (-1330.600) (-1311.347) [-1307.555] (-1322.675) * (-1314.781) (-1325.180) (-1317.680) [-1312.934] -- 0:01:15
      13500 -- (-1324.715) [-1316.203] (-1315.051) (-1324.231) * [-1312.824] (-1330.474) (-1320.575) (-1314.055) -- 0:01:13
      14000 -- (-1328.272) [-1313.832] (-1313.143) (-1322.061) * (-1326.177) (-1325.503) [-1316.231] (-1316.523) -- 0:01:10
      14500 -- (-1321.116) (-1314.105) [-1309.589] (-1321.168) * [-1312.758] (-1330.533) (-1312.626) (-1315.701) -- 0:01:07
      15000 -- (-1329.974) (-1315.226) [-1310.322] (-1322.199) * (-1316.443) (-1328.404) [-1314.667] (-1307.137) -- 0:01:05

      Average standard deviation of split frequencies: 0.032141

      15500 -- (-1317.761) [-1311.042] (-1312.723) (-1320.949) * (-1317.208) (-1322.973) [-1316.357] (-1318.124) -- 0:02:07
      16000 -- (-1323.353) [-1310.597] (-1312.774) (-1329.485) * (-1320.880) (-1325.744) [-1308.144] (-1314.257) -- 0:02:03
      16500 -- (-1321.202) (-1311.513) [-1308.684] (-1320.696) * [-1313.766] (-1320.123) (-1314.616) (-1310.092) -- 0:01:59
      17000 -- (-1328.669) (-1310.815) [-1308.808] (-1324.289) * (-1315.857) (-1322.128) (-1311.556) [-1314.979] -- 0:01:55
      17500 -- (-1321.208) (-1314.523) [-1312.048] (-1320.313) * (-1321.486) (-1318.788) (-1317.760) [-1307.361] -- 0:01:52
      18000 -- (-1331.045) (-1311.721) [-1312.983] (-1319.575) * [-1312.831] (-1334.619) (-1316.686) (-1314.669) -- 0:01:49
      18500 -- (-1322.424) (-1322.548) [-1309.583] (-1330.055) * (-1317.719) (-1328.052) [-1318.848] (-1320.977) -- 0:01:46
      19000 -- (-1322.326) (-1317.627) (-1308.424) [-1320.515] * (-1315.479) (-1328.715) [-1314.880] (-1312.069) -- 0:01:43
      19500 -- (-1327.318) [-1313.701] (-1315.372) (-1319.757) * [-1312.344] (-1334.545) (-1324.322) (-1313.085) -- 0:01:40
      20000 -- (-1321.963) [-1321.584] (-1315.388) (-1321.523) * (-1310.291) (-1325.467) (-1323.793) [-1305.615] -- 0:01:38

      Average standard deviation of split frequencies: 0.020736

      20500 -- (-1327.899) [-1314.454] (-1312.666) (-1321.097) * (-1319.005) (-1319.913) (-1319.251) [-1321.982] -- 0:01:35
      21000 -- [-1317.753] (-1322.591) (-1313.281) (-1315.271) * (-1324.602) (-1322.698) (-1325.068) [-1311.803] -- 0:01:33
      21500 -- (-1319.003) (-1315.181) [-1310.535] (-1325.956) * (-1322.594) (-1324.917) (-1319.915) [-1311.213] -- 0:01:31
      22000 -- (-1326.571) (-1314.087) [-1310.931] (-1317.277) * (-1331.417) (-1325.811) (-1322.731) [-1313.415] -- 0:01:28
      22500 -- (-1328.446) [-1315.936] (-1329.269) (-1320.125) * (-1330.121) [-1322.023] (-1320.594) (-1308.570) -- 0:01:26
      23000 -- (-1326.214) [-1321.842] (-1323.989) (-1319.848) * (-1318.621) (-1328.552) (-1326.143) [-1310.126] -- 0:01:24
      23500 -- (-1329.002) (-1312.790) [-1323.219] (-1320.129) * (-1325.076) (-1328.034) (-1329.742) [-1312.981] -- 0:01:23
      24000 -- (-1325.127) [-1316.380] (-1327.689) (-1319.798) * (-1324.412) (-1324.199) (-1323.331) [-1311.019] -- 0:01:21
      24500 -- (-1329.736) [-1313.513] (-1325.476) (-1322.627) * (-1328.819) [-1326.420] (-1318.078) (-1306.595) -- 0:01:19
      25000 -- (-1331.557) (-1312.276) (-1322.250) [-1323.004] * (-1324.640) (-1324.610) (-1321.888) [-1313.545] -- 0:01:18

      Average standard deviation of split frequencies: 0.029669

      25500 -- (-1325.089) [-1317.320] (-1325.974) (-1318.553) * (-1318.026) (-1321.281) (-1323.769) [-1314.803] -- 0:01:54
      26000 -- (-1331.355) [-1315.974] (-1325.360) (-1324.272) * (-1318.895) (-1323.252) (-1326.270) [-1312.310] -- 0:01:52
      26500 -- (-1324.476) (-1312.738) [-1316.268] (-1324.786) * [-1318.528] (-1324.484) (-1327.955) (-1307.609) -- 0:01:50
      27000 -- (-1325.790) [-1312.954] (-1319.173) (-1326.738) * (-1321.342) (-1324.232) (-1325.550) [-1312.906] -- 0:01:48
      27500 -- (-1325.700) [-1315.510] (-1322.110) (-1319.874) * (-1324.535) (-1323.327) (-1321.858) [-1317.093] -- 0:01:46
      28000 -- (-1327.429) [-1310.712] (-1319.924) (-1317.749) * (-1321.003) (-1320.075) (-1326.800) [-1306.149] -- 0:01:44
      28500 -- (-1321.585) [-1318.550] (-1319.994) (-1320.464) * (-1326.088) (-1329.635) (-1323.902) [-1311.427] -- 0:01:42
      29000 -- (-1322.089) [-1311.774] (-1323.926) (-1326.612) * (-1324.548) (-1326.245) (-1325.315) [-1313.383] -- 0:01:40
      29500 -- (-1318.069) [-1321.332] (-1323.462) (-1318.077) * (-1326.271) (-1320.863) (-1323.212) [-1315.146] -- 0:01:38
      30000 -- (-1332.386) [-1315.754] (-1324.509) (-1327.551) * (-1331.945) [-1324.944] (-1323.939) (-1313.431) -- 0:01:37

      Average standard deviation of split frequencies: 0.033539

      30500 -- (-1326.029) [-1314.517] (-1318.714) (-1325.622) * [-1324.082] (-1325.615) (-1334.772) (-1315.592) -- 0:01:35
      31000 -- (-1325.045) [-1314.323] (-1323.688) (-1321.472) * [-1321.507] (-1328.422) (-1332.583) (-1311.069) -- 0:01:33
      31500 -- (-1325.192) [-1325.270] (-1323.165) (-1322.563) * (-1321.294) (-1319.803) (-1328.623) [-1309.263] -- 0:01:32
      32000 -- (-1330.810) [-1318.670] (-1332.390) (-1317.178) * (-1324.843) (-1322.610) (-1323.489) [-1314.032] -- 0:01:30
      32500 -- [-1325.268] (-1315.779) (-1337.869) (-1326.885) * (-1330.318) (-1325.291) (-1324.562) [-1308.981] -- 0:01:29
      33000 -- (-1326.960) [-1314.753] (-1323.118) (-1324.400) * (-1325.137) (-1317.464) (-1316.427) [-1318.404] -- 0:01:27
      33500 -- (-1331.825) [-1315.850] (-1325.881) (-1318.512) * (-1324.950) (-1320.031) (-1333.853) [-1307.836] -- 0:01:26
      34000 -- (-1327.287) (-1314.191) [-1322.196] (-1321.065) * (-1320.726) (-1319.275) (-1319.832) [-1308.188] -- 0:01:25
      34500 -- (-1321.678) (-1315.128) [-1320.995] (-1329.208) * (-1322.855) (-1322.423) (-1325.736) [-1309.849] -- 0:01:23
      35000 -- (-1331.974) [-1310.731] (-1324.402) (-1321.000) * (-1325.837) (-1328.795) (-1320.758) [-1308.949] -- 0:01:22

      Average standard deviation of split frequencies: 0.030951

      35500 -- (-1328.719) (-1311.931) (-1328.432) [-1322.897] * (-1328.199) (-1323.841) (-1325.912) [-1316.095] -- 0:01:48
      36000 -- (-1324.350) [-1318.592] (-1322.510) (-1324.898) * (-1330.535) (-1322.734) (-1320.224) [-1309.131] -- 0:01:47
      36500 -- (-1324.955) [-1316.150] (-1317.066) (-1322.445) * (-1321.364) (-1324.448) (-1327.379) [-1309.992] -- 0:01:45
      37000 -- (-1319.862) [-1312.729] (-1323.551) (-1324.220) * (-1322.776) [-1319.254] (-1327.881) (-1317.175) -- 0:01:44
      37500 -- (-1328.736) (-1313.704) (-1324.419) [-1322.645] * (-1330.062) (-1320.409) (-1313.655) [-1312.237] -- 0:01:42
      38000 -- (-1332.068) [-1311.651] (-1321.794) (-1324.438) * (-1320.313) (-1333.838) [-1323.144] (-1314.514) -- 0:01:41
      38500 -- [-1322.046] (-1312.988) (-1326.346) (-1321.329) * (-1324.738) (-1327.461) (-1329.881) [-1306.488] -- 0:01:39
      39000 -- [-1326.636] (-1314.931) (-1323.894) (-1321.298) * (-1333.119) (-1313.745) (-1322.810) [-1309.249] -- 0:01:38
      39500 -- (-1329.376) (-1320.444) [-1324.156] (-1323.510) * (-1319.773) (-1323.565) (-1328.860) [-1311.572] -- 0:01:37
      40000 -- (-1325.206) [-1319.974] (-1319.666) (-1322.778) * (-1319.220) [-1316.592] (-1332.589) (-1308.917) -- 0:01:36

      Average standard deviation of split frequencies: 0.021076

      40500 -- (-1322.302) [-1316.194] (-1318.998) (-1322.854) * (-1326.823) (-1320.059) (-1326.015) [-1312.094] -- 0:01:34
      41000 -- (-1322.042) [-1310.776] (-1317.057) (-1317.156) * (-1330.957) (-1318.962) (-1323.175) [-1308.957] -- 0:01:33
      41500 -- (-1323.862) [-1311.707] (-1319.815) (-1316.909) * (-1323.747) (-1329.106) (-1330.121) [-1307.607] -- 0:01:32
      42000 -- [-1320.344] (-1309.884) (-1320.448) (-1325.616) * (-1327.446) (-1325.772) (-1325.844) [-1309.317] -- 0:01:31
      42500 -- (-1320.961) (-1311.637) (-1324.982) [-1321.877] * (-1337.195) (-1322.376) (-1325.995) [-1313.545] -- 0:01:30
      43000 -- (-1328.335) [-1308.729] (-1322.483) (-1323.059) * (-1323.445) (-1323.523) (-1322.515) [-1306.476] -- 0:01:29
      43500 -- (-1328.027) [-1309.952] (-1327.990) (-1325.720) * (-1329.237) (-1326.263) (-1323.625) [-1309.505] -- 0:01:27
      44000 -- (-1317.412) [-1309.213] (-1326.935) (-1323.431) * (-1324.824) (-1318.116) (-1318.798) [-1309.725] -- 0:01:26
      44500 -- (-1334.562) [-1308.039] (-1320.674) (-1335.930) * [-1324.086] (-1324.149) (-1324.024) (-1318.774) -- 0:01:25
      45000 -- [-1317.749] (-1311.531) (-1323.935) (-1322.876) * [-1322.907] (-1326.710) (-1325.258) (-1312.027) -- 0:01:24

      Average standard deviation of split frequencies: 0.022359

      45500 -- (-1335.694) [-1312.700] (-1324.216) (-1319.633) * (-1323.112) (-1323.776) (-1321.680) [-1316.001] -- 0:01:23
      46000 -- (-1326.339) [-1316.390] (-1326.910) (-1319.173) * (-1317.527) (-1326.580) (-1329.708) [-1316.964] -- 0:01:22
      46500 -- (-1334.953) [-1311.921] (-1322.738) (-1319.022) * (-1317.828) (-1321.803) (-1321.976) [-1314.938] -- 0:01:42
      47000 -- (-1322.497) [-1310.810] (-1320.907) (-1321.471) * (-1323.909) (-1338.519) [-1326.390] (-1312.376) -- 0:01:41
      47500 -- (-1326.671) (-1311.162) [-1323.487] (-1317.809) * (-1318.392) (-1324.345) (-1319.537) [-1309.743] -- 0:01:40
      48000 -- (-1324.552) [-1314.997] (-1321.685) (-1329.359) * [-1317.989] (-1322.166) (-1328.499) (-1314.452) -- 0:01:39
      48500 -- (-1327.498) [-1314.739] (-1319.939) (-1326.447) * (-1320.090) (-1328.135) (-1326.525) [-1310.129] -- 0:01:38
      49000 -- (-1323.972) [-1309.602] (-1335.699) (-1321.677) * (-1325.862) (-1323.855) (-1324.849) [-1309.798] -- 0:01:37
      49500 -- (-1324.522) (-1309.670) (-1328.261) [-1313.597] * (-1326.334) (-1329.289) (-1322.103) [-1310.121] -- 0:01:36
      50000 -- (-1318.845) (-1315.237) (-1324.687) [-1325.475] * (-1325.470) (-1321.331) (-1318.779) [-1317.315] -- 0:01:35

      Average standard deviation of split frequencies: 0.021991

      50500 -- (-1329.262) [-1316.815] (-1325.424) (-1330.567) * (-1330.426) (-1326.421) (-1325.020) [-1316.161] -- 0:01:34
      51000 -- (-1325.574) [-1311.254] (-1320.528) (-1323.162) * (-1328.396) (-1326.895) (-1323.334) [-1308.814] -- 0:01:33
      51500 -- (-1326.307) [-1318.150] (-1319.000) (-1321.308) * [-1324.178] (-1321.063) (-1327.191) (-1316.014) -- 0:01:32
      52000 -- (-1330.572) [-1307.989] (-1320.618) (-1326.238) * (-1329.283) (-1327.994) (-1321.356) [-1313.849] -- 0:01:31
      52500 -- (-1323.471) (-1311.839) [-1320.348] (-1326.492) * (-1320.493) [-1322.994] (-1321.570) (-1312.635) -- 0:01:30
      53000 -- (-1322.260) (-1315.773) [-1320.076] (-1322.191) * (-1321.961) (-1322.069) (-1322.978) [-1310.380] -- 0:01:29
      53500 -- [-1323.341] (-1316.512) (-1322.610) (-1330.033) * (-1326.405) (-1326.523) (-1318.718) [-1315.444] -- 0:01:28
      54000 -- (-1322.311) [-1314.911] (-1324.483) (-1317.039) * (-1323.374) (-1320.050) (-1325.345) [-1313.176] -- 0:01:27
      54500 -- (-1326.056) [-1312.547] (-1328.325) (-1331.633) * (-1323.521) (-1326.650) [-1328.620] (-1313.731) -- 0:01:26
      55000 -- (-1321.225) [-1308.226] (-1324.074) (-1327.537) * (-1327.524) (-1327.363) (-1327.874) [-1326.272] -- 0:01:25

      Average standard deviation of split frequencies: 0.022958

      55500 -- [-1318.355] (-1313.040) (-1332.795) (-1318.170) * (-1321.654) [-1323.438] (-1320.151) (-1323.753) -- 0:01:25
      56000 -- (-1317.045) [-1314.539] (-1320.910) (-1320.319) * (-1317.542) (-1323.871) (-1320.472) [-1313.175] -- 0:01:24
      56500 -- (-1322.907) (-1314.951) (-1332.671) [-1319.950] * (-1322.363) (-1325.696) (-1325.296) [-1316.180] -- 0:01:23
      57000 -- (-1329.864) (-1309.091) (-1322.532) [-1320.279] * (-1323.540) (-1323.091) (-1326.936) [-1315.135] -- 0:01:22
      57500 -- (-1322.969) (-1314.733) (-1323.443) [-1325.351] * (-1317.797) (-1326.070) (-1318.662) [-1309.732] -- 0:01:38
      58000 -- (-1327.183) (-1314.070) [-1322.909] (-1323.565) * (-1324.298) (-1325.485) (-1321.098) [-1309.509] -- 0:01:37
      58500 -- (-1324.048) [-1311.672] (-1319.240) (-1325.791) * (-1331.936) (-1320.549) [-1322.577] (-1321.609) -- 0:01:36
      59000 -- (-1331.716) [-1311.162] (-1322.182) (-1323.812) * [-1322.083] (-1320.859) (-1323.374) (-1311.645) -- 0:01:35
      59500 -- (-1329.092) [-1309.176] (-1320.059) (-1323.806) * (-1322.421) (-1322.654) (-1323.468) [-1317.416] -- 0:01:34
      60000 -- (-1327.023) [-1311.066] (-1322.120) (-1324.521) * (-1327.182) [-1322.275] (-1326.644) (-1323.231) -- 0:01:34

      Average standard deviation of split frequencies: 0.026843

      60500 -- [-1319.647] (-1306.809) (-1332.134) (-1321.357) * (-1321.799) (-1322.383) [-1318.294] (-1315.197) -- 0:01:33
      61000 -- (-1331.862) [-1311.686] (-1324.901) (-1324.908) * (-1319.634) (-1326.362) (-1318.253) [-1320.371] -- 0:01:32
      61500 -- (-1325.059) [-1309.595] (-1322.983) (-1323.711) * (-1314.905) (-1322.108) (-1320.262) [-1312.832] -- 0:01:31
      62000 -- (-1317.846) [-1309.448] (-1319.156) (-1327.808) * [-1317.639] (-1326.450) (-1329.410) (-1310.309) -- 0:01:30
      62500 -- (-1318.138) [-1309.045] (-1318.523) (-1328.893) * (-1319.902) (-1322.158) (-1320.610) [-1309.688] -- 0:01:30
      63000 -- (-1318.044) [-1310.071] (-1328.852) (-1322.737) * (-1321.406) (-1327.006) (-1325.156) [-1311.538] -- 0:01:29
      63500 -- (-1332.046) (-1312.356) (-1331.110) [-1318.983] * (-1317.451) (-1324.457) (-1319.715) [-1311.996] -- 0:01:28
      64000 -- (-1321.812) [-1310.180] (-1321.439) (-1324.296) * [-1320.734] (-1323.781) (-1323.040) (-1310.604) -- 0:01:27
      64500 -- (-1318.959) [-1311.637] (-1316.348) (-1321.109) * (-1326.342) (-1323.753) (-1326.424) [-1312.963] -- 0:01:27
      65000 -- (-1325.921) [-1315.044] (-1322.681) (-1326.962) * (-1314.003) (-1326.063) (-1315.478) [-1319.665] -- 0:01:26

      Average standard deviation of split frequencies: 0.027271

      65500 -- (-1329.748) [-1313.793] (-1321.118) (-1322.649) * (-1321.694) (-1325.940) (-1320.925) [-1314.696] -- 0:01:25
      66000 -- (-1324.013) [-1314.491] (-1322.801) (-1323.745) * (-1325.015) (-1318.995) (-1322.526) [-1311.586] -- 0:01:24
      66500 -- (-1321.503) [-1309.330] (-1331.763) (-1322.071) * (-1320.645) (-1325.189) (-1322.521) [-1326.296] -- 0:01:24
      67000 -- (-1320.730) [-1311.735] (-1325.990) (-1320.025) * (-1320.606) (-1323.836) (-1324.923) [-1320.286] -- 0:01:23
      67500 -- [-1316.586] (-1311.768) (-1324.878) (-1320.810) * (-1317.573) [-1324.768] (-1324.847) (-1319.734) -- 0:01:22
      68000 -- (-1322.357) [-1309.941] (-1320.777) (-1322.741) * [-1322.120] (-1322.251) (-1318.155) (-1323.104) -- 0:01:22
      68500 -- (-1325.144) [-1310.080] (-1324.424) (-1318.912) * (-1329.800) (-1321.750) (-1327.765) [-1320.868] -- 0:01:35
      69000 -- (-1331.584) [-1318.049] (-1325.716) (-1323.491) * (-1323.659) (-1324.630) [-1316.748] (-1320.135) -- 0:01:34
      69500 -- (-1329.121) [-1314.202] (-1325.233) (-1322.319) * (-1321.096) [-1318.221] (-1323.766) (-1317.034) -- 0:01:33
      70000 -- (-1325.064) [-1322.705] (-1324.321) (-1320.993) * [-1323.003] (-1321.376) (-1318.411) (-1324.211) -- 0:01:33

      Average standard deviation of split frequencies: 0.025470

      70500 -- (-1322.390) (-1310.413) [-1319.208] (-1318.904) * (-1328.566) [-1325.091] (-1317.842) (-1318.089) -- 0:01:32
      71000 -- [-1324.811] (-1313.791) (-1322.698) (-1327.240) * (-1319.875) [-1326.179] (-1320.972) (-1326.045) -- 0:01:31
      71500 -- (-1324.104) (-1310.437) (-1326.014) [-1322.406] * (-1317.682) (-1334.212) [-1325.114] (-1323.572) -- 0:01:30
      72000 -- (-1320.238) [-1312.908] (-1325.374) (-1329.890) * (-1331.578) [-1320.470] (-1322.850) (-1321.611) -- 0:01:30
      72500 -- [-1318.998] (-1315.314) (-1325.020) (-1325.393) * (-1326.975) (-1334.166) [-1317.303] (-1320.200) -- 0:01:29
      73000 -- (-1322.951) (-1313.202) (-1335.247) [-1317.236] * (-1320.867) (-1329.916) [-1319.923] (-1321.290) -- 0:01:28
      73500 -- (-1318.106) (-1314.013) (-1326.240) [-1331.311] * (-1322.832) (-1328.303) [-1322.969] (-1323.288) -- 0:01:28
      74000 -- (-1326.110) [-1307.443] (-1326.127) (-1317.950) * (-1329.698) (-1324.394) [-1315.715] (-1318.080) -- 0:01:27
      74500 -- (-1321.000) [-1309.520] (-1319.070) (-1325.775) * (-1321.001) [-1317.065] (-1323.080) (-1323.965) -- 0:01:26
      75000 -- (-1319.659) (-1319.540) [-1323.239] (-1325.481) * (-1323.008) (-1324.308) [-1324.813] (-1331.078) -- 0:01:26

      Average standard deviation of split frequencies: 0.022555

      75500 -- [-1326.426] (-1311.529) (-1322.176) (-1322.527) * (-1322.519) (-1325.150) (-1320.138) [-1322.412] -- 0:01:25
      76000 -- (-1327.041) [-1314.241] (-1322.922) (-1322.019) * [-1320.250] (-1317.975) (-1323.166) (-1330.020) -- 0:01:25
      76500 -- (-1323.787) [-1311.239] (-1327.691) (-1327.051) * (-1325.530) (-1323.829) [-1315.375] (-1323.417) -- 0:01:24
      77000 -- [-1322.316] (-1317.720) (-1323.468) (-1323.785) * (-1327.450) (-1335.131) [-1320.883] (-1328.062) -- 0:01:23
      77500 -- (-1329.557) (-1318.653) [-1328.272] (-1323.551) * (-1323.428) (-1323.838) (-1320.247) [-1316.375] -- 0:01:23
      78000 -- (-1316.283) [-1316.622] (-1317.432) (-1331.752) * (-1323.530) (-1327.063) (-1329.029) [-1317.094] -- 0:01:22
      78500 -- (-1322.280) [-1313.521] (-1325.897) (-1328.940) * (-1321.944) [-1327.440] (-1321.618) (-1321.675) -- 0:01:22
      79000 -- (-1321.138) [-1313.035] (-1329.474) (-1324.358) * (-1336.247) (-1321.956) [-1320.694] (-1322.475) -- 0:01:21
      79500 -- (-1323.176) [-1314.032] (-1324.973) (-1328.700) * (-1321.452) (-1324.007) (-1322.278) [-1321.721] -- 0:01:32
      80000 -- (-1316.011) [-1308.565] (-1324.033) (-1325.274) * [-1325.768] (-1320.359) (-1320.675) (-1334.414) -- 0:01:32

      Average standard deviation of split frequencies: 0.019125

      80500 -- (-1323.937) [-1310.993] (-1323.894) (-1315.623) * (-1322.745) [-1317.558] (-1317.903) (-1327.990) -- 0:01:31
      81000 -- (-1317.914) [-1306.462] (-1323.380) (-1318.890) * (-1317.268) (-1329.773) (-1326.016) [-1320.533] -- 0:01:30
      81500 -- (-1330.924) [-1305.688] (-1325.970) (-1327.218) * (-1321.377) (-1329.623) [-1325.805] (-1324.045) -- 0:01:30
      82000 -- (-1322.437) [-1312.188] (-1331.586) (-1321.053) * (-1317.371) [-1319.048] (-1323.275) (-1326.041) -- 0:01:29
      82500 -- (-1325.283) [-1318.350] (-1324.601) (-1322.325) * (-1314.465) [-1329.159] (-1330.100) (-1322.564) -- 0:01:28
      83000 -- (-1319.776) [-1319.639] (-1330.794) (-1320.873) * (-1326.108) (-1331.944) (-1321.999) [-1319.348] -- 0:01:28
      83500 -- [-1324.067] (-1311.363) (-1329.472) (-1321.610) * [-1328.070] (-1329.544) (-1318.629) (-1325.749) -- 0:01:27
      84000 -- (-1331.389) [-1315.128] (-1330.682) (-1322.671) * [-1317.573] (-1332.217) (-1320.772) (-1327.184) -- 0:01:27
      84500 -- (-1325.774) [-1312.895] (-1324.146) (-1321.322) * (-1333.511) (-1323.502) [-1318.089] (-1324.452) -- 0:01:26
      85000 -- (-1329.970) (-1317.698) [-1323.411] (-1323.265) * (-1324.567) (-1318.665) (-1318.703) [-1323.753] -- 0:01:26

      Average standard deviation of split frequencies: 0.015946

      85500 -- (-1322.841) [-1311.488] (-1321.535) (-1321.305) * (-1320.770) [-1322.439] (-1320.763) (-1325.420) -- 0:01:25
      86000 -- [-1320.887] (-1320.493) (-1322.723) (-1315.647) * (-1320.308) (-1321.002) [-1316.555] (-1326.563) -- 0:01:25
      86500 -- (-1324.905) [-1316.304] (-1330.315) (-1324.311) * (-1324.263) [-1318.624] (-1318.111) (-1321.799) -- 0:01:24
      87000 -- (-1323.596) (-1313.478) [-1329.517] (-1326.300) * (-1324.850) [-1319.430] (-1326.503) (-1321.396) -- 0:01:23
      87500 -- (-1318.086) (-1314.021) [-1327.193] (-1321.333) * [-1320.047] (-1317.944) (-1321.211) (-1325.843) -- 0:01:23
      88000 -- (-1324.052) [-1312.355] (-1329.365) (-1323.641) * (-1322.102) [-1323.370] (-1321.669) (-1331.952) -- 0:01:22
      88500 -- (-1332.190) [-1319.912] (-1323.696) (-1319.604) * (-1317.284) (-1329.412) [-1324.629] (-1317.581) -- 0:01:22
      89000 -- (-1320.663) [-1309.554] (-1321.879) (-1322.794) * (-1328.036) (-1321.072) [-1322.936] (-1321.054) -- 0:01:21
      89500 -- (-1325.924) [-1314.159] (-1322.144) (-1328.111) * (-1329.292) [-1320.337] (-1320.116) (-1328.574) -- 0:01:21
      90000 -- (-1321.909) (-1313.382) (-1324.511) [-1320.317] * (-1323.878) (-1321.731) [-1323.927] (-1325.710) -- 0:01:20

      Average standard deviation of split frequencies: 0.017016

      90500 -- (-1324.375) [-1312.400] (-1321.748) (-1325.844) * (-1330.937) (-1326.163) [-1322.090] (-1325.504) -- 0:01:30
      91000 -- (-1324.628) (-1322.949) [-1320.165] (-1321.584) * (-1317.324) [-1319.763] (-1328.757) (-1325.319) -- 0:01:29
      91500 -- (-1316.266) [-1319.885] (-1317.766) (-1334.470) * (-1325.872) (-1331.122) [-1318.617] (-1325.734) -- 0:01:29
      92000 -- (-1319.887) [-1321.010] (-1326.006) (-1322.270) * (-1320.674) (-1322.300) [-1322.767] (-1323.862) -- 0:01:28
      92500 -- (-1319.720) [-1314.125] (-1323.029) (-1333.054) * [-1324.484] (-1331.526) (-1328.942) (-1323.536) -- 0:01:28
      93000 -- [-1315.859] (-1321.658) (-1324.381) (-1332.255) * (-1316.678) [-1324.028] (-1321.253) (-1322.323) -- 0:01:27
      93500 -- (-1324.456) (-1315.705) (-1319.412) [-1325.252] * [-1325.711] (-1323.747) (-1326.096) (-1323.350) -- 0:01:27
      94000 -- [-1325.267] (-1320.194) (-1326.117) (-1327.366) * (-1321.508) (-1326.973) [-1320.894] (-1328.276) -- 0:01:26
      94500 -- (-1324.503) (-1317.587) [-1326.040] (-1329.902) * (-1330.555) (-1322.969) (-1319.984) [-1319.450] -- 0:01:26
      95000 -- (-1334.102) [-1322.604] (-1320.364) (-1327.184) * [-1322.775] (-1324.635) (-1322.610) (-1322.518) -- 0:01:25

      Average standard deviation of split frequencies: 0.017856

      95500 -- (-1319.982) [-1317.288] (-1322.084) (-1321.632) * (-1320.299) (-1319.674) [-1324.555] (-1324.759) -- 0:01:25
      96000 -- [-1319.185] (-1332.282) (-1323.383) (-1323.930) * (-1317.246) (-1325.107) (-1320.308) [-1319.468] -- 0:01:24
      96500 -- (-1325.629) [-1327.653] (-1320.676) (-1326.599) * (-1325.794) (-1325.992) (-1325.050) [-1325.230] -- 0:01:24
      97000 -- (-1328.150) (-1321.499) [-1317.988] (-1320.071) * (-1327.361) (-1328.243) (-1324.491) [-1324.798] -- 0:01:23
      97500 -- (-1316.276) (-1326.834) (-1325.946) [-1325.838] * (-1331.289) (-1324.910) [-1319.952] (-1324.763) -- 0:01:23
      98000 -- (-1328.093) (-1327.143) (-1323.288) [-1323.279] * (-1327.979) (-1320.945) [-1324.184] (-1317.673) -- 0:01:22
      98500 -- [-1321.612] (-1323.135) (-1326.508) (-1324.986) * (-1325.652) [-1321.223] (-1328.439) (-1325.448) -- 0:01:22
      99000 -- [-1324.668] (-1323.187) (-1328.476) (-1319.069) * (-1321.040) (-1322.855) (-1322.577) [-1320.159] -- 0:01:21
      99500 -- (-1324.278) [-1322.438] (-1321.763) (-1325.056) * (-1319.101) (-1328.112) [-1316.533] (-1319.764) -- 0:01:21
      100000 -- (-1329.763) (-1326.272) (-1322.035) [-1321.204] * (-1322.242) (-1320.013) (-1325.076) [-1319.442] -- 0:01:21

      Average standard deviation of split frequencies: 0.019583

      100500 -- [-1320.235] (-1333.504) (-1327.575) (-1319.359) * [-1320.289] (-1328.347) (-1326.582) (-1325.483) -- 0:01:20
      101000 -- (-1321.336) (-1328.075) [-1322.044] (-1321.237) * (-1318.186) (-1329.363) (-1322.705) [-1319.556] -- 0:01:29
      101500 -- [-1321.610] (-1319.977) (-1325.311) (-1317.113) * (-1322.007) (-1329.750) (-1323.387) [-1318.605] -- 0:01:28
      102000 -- (-1325.475) [-1323.506] (-1329.236) (-1325.172) * (-1319.613) [-1325.518] (-1325.205) (-1324.036) -- 0:01:28
      102500 -- (-1323.475) (-1318.695) (-1321.406) [-1322.779] * (-1327.933) (-1324.074) (-1323.974) [-1326.445] -- 0:01:27
      103000 -- (-1325.351) [-1323.078] (-1323.800) (-1325.051) * (-1333.475) (-1322.457) (-1318.496) [-1323.377] -- 0:01:27
      103500 -- (-1332.403) [-1318.018] (-1323.883) (-1323.976) * (-1320.857) (-1332.038) (-1332.716) [-1324.749] -- 0:01:26
      104000 -- (-1317.498) [-1320.707] (-1329.546) (-1332.849) * (-1323.383) (-1332.766) [-1324.157] (-1325.217) -- 0:01:26
      104500 -- (-1320.897) (-1324.159) (-1322.074) [-1322.039] * (-1326.678) (-1321.513) (-1333.792) [-1321.152] -- 0:01:25
      105000 -- (-1325.321) [-1321.733] (-1328.755) (-1321.352) * (-1332.681) (-1322.837) [-1315.837] (-1329.688) -- 0:01:25

      Average standard deviation of split frequencies: 0.015363

      105500 -- (-1322.783) (-1325.073) [-1324.164] (-1320.680) * [-1319.584] (-1330.947) (-1323.939) (-1325.059) -- 0:01:24
      106000 -- (-1322.416) [-1318.183] (-1324.901) (-1328.772) * (-1313.748) (-1325.932) [-1318.194] (-1324.980) -- 0:01:24
      106500 -- (-1315.905) (-1322.919) (-1323.761) [-1323.533] * (-1324.377) (-1329.437) [-1321.371] (-1318.880) -- 0:01:23
      107000 -- (-1330.230) (-1316.664) [-1326.073] (-1327.273) * [-1322.347] (-1324.272) (-1320.097) (-1319.745) -- 0:01:23
      107500 -- (-1318.848) (-1324.320) (-1329.071) [-1321.573] * (-1320.404) [-1318.926] (-1320.712) (-1323.238) -- 0:01:23
      108000 -- [-1324.164] (-1329.414) (-1327.013) (-1320.445) * (-1324.531) (-1320.956) (-1321.981) [-1318.027] -- 0:01:22
      108500 -- (-1319.906) (-1327.758) [-1322.069] (-1327.960) * (-1321.732) (-1322.094) (-1324.514) [-1317.817] -- 0:01:22
      109000 -- [-1322.602] (-1323.299) (-1333.437) (-1320.503) * (-1326.277) [-1321.301] (-1330.624) (-1322.047) -- 0:01:21
      109500 -- (-1324.494) [-1325.542] (-1321.888) (-1323.458) * (-1318.964) (-1326.297) (-1320.390) [-1322.434] -- 0:01:21
      110000 -- (-1325.433) (-1321.783) (-1326.019) [-1325.578] * (-1320.847) (-1326.289) (-1320.577) [-1320.909] -- 0:01:20

      Average standard deviation of split frequencies: 0.015490

      110500 -- (-1319.785) (-1322.953) (-1323.443) [-1326.542] * (-1326.845) (-1325.679) [-1319.708] (-1319.154) -- 0:01:20
      111000 -- (-1324.174) [-1315.392] (-1322.381) (-1340.381) * (-1321.245) [-1322.818] (-1323.253) (-1324.293) -- 0:01:20
      111500 -- (-1324.655) (-1323.976) [-1319.590] (-1327.508) * [-1318.907] (-1320.375) (-1324.161) (-1324.129) -- 0:01:19
      112000 -- [-1317.839] (-1326.226) (-1329.202) (-1327.701) * (-1321.693) (-1318.001) [-1318.870] (-1321.460) -- 0:01:27
      112500 -- (-1323.109) [-1321.843] (-1318.133) (-1324.528) * (-1324.244) (-1328.548) (-1318.672) [-1326.502] -- 0:01:26
      113000 -- (-1326.739) (-1324.724) [-1317.718] (-1324.930) * (-1329.984) [-1327.770] (-1324.240) (-1325.167) -- 0:01:26
      113500 -- (-1321.235) (-1322.633) (-1328.687) [-1323.275] * [-1317.205] (-1324.650) (-1324.136) (-1324.046) -- 0:01:25
      114000 -- (-1324.603) (-1317.303) [-1321.638] (-1332.290) * (-1324.182) (-1328.031) (-1323.953) [-1323.612] -- 0:01:25
      114500 -- (-1322.989) (-1327.045) (-1322.855) [-1324.471] * (-1321.986) [-1322.121] (-1322.076) (-1324.251) -- 0:01:25
      115000 -- (-1324.634) [-1324.069] (-1323.367) (-1323.287) * [-1324.971] (-1324.772) (-1327.540) (-1321.371) -- 0:01:24

      Average standard deviation of split frequencies: 0.018472

      115500 -- (-1320.771) [-1317.173] (-1318.602) (-1324.423) * (-1331.978) [-1321.881] (-1324.087) (-1320.561) -- 0:01:24
      116000 -- (-1324.101) (-1323.403) (-1326.608) [-1317.423] * (-1323.059) (-1325.351) (-1331.552) [-1318.954] -- 0:01:23
      116500 -- (-1322.296) (-1323.638) [-1316.079] (-1330.709) * [-1326.503] (-1321.690) (-1326.540) (-1329.224) -- 0:01:23
      117000 -- (-1325.802) [-1314.745] (-1328.766) (-1326.299) * (-1330.979) (-1320.781) (-1325.674) [-1322.621] -- 0:01:23
      117500 -- (-1334.048) (-1320.031) (-1320.041) [-1323.386] * (-1318.494) (-1330.206) [-1319.608] (-1326.417) -- 0:01:22
      118000 -- (-1321.286) [-1318.524] (-1326.488) (-1325.410) * (-1317.153) (-1324.747) (-1317.253) [-1318.409] -- 0:01:22
      118500 -- (-1321.545) [-1326.628] (-1333.335) (-1326.549) * (-1327.400) (-1320.553) (-1327.851) [-1321.797] -- 0:01:21
      119000 -- [-1320.773] (-1321.460) (-1324.021) (-1321.775) * (-1327.390) (-1328.022) [-1319.867] (-1319.727) -- 0:01:21
      119500 -- [-1324.955] (-1320.464) (-1319.360) (-1328.513) * (-1330.166) [-1321.144] (-1326.354) (-1319.688) -- 0:01:21
      120000 -- (-1334.338) (-1321.949) (-1333.011) [-1323.692] * (-1321.814) (-1320.861) [-1325.405] (-1327.243) -- 0:01:20

      Average standard deviation of split frequencies: 0.018468

      120500 -- [-1323.307] (-1326.173) (-1322.406) (-1320.945) * (-1334.325) (-1330.771) [-1314.564] (-1330.353) -- 0:01:20
      121000 -- (-1320.208) (-1326.599) (-1323.724) [-1325.600] * (-1317.612) [-1318.500] (-1327.811) (-1329.221) -- 0:01:19
      121500 -- (-1330.484) [-1321.941] (-1325.333) (-1333.449) * (-1322.864) (-1324.610) (-1320.093) [-1325.461] -- 0:01:19
      122000 -- (-1338.609) (-1323.714) [-1318.472] (-1327.286) * (-1324.029) (-1319.905) [-1315.022] (-1325.112) -- 0:01:19
      122500 -- [-1323.099] (-1325.823) (-1319.470) (-1324.557) * (-1318.049) (-1316.540) (-1321.304) [-1318.476] -- 0:01:18
      123000 -- (-1322.371) (-1316.792) [-1321.282] (-1328.803) * [-1320.570] (-1325.620) (-1325.277) (-1318.296) -- 0:01:25
      123500 -- [-1322.677] (-1320.795) (-1331.050) (-1331.085) * (-1322.291) [-1321.414] (-1323.916) (-1328.682) -- 0:01:25
      124000 -- (-1326.845) (-1323.434) (-1317.450) [-1320.967] * [-1321.571] (-1321.384) (-1327.024) (-1325.966) -- 0:01:24
      124500 -- (-1318.802) [-1321.942] (-1334.398) (-1330.490) * (-1330.529) (-1323.709) (-1329.356) [-1319.793] -- 0:01:24
      125000 -- (-1323.892) [-1322.409] (-1319.123) (-1326.072) * (-1319.407) (-1319.096) [-1322.422] (-1319.912) -- 0:01:24

      Average standard deviation of split frequencies: 0.016326

      125500 -- [-1320.803] (-1324.415) (-1322.662) (-1322.278) * (-1320.221) [-1316.374] (-1326.022) (-1324.903) -- 0:01:23
      126000 -- [-1320.416] (-1324.119) (-1319.339) (-1324.644) * [-1321.646] (-1316.967) (-1325.404) (-1322.882) -- 0:01:23
      126500 -- [-1319.912] (-1319.639) (-1320.043) (-1323.943) * (-1324.641) [-1327.708] (-1326.692) (-1322.210) -- 0:01:22
      127000 -- [-1320.924] (-1321.928) (-1323.855) (-1336.260) * (-1326.286) [-1326.152] (-1322.400) (-1323.525) -- 0:01:22
      127500 -- (-1319.819) (-1319.781) (-1334.091) [-1329.473] * (-1329.833) (-1321.749) [-1325.027] (-1321.079) -- 0:01:22
      128000 -- (-1332.086) (-1323.388) [-1319.682] (-1322.524) * [-1318.926] (-1327.161) (-1320.811) (-1325.129) -- 0:01:21
      128500 -- (-1326.897) (-1320.886) (-1321.826) [-1319.149] * (-1322.654) (-1325.686) [-1330.361] (-1325.801) -- 0:01:21
      129000 -- (-1324.589) (-1322.756) [-1317.526] (-1322.869) * [-1322.397] (-1322.908) (-1319.540) (-1322.444) -- 0:01:21
      129500 -- (-1325.208) (-1323.072) (-1321.881) [-1318.841] * (-1322.311) (-1326.874) (-1320.386) [-1320.654] -- 0:01:20
      130000 -- [-1326.646] (-1331.014) (-1328.677) (-1320.748) * (-1328.378) (-1326.178) (-1324.902) [-1314.844] -- 0:01:20

      Average standard deviation of split frequencies: 0.017055

      130500 -- [-1319.410] (-1323.649) (-1322.861) (-1331.780) * (-1324.084) [-1324.151] (-1326.142) (-1324.724) -- 0:01:19
      131000 -- (-1318.566) (-1322.300) (-1322.392) [-1319.156] * (-1324.038) (-1319.564) (-1323.788) [-1319.902] -- 0:01:19
      131500 -- (-1319.178) (-1325.245) (-1325.271) [-1325.665] * [-1320.339] (-1323.192) (-1320.302) (-1325.161) -- 0:01:19
      132000 -- (-1317.623) (-1326.859) [-1319.112] (-1327.458) * (-1326.969) (-1332.861) (-1320.288) [-1321.313] -- 0:01:18
      132500 -- (-1317.855) (-1330.708) (-1320.493) [-1320.975] * [-1321.953] (-1329.114) (-1326.467) (-1323.690) -- 0:01:18
      133000 -- (-1325.846) [-1320.390] (-1318.653) (-1323.886) * (-1321.890) (-1323.980) [-1318.966] (-1321.364) -- 0:01:18
      133500 -- (-1323.506) (-1332.630) [-1325.297] (-1322.712) * (-1325.040) (-1321.314) [-1329.049] (-1321.309) -- 0:01:17
      134000 -- (-1319.275) (-1327.805) [-1316.451] (-1327.827) * (-1325.946) (-1323.730) (-1317.680) [-1317.327] -- 0:01:24
      134500 -- (-1325.739) (-1324.931) [-1320.351] (-1327.095) * (-1318.028) (-1328.308) (-1324.931) [-1317.753] -- 0:01:23
      135000 -- (-1326.208) (-1331.288) (-1325.575) [-1320.256] * (-1320.916) (-1327.119) [-1320.598] (-1325.106) -- 0:01:23

      Average standard deviation of split frequencies: 0.016386

      135500 -- [-1321.288] (-1322.225) (-1327.540) (-1322.504) * (-1329.118) (-1325.522) [-1320.625] (-1328.654) -- 0:01:22
      136000 -- (-1329.177) (-1319.154) (-1324.481) [-1321.492] * (-1325.394) [-1319.955] (-1325.604) (-1325.595) -- 0:01:22
      136500 -- (-1327.863) (-1327.004) (-1324.866) [-1320.926] * (-1321.391) (-1321.696) [-1322.927] (-1327.441) -- 0:01:22
      137000 -- (-1322.811) [-1330.921] (-1323.990) (-1322.699) * (-1318.073) (-1323.209) [-1320.171] (-1325.275) -- 0:01:21
      137500 -- (-1325.879) [-1317.681] (-1322.207) (-1327.844) * (-1318.462) (-1325.392) [-1324.348] (-1335.049) -- 0:01:21
      138000 -- (-1321.065) [-1320.593] (-1322.198) (-1328.900) * (-1322.145) (-1322.808) [-1322.863] (-1323.802) -- 0:01:21
      138500 -- (-1328.526) [-1325.748] (-1323.856) (-1320.301) * (-1334.614) [-1321.498] (-1324.799) (-1322.339) -- 0:01:20
      139000 -- (-1322.726) [-1320.330] (-1322.114) (-1326.338) * [-1323.412] (-1321.813) (-1321.289) (-1337.095) -- 0:01:20
      139500 -- (-1316.224) (-1328.712) [-1319.689] (-1319.422) * [-1324.536] (-1318.321) (-1322.959) (-1322.325) -- 0:01:20
      140000 -- [-1320.365] (-1320.054) (-1319.342) (-1320.668) * (-1323.236) (-1320.004) (-1315.705) [-1324.804] -- 0:01:19

      Average standard deviation of split frequencies: 0.015842

      140500 -- (-1327.611) (-1329.486) (-1321.692) [-1321.670] * (-1327.350) [-1323.537] (-1320.060) (-1323.351) -- 0:01:19
      141000 -- [-1327.046] (-1318.798) (-1320.557) (-1330.235) * (-1321.271) (-1320.957) [-1325.601] (-1327.329) -- 0:01:19
      141500 -- (-1336.719) [-1319.658] (-1320.080) (-1321.699) * (-1324.360) [-1320.832] (-1325.328) (-1324.754) -- 0:01:18
      142000 -- (-1325.884) [-1320.619] (-1320.172) (-1326.113) * [-1318.754] (-1328.813) (-1325.364) (-1320.200) -- 0:01:18
      142500 -- (-1323.107) (-1321.334) (-1319.273) [-1317.490] * (-1319.964) (-1323.677) [-1317.892] (-1323.240) -- 0:01:18
      143000 -- [-1320.633] (-1322.223) (-1323.762) (-1323.786) * (-1319.220) (-1325.986) [-1321.593] (-1327.943) -- 0:01:17
      143500 -- (-1323.917) [-1317.164] (-1319.565) (-1325.109) * [-1324.340] (-1323.192) (-1332.299) (-1320.128) -- 0:01:17
      144000 -- (-1317.951) [-1324.344] (-1320.156) (-1328.819) * (-1321.793) (-1328.808) [-1315.694] (-1328.445) -- 0:01:17
      144500 -- (-1319.425) [-1322.105] (-1326.479) (-1325.304) * (-1320.741) (-1322.626) [-1323.524] (-1329.363) -- 0:01:16
      145000 -- (-1322.515) (-1322.897) (-1324.618) [-1323.694] * (-1323.748) [-1320.514] (-1329.582) (-1325.564) -- 0:01:16

      Average standard deviation of split frequencies: 0.015263

      145500 -- (-1321.863) (-1324.532) [-1322.738] (-1323.037) * (-1320.335) [-1325.741] (-1329.605) (-1323.252) -- 0:01:22
      146000 -- [-1322.690] (-1324.570) (-1317.606) (-1328.062) * (-1319.419) [-1322.744] (-1321.983) (-1323.263) -- 0:01:21
      146500 -- (-1321.939) (-1325.089) (-1328.491) [-1330.000] * (-1322.808) [-1319.700] (-1318.150) (-1318.406) -- 0:01:21
      147000 -- (-1326.426) (-1327.899) [-1321.111] (-1323.430) * (-1325.245) (-1319.582) [-1318.767] (-1320.352) -- 0:01:21
      147500 -- (-1328.892) (-1321.295) (-1321.537) [-1321.516] * (-1325.606) (-1323.548) [-1322.474] (-1327.039) -- 0:01:20
      148000 -- (-1323.413) (-1331.244) [-1322.228] (-1321.725) * (-1321.419) (-1328.198) [-1314.986] (-1321.082) -- 0:01:20
      148500 -- (-1324.136) [-1321.013] (-1321.034) (-1324.602) * (-1326.480) (-1322.754) (-1325.711) [-1318.177] -- 0:01:20
      149000 -- (-1324.019) (-1318.664) [-1325.224] (-1326.878) * (-1324.761) (-1320.794) (-1326.373) [-1316.656] -- 0:01:19
      149500 -- (-1322.479) (-1321.227) (-1322.995) [-1319.195] * (-1329.411) (-1327.887) (-1324.133) [-1317.270] -- 0:01:19
      150000 -- [-1320.702] (-1325.125) (-1323.244) (-1321.083) * (-1319.105) (-1322.187) [-1321.002] (-1317.618) -- 0:01:19

      Average standard deviation of split frequencies: 0.016497

      150500 -- (-1322.099) (-1324.964) (-1323.693) [-1317.510] * (-1331.357) (-1331.250) [-1325.332] (-1321.148) -- 0:01:19
      151000 -- (-1322.086) (-1322.883) (-1319.508) [-1317.047] * (-1322.035) (-1320.944) (-1322.704) [-1319.185] -- 0:01:18
      151500 -- (-1319.491) [-1320.068] (-1323.988) (-1322.452) * (-1320.672) (-1331.769) [-1324.416] (-1320.481) -- 0:01:18
      152000 -- [-1326.069] (-1335.526) (-1331.275) (-1326.860) * (-1323.542) (-1335.992) (-1328.876) [-1320.367] -- 0:01:18
      152500 -- (-1324.592) (-1330.101) [-1319.037] (-1322.036) * (-1318.685) (-1325.898) (-1323.694) [-1318.795] -- 0:01:17
      153000 -- [-1327.467] (-1323.529) (-1323.750) (-1320.473) * [-1317.126] (-1327.789) (-1324.116) (-1320.532) -- 0:01:17
      153500 -- (-1319.875) [-1317.506] (-1321.027) (-1326.459) * (-1317.850) (-1324.358) [-1320.659] (-1322.151) -- 0:01:17
      154000 -- (-1326.701) (-1323.390) [-1320.906] (-1324.217) * (-1321.267) [-1319.743] (-1323.259) (-1320.429) -- 0:01:16
      154500 -- (-1321.896) (-1326.133) (-1317.580) [-1322.092] * [-1322.525] (-1330.836) (-1323.404) (-1316.554) -- 0:01:16
      155000 -- [-1318.926] (-1321.956) (-1322.894) (-1324.574) * [-1318.654] (-1325.199) (-1323.631) (-1321.985) -- 0:01:16

      Average standard deviation of split frequencies: 0.019230

      155500 -- (-1321.533) (-1327.997) [-1316.971] (-1322.218) * (-1318.833) [-1325.871] (-1326.783) (-1329.761) -- 0:01:16
      156000 -- [-1321.681] (-1328.345) (-1320.663) (-1324.196) * (-1324.180) (-1320.412) [-1324.776] (-1331.229) -- 0:01:21
      156500 -- (-1324.547) (-1322.685) (-1321.522) [-1327.175] * (-1327.360) (-1322.404) [-1319.888] (-1334.883) -- 0:01:20
      157000 -- [-1318.994] (-1324.321) (-1321.415) (-1323.413) * (-1325.588) [-1317.664] (-1320.032) (-1320.131) -- 0:01:20
      157500 -- (-1325.634) [-1323.714] (-1321.485) (-1327.991) * (-1327.167) [-1322.143] (-1329.304) (-1316.381) -- 0:01:20
      158000 -- [-1320.193] (-1324.192) (-1322.379) (-1323.064) * (-1322.749) [-1326.217] (-1326.447) (-1326.449) -- 0:01:19
      158500 -- (-1320.855) (-1326.802) (-1326.010) [-1326.991] * (-1327.022) [-1320.791] (-1327.901) (-1319.389) -- 0:01:19
      159000 -- (-1324.703) [-1324.602] (-1324.311) (-1321.620) * (-1323.146) (-1319.231) (-1324.133) [-1323.917] -- 0:01:19
      159500 -- (-1329.237) (-1328.630) (-1317.879) [-1323.561] * (-1321.319) (-1327.023) (-1322.558) [-1326.761] -- 0:01:19
      160000 -- (-1326.562) (-1319.875) [-1325.985] (-1323.107) * (-1317.672) [-1323.108] (-1321.531) (-1322.608) -- 0:01:18

      Average standard deviation of split frequencies: 0.017071

      160500 -- (-1328.645) [-1321.456] (-1327.777) (-1321.371) * (-1322.624) (-1325.921) (-1323.500) [-1321.993] -- 0:01:18
      161000 -- (-1322.555) (-1321.663) (-1321.598) [-1318.875] * (-1318.118) (-1321.280) [-1323.762] (-1316.135) -- 0:01:18
      161500 -- (-1326.617) (-1319.012) (-1322.475) [-1327.237] * (-1321.519) [-1324.574] (-1323.410) (-1320.741) -- 0:01:17
      162000 -- (-1325.584) (-1328.741) (-1333.596) [-1322.753] * (-1322.015) (-1332.454) (-1319.989) [-1321.465] -- 0:01:17
      162500 -- (-1322.875) [-1317.476] (-1323.584) (-1320.147) * (-1330.609) (-1324.852) [-1319.629] (-1318.712) -- 0:01:17
      163000 -- (-1325.334) (-1325.929) [-1322.657] (-1323.568) * [-1320.347] (-1325.141) (-1322.069) (-1321.112) -- 0:01:17
      163500 -- (-1323.035) (-1328.372) [-1320.225] (-1328.272) * (-1322.988) (-1324.771) (-1323.190) [-1318.312] -- 0:01:16
      164000 -- [-1320.357] (-1325.937) (-1321.712) (-1321.654) * (-1321.102) (-1328.943) (-1325.872) [-1319.578] -- 0:01:16
      164500 -- (-1321.673) (-1324.442) [-1329.216] (-1324.730) * (-1326.932) [-1319.570] (-1327.075) (-1324.085) -- 0:01:16
      165000 -- (-1321.758) [-1320.202] (-1324.540) (-1334.015) * (-1320.028) (-1317.212) [-1327.622] (-1323.471) -- 0:01:15

      Average standard deviation of split frequencies: 0.016006

      165500 -- (-1323.936) (-1320.806) [-1323.859] (-1324.352) * (-1325.869) [-1319.510] (-1335.304) (-1327.529) -- 0:01:15
      166000 -- [-1328.528] (-1329.722) (-1323.882) (-1329.435) * [-1326.782] (-1325.299) (-1324.462) (-1318.523) -- 0:01:15
      166500 -- (-1324.175) (-1322.878) (-1322.867) [-1323.299] * [-1324.268] (-1316.943) (-1328.598) (-1326.079) -- 0:01:15
      167000 -- (-1334.029) [-1319.892] (-1318.279) (-1326.817) * [-1319.269] (-1325.067) (-1321.721) (-1319.382) -- 0:01:19
      167500 -- (-1322.992) (-1320.610) [-1321.986] (-1322.232) * (-1320.346) [-1325.924] (-1328.546) (-1314.589) -- 0:01:19
      168000 -- [-1316.184] (-1324.378) (-1323.475) (-1320.780) * (-1322.958) (-1326.075) [-1324.546] (-1321.315) -- 0:01:19
      168500 -- (-1327.802) [-1322.067] (-1324.656) (-1316.921) * (-1334.799) (-1324.754) (-1324.115) [-1320.552] -- 0:01:18
      169000 -- [-1317.933] (-1321.424) (-1324.831) (-1320.055) * (-1326.780) [-1319.814] (-1331.989) (-1322.090) -- 0:01:18
      169500 -- (-1319.959) [-1320.384] (-1322.170) (-1325.670) * (-1324.992) [-1319.135] (-1322.968) (-1327.143) -- 0:01:18
      170000 -- [-1319.200] (-1323.431) (-1327.744) (-1323.760) * (-1324.831) (-1319.465) [-1326.470] (-1327.411) -- 0:01:18

      Average standard deviation of split frequencies: 0.015066

      170500 -- [-1317.666] (-1323.132) (-1325.673) (-1322.501) * (-1315.735) (-1326.698) (-1324.608) [-1322.070] -- 0:01:17
      171000 -- (-1326.424) [-1320.223] (-1323.630) (-1322.124) * (-1317.435) (-1326.825) [-1324.364] (-1325.862) -- 0:01:17
      171500 -- (-1333.427) [-1320.548] (-1321.311) (-1316.663) * (-1320.724) [-1318.947] (-1326.518) (-1329.881) -- 0:01:17
      172000 -- [-1322.683] (-1326.371) (-1329.341) (-1325.694) * (-1319.265) [-1325.561] (-1322.993) (-1320.466) -- 0:01:17
      172500 -- (-1323.769) (-1323.111) [-1319.075] (-1327.119) * (-1320.942) (-1322.125) [-1322.426] (-1322.731) -- 0:01:16
      173000 -- [-1324.421] (-1321.480) (-1321.764) (-1324.511) * (-1325.278) [-1320.316] (-1323.606) (-1325.574) -- 0:01:16
      173500 -- (-1322.580) (-1321.811) [-1328.120] (-1326.436) * (-1322.647) [-1319.521] (-1326.617) (-1319.785) -- 0:01:16
      174000 -- [-1322.796] (-1323.799) (-1321.887) (-1319.443) * (-1328.977) [-1323.382] (-1319.655) (-1329.698) -- 0:01:15
      174500 -- (-1331.989) (-1341.776) (-1323.573) [-1319.178] * (-1323.881) (-1323.396) (-1322.239) [-1321.325] -- 0:01:15
      175000 -- [-1322.887] (-1317.972) (-1322.514) (-1330.150) * [-1321.206] (-1321.621) (-1320.722) (-1325.109) -- 0:01:15

      Average standard deviation of split frequencies: 0.017045

      175500 -- [-1318.032] (-1320.540) (-1322.785) (-1320.450) * (-1327.965) (-1319.267) [-1320.125] (-1320.978) -- 0:01:15
      176000 -- (-1329.688) (-1321.353) [-1320.894] (-1325.338) * (-1324.616) (-1320.265) (-1320.643) [-1324.862] -- 0:01:14
      176500 -- [-1324.435] (-1318.838) (-1328.123) (-1325.216) * (-1325.859) (-1322.028) [-1319.515] (-1318.966) -- 0:01:14
      177000 -- [-1318.994] (-1332.006) (-1323.446) (-1322.235) * (-1323.778) (-1332.099) [-1317.931] (-1317.131) -- 0:01:14
      177500 -- (-1331.298) (-1330.315) [-1329.791] (-1315.605) * (-1324.080) (-1322.673) [-1321.681] (-1328.129) -- 0:01:14
      178000 -- (-1327.237) (-1334.454) (-1323.926) [-1321.676] * (-1323.937) [-1316.957] (-1329.268) (-1326.121) -- 0:01:18
      178500 -- [-1320.388] (-1334.101) (-1319.989) (-1321.734) * (-1328.571) (-1324.937) [-1322.173] (-1322.731) -- 0:01:18
      179000 -- (-1322.123) (-1319.210) (-1319.672) [-1317.479] * [-1322.137] (-1318.288) (-1323.817) (-1319.823) -- 0:01:17
      179500 -- (-1320.724) (-1322.500) (-1325.773) [-1314.374] * [-1319.635] (-1316.560) (-1322.281) (-1322.661) -- 0:01:17
      180000 -- (-1325.404) [-1321.892] (-1320.146) (-1318.882) * [-1317.690] (-1322.630) (-1319.986) (-1324.807) -- 0:01:17

      Average standard deviation of split frequencies: 0.018976

      180500 -- (-1320.827) [-1321.917] (-1325.167) (-1319.362) * (-1318.132) [-1318.853] (-1322.523) (-1320.219) -- 0:01:17
      181000 -- [-1317.560] (-1326.174) (-1324.788) (-1324.387) * (-1323.489) (-1318.640) (-1314.423) [-1323.316] -- 0:01:16
      181500 -- [-1322.403] (-1314.852) (-1322.984) (-1325.367) * (-1318.645) (-1325.179) (-1330.650) [-1322.259] -- 0:01:16
      182000 -- [-1325.189] (-1317.427) (-1322.658) (-1328.804) * (-1325.393) [-1325.198] (-1323.671) (-1324.239) -- 0:01:16
      182500 -- (-1325.353) (-1322.866) [-1316.654] (-1326.206) * (-1324.959) (-1320.576) (-1323.034) [-1326.681] -- 0:01:16
      183000 -- [-1317.636] (-1324.305) (-1320.504) (-1333.203) * (-1322.648) (-1320.531) [-1321.042] (-1321.157) -- 0:01:15
      183500 -- (-1322.340) (-1321.408) (-1327.105) [-1319.690] * (-1328.868) [-1321.978] (-1321.475) (-1324.898) -- 0:01:15
      184000 -- (-1331.257) [-1317.439] (-1322.757) (-1323.391) * (-1326.059) [-1325.037] (-1321.206) (-1320.023) -- 0:01:15
      184500 -- (-1324.073) [-1317.859] (-1317.943) (-1328.106) * (-1319.899) [-1320.938] (-1324.189) (-1323.761) -- 0:01:15
      185000 -- (-1324.266) [-1323.363] (-1321.875) (-1321.759) * (-1319.770) (-1322.230) [-1315.038] (-1320.174) -- 0:01:14

      Average standard deviation of split frequencies: 0.016589

      185500 -- [-1320.129] (-1326.272) (-1323.309) (-1330.621) * [-1325.877] (-1326.585) (-1330.783) (-1320.674) -- 0:01:14
      186000 -- [-1319.136] (-1324.943) (-1324.025) (-1326.730) * (-1323.762) (-1317.170) [-1323.578] (-1321.254) -- 0:01:14
      186500 -- (-1324.674) [-1320.392] (-1325.143) (-1325.161) * (-1317.847) [-1319.651] (-1328.500) (-1320.441) -- 0:01:14
      187000 -- (-1319.631) (-1326.974) [-1317.201] (-1325.318) * (-1326.407) (-1320.700) [-1323.808] (-1324.778) -- 0:01:13
      187500 -- (-1320.684) (-1328.418) [-1329.363] (-1331.311) * (-1325.494) (-1323.190) [-1318.242] (-1314.440) -- 0:01:18
      188000 -- (-1320.196) (-1324.524) [-1320.417] (-1330.293) * (-1331.272) [-1321.640] (-1320.584) (-1327.612) -- 0:01:17
      188500 -- [-1315.125] (-1332.874) (-1323.325) (-1321.792) * (-1322.845) (-1325.371) [-1324.371] (-1326.867) -- 0:01:17
      189000 -- (-1319.674) (-1326.163) [-1325.361] (-1328.540) * [-1324.954] (-1327.305) (-1324.853) (-1321.798) -- 0:01:17
      189500 -- [-1319.580] (-1319.016) (-1325.474) (-1327.845) * (-1320.786) [-1319.372] (-1323.170) (-1327.465) -- 0:01:16
      190000 -- (-1322.948) (-1322.212) [-1318.828] (-1326.774) * [-1323.373] (-1324.668) (-1318.848) (-1324.586) -- 0:01:16

      Average standard deviation of split frequencies: 0.015733

      190500 -- (-1322.528) (-1319.646) [-1328.789] (-1324.119) * (-1329.050) (-1326.334) [-1320.662] (-1316.788) -- 0:01:16
      191000 -- [-1318.972] (-1325.624) (-1327.778) (-1326.586) * (-1324.563) (-1324.672) (-1323.619) [-1319.675] -- 0:01:16
      191500 -- (-1322.491) (-1325.104) (-1326.986) [-1323.735] * (-1326.111) (-1322.226) (-1317.668) [-1321.537] -- 0:01:15
      192000 -- [-1323.513] (-1334.663) (-1325.830) (-1325.497) * (-1320.737) (-1327.692) [-1314.594] (-1318.818) -- 0:01:15
      192500 -- (-1330.918) (-1324.280) (-1322.167) [-1319.871] * (-1327.679) [-1318.559] (-1320.366) (-1326.777) -- 0:01:15
      193000 -- (-1320.334) [-1320.442] (-1328.933) (-1325.360) * (-1326.610) [-1320.647] (-1327.087) (-1324.692) -- 0:01:15
      193500 -- (-1321.189) [-1326.284] (-1322.397) (-1328.059) * (-1320.886) [-1322.977] (-1322.928) (-1319.285) -- 0:01:15
      194000 -- (-1326.350) (-1322.606) [-1318.943] (-1325.515) * (-1329.566) (-1323.622) (-1322.299) [-1320.826] -- 0:01:14
      194500 -- [-1325.636] (-1324.387) (-1324.757) (-1333.140) * (-1320.772) (-1328.540) (-1322.402) [-1326.388] -- 0:01:14
      195000 -- (-1318.560) (-1321.005) [-1318.689] (-1327.639) * (-1327.478) (-1321.731) (-1332.972) [-1323.983] -- 0:01:14

      Average standard deviation of split frequencies: 0.013556

      195500 -- (-1326.031) (-1327.148) [-1326.527] (-1320.884) * [-1320.183] (-1319.979) (-1322.868) (-1324.016) -- 0:01:14
      196000 -- [-1319.175] (-1327.662) (-1325.820) (-1325.265) * (-1321.482) [-1317.234] (-1330.626) (-1326.483) -- 0:01:13
      196500 -- [-1323.545] (-1321.183) (-1325.322) (-1319.010) * (-1323.404) [-1323.743] (-1331.173) (-1323.349) -- 0:01:13
      197000 -- (-1320.956) (-1321.277) (-1317.803) [-1322.987] * [-1324.769] (-1329.473) (-1326.359) (-1321.838) -- 0:01:13
      197500 -- (-1329.096) (-1319.760) [-1320.149] (-1326.828) * (-1327.512) [-1318.752] (-1329.539) (-1322.903) -- 0:01:17
      198000 -- [-1317.116] (-1324.637) (-1321.092) (-1315.696) * [-1322.507] (-1322.853) (-1327.255) (-1325.410) -- 0:01:16
      198500 -- (-1319.517) (-1326.123) [-1323.534] (-1327.342) * (-1320.583) (-1324.655) (-1323.247) [-1319.654] -- 0:01:16
      199000 -- (-1324.285) [-1324.406] (-1322.478) (-1325.135) * (-1322.408) (-1328.427) [-1318.892] (-1325.655) -- 0:01:16
      199500 -- (-1332.698) [-1323.663] (-1326.217) (-1318.931) * (-1321.520) (-1321.316) (-1321.665) [-1319.692] -- 0:01:16
      200000 -- (-1321.825) [-1315.964] (-1320.486) (-1329.550) * [-1320.770] (-1321.543) (-1336.825) (-1320.285) -- 0:01:16

      Average standard deviation of split frequencies: 0.012814

      200500 -- (-1321.412) (-1317.934) (-1318.151) [-1325.093] * (-1319.961) [-1319.577] (-1322.586) (-1317.350) -- 0:01:15
      201000 -- [-1324.120] (-1324.211) (-1321.200) (-1328.142) * (-1318.390) (-1321.672) (-1323.042) [-1323.484] -- 0:01:15
      201500 -- (-1323.219) (-1331.263) [-1322.423] (-1323.544) * (-1319.101) [-1319.950] (-1329.247) (-1330.784) -- 0:01:15
      202000 -- [-1324.134] (-1322.912) (-1323.608) (-1324.120) * (-1323.934) [-1315.766] (-1319.777) (-1324.508) -- 0:01:15
      202500 -- (-1325.692) (-1320.915) [-1320.824] (-1331.305) * [-1318.185] (-1323.985) (-1323.252) (-1326.122) -- 0:01:14
      203000 -- (-1323.257) (-1322.194) [-1319.151] (-1331.466) * (-1324.580) (-1324.529) (-1323.806) [-1322.222] -- 0:01:14
      203500 -- (-1330.336) (-1321.476) [-1317.457] (-1329.510) * (-1320.008) [-1324.735] (-1325.261) (-1318.579) -- 0:01:14
      204000 -- (-1333.425) (-1325.816) (-1319.074) [-1323.607] * (-1324.744) (-1320.153) (-1321.549) [-1318.144] -- 0:01:14
      204500 -- [-1317.167] (-1320.072) (-1322.757) (-1328.388) * (-1322.457) [-1318.473] (-1322.434) (-1323.592) -- 0:01:13
      205000 -- (-1319.118) (-1329.153) (-1314.512) [-1326.005] * [-1322.347] (-1316.722) (-1323.209) (-1327.000) -- 0:01:13

      Average standard deviation of split frequencies: 0.013730

      205500 -- (-1321.571) [-1317.718] (-1321.532) (-1322.787) * [-1322.265] (-1327.211) (-1332.052) (-1322.715) -- 0:01:13
      206000 -- (-1323.921) (-1318.808) [-1323.370] (-1323.837) * (-1326.320) (-1325.220) (-1324.245) [-1321.438] -- 0:01:13
      206500 -- (-1325.106) (-1322.058) [-1319.776] (-1328.449) * (-1323.290) [-1322.573] (-1328.978) (-1317.048) -- 0:01:13
      207000 -- (-1322.506) (-1323.800) (-1319.445) [-1318.101] * (-1332.147) [-1320.837] (-1321.387) (-1321.171) -- 0:01:12
      207500 -- (-1317.508) [-1321.960] (-1333.035) (-1332.166) * [-1323.621] (-1322.360) (-1318.402) (-1322.391) -- 0:01:12
      208000 -- (-1320.462) [-1326.337] (-1324.743) (-1326.031) * (-1322.650) (-1331.152) (-1320.055) [-1319.695] -- 0:01:12
      208500 -- (-1320.085) [-1324.916] (-1323.327) (-1317.028) * (-1325.210) [-1318.886] (-1320.814) (-1319.927) -- 0:01:12
      209000 -- (-1330.443) (-1331.864) (-1320.598) [-1326.505] * (-1322.524) [-1322.990] (-1326.574) (-1328.817) -- 0:01:15
      209500 -- [-1323.672] (-1324.002) (-1325.695) (-1327.291) * [-1323.470] (-1320.046) (-1325.757) (-1326.342) -- 0:01:15
      210000 -- (-1322.435) (-1318.473) [-1320.195] (-1319.705) * (-1323.635) (-1323.428) [-1320.418] (-1321.624) -- 0:01:15

      Average standard deviation of split frequencies: 0.012612

      210500 -- (-1328.834) (-1319.448) (-1323.676) [-1327.993] * (-1332.609) (-1320.226) (-1323.332) [-1326.027] -- 0:01:15
      211000 -- (-1332.766) (-1338.617) (-1320.533) [-1327.742] * (-1328.612) (-1321.550) (-1320.837) [-1323.763] -- 0:01:14
      211500 -- (-1323.219) (-1326.338) [-1317.699] (-1327.796) * [-1319.414] (-1321.719) (-1326.459) (-1332.531) -- 0:01:14
      212000 -- (-1327.819) (-1320.389) (-1315.552) [-1320.460] * [-1308.699] (-1323.307) (-1324.859) (-1327.875) -- 0:01:14
      212500 -- (-1321.255) [-1325.413] (-1321.657) (-1317.160) * (-1319.734) (-1325.301) [-1319.269] (-1327.958) -- 0:01:14
      213000 -- (-1321.395) (-1322.186) (-1323.495) [-1320.199] * [-1321.848] (-1322.037) (-1331.483) (-1326.466) -- 0:01:13
      213500 -- [-1323.840] (-1323.199) (-1316.616) (-1327.992) * (-1324.826) (-1317.368) [-1319.118] (-1320.655) -- 0:01:13
      214000 -- (-1321.357) [-1323.570] (-1329.215) (-1322.659) * (-1325.012) [-1322.512] (-1330.043) (-1319.237) -- 0:01:13
      214500 -- (-1323.530) (-1325.472) (-1326.455) [-1322.100] * [-1319.529] (-1322.192) (-1325.199) (-1328.015) -- 0:01:13
      215000 -- (-1324.881) (-1325.058) (-1326.344) [-1322.057] * (-1325.486) [-1320.646] (-1319.892) (-1318.803) -- 0:01:13

      Average standard deviation of split frequencies: 0.012301

      215500 -- (-1324.414) [-1323.195] (-1325.920) (-1322.207) * (-1332.408) (-1329.284) [-1319.790] (-1329.432) -- 0:01:12
      216000 -- (-1325.442) (-1325.229) (-1320.582) [-1320.920] * (-1320.382) (-1332.974) [-1319.124] (-1323.799) -- 0:01:12
      216500 -- (-1322.050) (-1327.556) (-1324.901) [-1325.575] * [-1326.693] (-1325.901) (-1326.707) (-1322.020) -- 0:01:12
      217000 -- (-1323.754) (-1323.220) [-1318.676] (-1322.583) * (-1322.630) (-1327.075) [-1316.356] (-1322.306) -- 0:01:12
      217500 -- (-1338.884) [-1327.402] (-1324.223) (-1323.615) * (-1321.451) [-1320.449] (-1324.666) (-1318.165) -- 0:01:11
      218000 -- (-1324.880) (-1325.918) [-1321.756] (-1327.168) * (-1326.457) [-1322.513] (-1325.819) (-1322.709) -- 0:01:11
      218500 -- [-1316.069] (-1341.139) (-1325.825) (-1320.788) * [-1331.875] (-1322.490) (-1319.618) (-1320.853) -- 0:01:11
      219000 -- [-1319.754] (-1326.791) (-1330.582) (-1327.103) * (-1315.575) (-1318.834) (-1319.794) [-1322.505] -- 0:01:11
      219500 -- [-1320.938] (-1319.672) (-1326.093) (-1329.980) * [-1325.244] (-1322.381) (-1320.658) (-1327.344) -- 0:01:11
      220000 -- (-1319.964) (-1320.806) (-1321.162) [-1329.897] * (-1318.981) (-1329.501) (-1318.792) [-1324.631] -- 0:01:14

      Average standard deviation of split frequencies: 0.008934

      220500 -- (-1322.768) [-1322.084] (-1325.219) (-1322.776) * (-1326.198) (-1323.718) (-1329.746) [-1328.766] -- 0:01:14
      221000 -- (-1328.732) (-1320.193) (-1326.231) [-1328.725] * [-1326.820] (-1323.911) (-1324.186) (-1325.541) -- 0:01:14
      221500 -- (-1328.355) [-1320.145] (-1320.697) (-1317.115) * (-1320.847) [-1320.362] (-1328.041) (-1320.314) -- 0:01:13
      222000 -- [-1324.919] (-1326.545) (-1324.715) (-1324.996) * (-1329.989) (-1319.967) (-1326.872) [-1325.209] -- 0:01:13
      222500 -- [-1327.053] (-1323.113) (-1335.704) (-1333.421) * (-1332.461) (-1320.873) (-1313.470) [-1319.785] -- 0:01:13
      223000 -- [-1320.885] (-1323.475) (-1332.961) (-1322.390) * (-1319.842) (-1325.172) (-1329.041) [-1321.414] -- 0:01:13
      223500 -- (-1321.377) (-1324.535) (-1321.861) [-1320.817] * (-1317.003) (-1320.423) [-1320.823] (-1329.713) -- 0:01:12
      224000 -- (-1329.233) (-1329.570) [-1322.049] (-1322.554) * (-1324.225) (-1320.523) [-1319.205] (-1330.751) -- 0:01:12
      224500 -- (-1327.396) [-1316.913] (-1323.534) (-1329.001) * (-1320.199) (-1318.421) [-1323.187] (-1324.007) -- 0:01:12
      225000 -- (-1320.214) [-1321.132] (-1328.978) (-1326.670) * [-1321.198] (-1323.454) (-1320.185) (-1326.197) -- 0:01:12

      Average standard deviation of split frequencies: 0.010998

      225500 -- (-1322.631) (-1324.056) [-1319.022] (-1323.296) * (-1326.320) (-1326.063) [-1316.618] (-1324.977) -- 0:01:12
      226000 -- (-1322.252) (-1323.541) [-1320.965] (-1316.847) * (-1330.284) (-1317.922) (-1320.281) [-1323.914] -- 0:01:11
      226500 -- (-1325.516) [-1317.901] (-1327.409) (-1322.742) * (-1326.362) (-1321.082) (-1322.763) [-1321.743] -- 0:01:11
      227000 -- (-1321.400) (-1318.936) [-1318.378] (-1326.492) * [-1329.349] (-1321.675) (-1322.213) (-1326.135) -- 0:01:11
      227500 -- (-1320.445) [-1320.976] (-1328.798) (-1327.839) * [-1322.600] (-1320.368) (-1324.044) (-1324.196) -- 0:01:11
      228000 -- (-1321.775) [-1320.530] (-1325.100) (-1323.500) * [-1324.707] (-1318.442) (-1329.727) (-1322.401) -- 0:01:11
      228500 -- (-1325.523) [-1321.091] (-1319.551) (-1328.697) * (-1322.131) [-1320.649] (-1329.958) (-1323.878) -- 0:01:10
      229000 -- (-1328.327) (-1319.917) (-1323.496) [-1315.633] * (-1323.360) (-1327.731) [-1322.367] (-1322.890) -- 0:01:10
      229500 -- (-1323.780) (-1321.134) [-1320.040] (-1325.517) * [-1318.665] (-1324.256) (-1326.621) (-1325.074) -- 0:01:10
      230000 -- (-1326.551) (-1330.830) (-1324.046) [-1322.901] * (-1323.533) (-1323.696) [-1325.123] (-1321.618) -- 0:01:10

      Average standard deviation of split frequencies: 0.010033

      230500 -- (-1325.395) [-1320.751] (-1331.264) (-1324.816) * (-1320.953) [-1319.223] (-1323.894) (-1318.716) -- 0:01:10
      231000 -- (-1320.157) (-1319.275) [-1319.214] (-1327.920) * (-1323.013) (-1326.229) [-1321.333] (-1317.447) -- 0:01:13
      231500 -- (-1325.951) [-1322.420] (-1328.808) (-1326.110) * (-1322.365) (-1327.197) [-1323.834] (-1320.051) -- 0:01:13
      232000 -- (-1327.144) (-1323.859) [-1327.890] (-1328.665) * [-1319.627] (-1330.327) (-1322.185) (-1325.473) -- 0:01:12
      232500 -- (-1329.693) (-1314.476) [-1325.607] (-1327.524) * (-1322.512) (-1321.661) (-1329.057) [-1325.462] -- 0:01:12
      233000 -- (-1318.299) (-1318.384) (-1318.750) [-1322.891] * [-1317.549] (-1328.339) (-1319.117) (-1329.656) -- 0:01:12
      233500 -- (-1321.705) (-1324.817) [-1318.657] (-1323.526) * [-1321.251] (-1324.406) (-1319.929) (-1320.494) -- 0:01:12
      234000 -- (-1322.247) [-1316.479] (-1325.677) (-1328.314) * (-1324.049) [-1319.667] (-1326.791) (-1320.259) -- 0:01:12
      234500 -- [-1319.143] (-1328.473) (-1323.214) (-1323.928) * [-1322.953] (-1319.655) (-1319.104) (-1327.261) -- 0:01:11
      235000 -- (-1324.379) [-1322.345] (-1320.490) (-1327.572) * (-1321.978) (-1320.284) (-1322.985) [-1318.872] -- 0:01:11

      Average standard deviation of split frequencies: 0.010169

      235500 -- [-1324.688] (-1320.493) (-1318.904) (-1323.260) * (-1329.059) (-1318.568) (-1322.421) [-1318.838] -- 0:01:11
      236000 -- (-1329.139) (-1331.386) [-1316.770] (-1324.267) * [-1324.911] (-1318.494) (-1320.601) (-1316.845) -- 0:01:11
      236500 -- (-1323.977) [-1326.100] (-1331.272) (-1332.723) * (-1324.639) (-1327.274) (-1319.036) [-1323.687] -- 0:01:11
      237000 -- [-1320.374] (-1326.412) (-1342.466) (-1324.113) * (-1322.144) (-1321.035) [-1320.431] (-1320.603) -- 0:01:10
      237500 -- (-1326.204) (-1325.016) [-1323.893] (-1328.566) * [-1318.369] (-1325.261) (-1322.494) (-1319.439) -- 0:01:10
      238000 -- (-1325.978) [-1318.771] (-1325.850) (-1328.886) * (-1324.136) [-1321.526] (-1326.747) (-1318.530) -- 0:01:10
      238500 -- [-1318.023] (-1318.706) (-1329.524) (-1325.297) * [-1324.019] (-1323.272) (-1318.740) (-1321.389) -- 0:01:10
      239000 -- (-1316.219) (-1332.321) (-1323.930) [-1322.193] * [-1315.588] (-1323.831) (-1328.779) (-1323.838) -- 0:01:10
      239500 -- [-1321.757] (-1322.942) (-1321.829) (-1332.304) * (-1321.453) (-1319.441) [-1320.505] (-1331.792) -- 0:01:09
      240000 -- (-1325.152) (-1320.517) [-1318.270] (-1325.537) * (-1325.953) [-1320.259] (-1325.933) (-1319.579) -- 0:01:09

      Average standard deviation of split frequencies: 0.010328

      240500 -- (-1322.410) [-1319.872] (-1321.834) (-1328.698) * (-1328.290) (-1320.154) [-1321.601] (-1315.536) -- 0:01:09
      241000 -- (-1320.516) (-1319.016) [-1316.539] (-1323.255) * [-1322.287] (-1322.386) (-1326.032) (-1321.449) -- 0:01:09
      241500 -- (-1326.533) (-1318.990) (-1326.837) [-1326.529] * (-1318.098) [-1324.497] (-1327.972) (-1328.142) -- 0:01:09
      242000 -- (-1322.695) (-1317.671) [-1322.186] (-1326.443) * (-1325.188) [-1323.334] (-1321.737) (-1320.615) -- 0:01:12
      242500 -- (-1325.455) [-1318.261] (-1329.888) (-1320.806) * (-1329.512) [-1326.536] (-1328.010) (-1318.752) -- 0:01:11
      243000 -- (-1331.416) [-1318.830] (-1324.492) (-1326.747) * (-1323.556) (-1325.228) (-1319.918) [-1320.337] -- 0:01:11
      243500 -- (-1329.307) [-1326.596] (-1324.589) (-1323.746) * (-1320.369) [-1322.841] (-1323.556) (-1323.398) -- 0:01:11
      244000 -- [-1316.240] (-1326.078) (-1321.740) (-1318.637) * (-1324.028) (-1321.653) (-1326.039) [-1326.120] -- 0:01:11
      244500 -- (-1316.527) (-1322.973) (-1323.850) [-1321.318] * (-1317.410) (-1317.952) (-1327.786) [-1324.845] -- 0:01:11
      245000 -- (-1318.711) (-1325.069) (-1316.658) [-1326.488] * [-1327.771] (-1324.519) (-1338.393) (-1320.099) -- 0:01:10

      Average standard deviation of split frequencies: 0.011498

      245500 -- [-1327.779] (-1321.934) (-1318.287) (-1330.209) * (-1319.072) (-1318.273) [-1322.296] (-1325.803) -- 0:01:10
      246000 -- [-1324.635] (-1321.547) (-1322.000) (-1327.372) * (-1320.908) (-1331.012) [-1315.411] (-1322.655) -- 0:01:10
      246500 -- (-1329.927) (-1323.842) (-1317.749) [-1317.498] * (-1319.995) (-1321.091) (-1323.097) [-1318.678] -- 0:01:10
      247000 -- (-1325.759) [-1317.251] (-1328.411) (-1327.904) * [-1322.232] (-1325.477) (-1320.349) (-1327.666) -- 0:01:10
      247500 -- (-1322.457) (-1321.375) (-1322.461) [-1320.241] * (-1329.280) (-1316.731) [-1319.023] (-1323.330) -- 0:01:09
      248000 -- [-1330.195] (-1317.194) (-1322.368) (-1320.408) * (-1324.274) (-1318.039) [-1320.633] (-1322.988) -- 0:01:09
      248500 -- [-1321.094] (-1323.624) (-1322.486) (-1322.165) * [-1319.683] (-1320.060) (-1319.560) (-1327.254) -- 0:01:09
      249000 -- (-1325.652) [-1321.618] (-1320.833) (-1325.069) * (-1319.624) (-1318.595) [-1324.987] (-1326.357) -- 0:01:09
      249500 -- (-1328.161) [-1320.946] (-1321.776) (-1325.946) * [-1319.929] (-1325.074) (-1329.784) (-1323.627) -- 0:01:09
      250000 -- (-1322.187) (-1317.115) (-1327.304) [-1320.331] * [-1321.548] (-1328.213) (-1325.048) (-1320.506) -- 0:01:09

      Average standard deviation of split frequencies: 0.011284

      250500 -- (-1330.102) (-1322.151) [-1313.331] (-1320.310) * (-1322.485) (-1321.104) [-1321.440] (-1330.115) -- 0:01:08
      251000 -- (-1330.779) [-1320.260] (-1317.987) (-1324.352) * [-1321.485] (-1324.160) (-1318.907) (-1319.922) -- 0:01:08
      251500 -- [-1320.338] (-1323.634) (-1323.314) (-1323.645) * (-1325.482) (-1320.022) [-1322.554] (-1326.405) -- 0:01:08
      252000 -- (-1321.281) [-1323.118] (-1320.859) (-1321.443) * (-1324.410) (-1326.318) [-1321.872] (-1321.811) -- 0:01:08
      252500 -- (-1330.151) [-1320.430] (-1321.322) (-1324.186) * (-1318.474) (-1324.065) [-1322.749] (-1328.259) -- 0:01:08
      253000 -- (-1327.813) (-1326.313) [-1316.148] (-1329.120) * (-1321.499) (-1323.780) (-1325.718) [-1319.166] -- 0:01:10
      253500 -- [-1319.902] (-1314.267) (-1319.175) (-1318.380) * (-1321.119) [-1321.132] (-1326.815) (-1322.208) -- 0:01:10
      254000 -- (-1333.133) (-1318.494) [-1321.789] (-1325.065) * [-1322.815] (-1324.344) (-1321.704) (-1328.374) -- 0:01:10
      254500 -- (-1326.977) (-1326.136) [-1331.532] (-1323.115) * (-1328.892) (-1326.121) [-1323.974] (-1330.867) -- 0:01:10
      255000 -- (-1326.736) (-1327.162) [-1320.794] (-1324.082) * (-1330.442) [-1324.546] (-1326.088) (-1319.208) -- 0:01:10

      Average standard deviation of split frequencies: 0.012388

      255500 -- (-1322.903) (-1326.554) [-1316.470] (-1318.583) * (-1325.771) (-1326.976) [-1322.115] (-1321.013) -- 0:01:09
      256000 -- (-1322.963) [-1322.665] (-1317.924) (-1319.615) * [-1326.677] (-1328.330) (-1326.647) (-1321.230) -- 0:01:09
      256500 -- (-1321.132) (-1322.239) [-1326.097] (-1322.726) * (-1328.593) [-1319.639] (-1322.184) (-1319.769) -- 0:01:09
      257000 -- (-1322.945) [-1323.562] (-1322.877) (-1327.510) * (-1325.985) [-1325.722] (-1321.380) (-1324.967) -- 0:01:09
      257500 -- (-1314.796) (-1321.529) (-1317.592) [-1315.986] * (-1323.693) (-1323.496) (-1320.465) [-1316.721] -- 0:01:09
      258000 -- (-1326.055) (-1325.125) (-1319.431) [-1317.734] * [-1317.557] (-1326.056) (-1325.995) (-1326.887) -- 0:01:09
      258500 -- (-1325.017) [-1327.898] (-1319.923) (-1320.510) * [-1322.730] (-1324.610) (-1321.010) (-1319.810) -- 0:01:08
      259000 -- (-1322.350) [-1324.289] (-1324.602) (-1321.106) * (-1325.000) (-1327.490) (-1329.388) [-1317.865] -- 0:01:08
      259500 -- (-1326.237) (-1322.132) [-1320.101] (-1325.706) * (-1325.762) [-1319.748] (-1325.627) (-1316.756) -- 0:01:08
      260000 -- (-1328.095) (-1322.820) [-1319.814] (-1320.689) * (-1322.785) [-1324.522] (-1319.279) (-1325.953) -- 0:01:08

      Average standard deviation of split frequencies: 0.012824

      260500 -- [-1320.958] (-1322.456) (-1319.823) (-1325.223) * (-1323.253) (-1322.159) (-1331.374) [-1324.648] -- 0:01:08
      261000 -- (-1321.459) (-1330.637) (-1314.237) [-1323.622] * (-1324.063) [-1318.100] (-1320.892) (-1324.556) -- 0:01:07
      261500 -- [-1328.953] (-1324.450) (-1319.009) (-1319.158) * (-1323.560) (-1319.725) (-1321.913) [-1318.159] -- 0:01:07
      262000 -- (-1328.413) (-1322.970) (-1320.118) [-1320.797] * [-1321.814] (-1323.037) (-1329.574) (-1323.482) -- 0:01:07
      262500 -- (-1320.974) (-1319.639) (-1324.282) [-1315.715] * (-1318.897) (-1328.396) (-1325.089) [-1319.113] -- 0:01:07
      263000 -- [-1320.243] (-1323.452) (-1330.065) (-1330.080) * [-1330.055] (-1323.942) (-1326.311) (-1328.502) -- 0:01:07
      263500 -- (-1320.359) [-1323.831] (-1320.169) (-1322.917) * [-1321.220] (-1319.888) (-1326.606) (-1322.821) -- 0:01:09
      264000 -- (-1325.018) [-1324.200] (-1327.493) (-1326.032) * [-1317.594] (-1320.732) (-1323.525) (-1325.214) -- 0:01:09
      264500 -- (-1325.603) [-1321.942] (-1320.003) (-1322.358) * (-1322.270) (-1326.092) (-1321.801) [-1319.931] -- 0:01:09
      265000 -- (-1321.287) (-1331.604) [-1326.155] (-1325.854) * (-1329.594) [-1323.620] (-1328.260) (-1321.455) -- 0:01:09

      Average standard deviation of split frequencies: 0.013211

      265500 -- [-1323.517] (-1329.401) (-1320.492) (-1326.684) * (-1318.517) (-1321.634) (-1328.565) [-1324.126] -- 0:01:09
      266000 -- (-1335.713) (-1330.187) [-1322.057] (-1324.237) * (-1321.367) (-1330.349) [-1321.723] (-1322.220) -- 0:01:08
      266500 -- [-1319.665] (-1327.100) (-1324.764) (-1320.766) * (-1329.990) (-1321.583) (-1331.778) [-1322.408] -- 0:01:08
      267000 -- (-1321.373) [-1319.944] (-1317.615) (-1320.902) * [-1316.797] (-1326.406) (-1330.523) (-1319.191) -- 0:01:08
      267500 -- (-1321.116) [-1326.323] (-1325.782) (-1325.287) * (-1322.203) (-1321.487) (-1324.424) [-1322.676] -- 0:01:08
      268000 -- [-1324.979] (-1321.157) (-1325.516) (-1324.036) * (-1323.840) (-1321.259) (-1321.927) [-1319.346] -- 0:01:08
      268500 -- [-1318.397] (-1318.658) (-1330.771) (-1326.798) * (-1322.245) [-1319.450] (-1323.072) (-1332.158) -- 0:01:08
      269000 -- (-1325.698) [-1321.632] (-1331.054) (-1325.041) * (-1329.602) [-1324.382] (-1320.982) (-1317.230) -- 0:01:07
      269500 -- (-1326.451) (-1331.944) (-1321.353) [-1320.574] * (-1328.863) [-1322.593] (-1324.815) (-1328.955) -- 0:01:07
      270000 -- (-1326.831) [-1324.534] (-1321.903) (-1322.332) * (-1332.002) (-1325.079) (-1330.892) [-1316.539] -- 0:01:07

      Average standard deviation of split frequencies: 0.012666

      270500 -- (-1333.110) (-1324.490) [-1323.354] (-1323.247) * [-1321.159] (-1323.236) (-1321.481) (-1327.002) -- 0:01:07
      271000 -- (-1324.210) (-1323.127) [-1318.695] (-1324.202) * (-1319.295) (-1321.059) [-1323.070] (-1325.736) -- 0:01:07
      271500 -- (-1322.369) [-1318.185] (-1325.788) (-1324.148) * (-1317.005) (-1322.303) [-1325.830] (-1327.208) -- 0:01:07
      272000 -- (-1327.607) [-1330.873] (-1325.288) (-1322.329) * (-1325.989) (-1319.965) [-1327.353] (-1327.857) -- 0:01:06
      272500 -- (-1322.752) (-1320.053) (-1323.640) [-1318.532] * (-1317.551) (-1322.817) (-1329.529) [-1321.504] -- 0:01:06
      273000 -- (-1324.126) (-1326.913) (-1323.263) [-1318.618] * (-1322.803) [-1322.833] (-1324.995) (-1321.167) -- 0:01:09
      273500 -- [-1328.489] (-1321.214) (-1329.893) (-1325.269) * [-1326.728] (-1322.427) (-1324.609) (-1325.957) -- 0:01:09
      274000 -- (-1324.104) [-1322.625] (-1326.575) (-1319.607) * (-1323.976) (-1331.408) (-1322.661) [-1323.743] -- 0:01:08
      274500 -- [-1327.061] (-1323.283) (-1329.254) (-1317.377) * (-1325.773) [-1321.643] (-1320.646) (-1325.763) -- 0:01:08
      275000 -- (-1325.071) (-1319.347) [-1322.153] (-1324.517) * (-1332.412) [-1322.899] (-1330.088) (-1326.420) -- 0:01:08

      Average standard deviation of split frequencies: 0.013353

      275500 -- (-1320.565) (-1322.760) (-1325.037) [-1326.401] * (-1321.372) [-1326.224] (-1328.335) (-1324.544) -- 0:01:08
      276000 -- (-1323.346) [-1317.850] (-1321.884) (-1328.175) * (-1320.362) (-1328.464) [-1318.986] (-1324.720) -- 0:01:08
      276500 -- (-1321.956) [-1322.906] (-1315.082) (-1326.805) * (-1326.470) (-1321.361) [-1318.594] (-1325.442) -- 0:01:08
      277000 -- (-1326.307) (-1321.856) [-1328.353] (-1324.824) * [-1317.579] (-1328.646) (-1321.028) (-1319.186) -- 0:01:07
      277500 -- (-1324.728) [-1324.132] (-1325.060) (-1333.157) * (-1330.736) (-1330.283) (-1320.420) [-1320.589] -- 0:01:07
      278000 -- (-1318.417) (-1324.216) [-1323.841] (-1329.569) * (-1321.126) [-1329.196] (-1326.673) (-1320.639) -- 0:01:07
      278500 -- (-1321.793) (-1320.760) (-1320.391) [-1325.746] * (-1324.847) (-1322.506) [-1316.617] (-1320.215) -- 0:01:07
      279000 -- (-1319.877) (-1323.598) [-1322.084] (-1327.802) * (-1319.578) (-1327.303) (-1319.406) [-1328.329] -- 0:01:07
      279500 -- (-1323.331) (-1322.193) (-1321.237) [-1328.468] * (-1323.597) (-1328.786) [-1321.893] (-1327.227) -- 0:01:07
      280000 -- (-1321.792) (-1318.152) (-1331.249) [-1322.196] * (-1329.569) (-1321.733) (-1325.618) [-1322.117] -- 0:01:06

      Average standard deviation of split frequencies: 0.013742

      280500 -- (-1317.519) [-1320.706] (-1325.292) (-1318.428) * (-1327.148) (-1322.128) [-1323.241] (-1322.301) -- 0:01:06
      281000 -- [-1318.334] (-1320.566) (-1329.015) (-1326.404) * (-1328.063) (-1323.728) [-1323.617] (-1330.015) -- 0:01:06
      281500 -- [-1323.017] (-1324.424) (-1327.318) (-1320.831) * (-1321.272) (-1326.437) [-1321.323] (-1327.385) -- 0:01:06
      282000 -- (-1328.595) (-1324.964) [-1319.026] (-1322.789) * (-1318.016) (-1327.704) (-1329.405) [-1317.090] -- 0:01:06
      282500 -- (-1325.781) [-1318.030] (-1319.865) (-1323.342) * (-1323.173) (-1329.689) [-1325.270] (-1323.101) -- 0:01:06
      283000 -- [-1324.860] (-1318.694) (-1321.798) (-1329.631) * (-1331.939) [-1321.532] (-1323.790) (-1322.804) -- 0:01:08
      283500 -- (-1327.263) [-1320.349] (-1320.610) (-1329.457) * (-1329.117) (-1322.936) (-1324.283) [-1323.501] -- 0:01:08
      284000 -- (-1329.071) (-1328.770) [-1322.010] (-1328.698) * (-1324.225) (-1328.862) [-1316.292] (-1322.534) -- 0:01:08
      284500 -- [-1326.182] (-1324.198) (-1323.546) (-1327.002) * (-1326.878) (-1317.557) (-1333.855) [-1323.141] -- 0:01:07
      285000 -- [-1322.288] (-1323.567) (-1322.027) (-1320.342) * (-1324.927) [-1315.892] (-1319.208) (-1320.423) -- 0:01:07

      Average standard deviation of split frequencies: 0.013186

      285500 -- (-1321.905) (-1324.681) (-1323.934) [-1322.802] * (-1324.955) (-1324.255) [-1324.345] (-1326.198) -- 0:01:07
      286000 -- (-1328.576) [-1318.444] (-1323.851) (-1322.040) * (-1330.728) [-1323.399] (-1319.859) (-1329.122) -- 0:01:07
      286500 -- (-1324.139) (-1317.696) [-1321.912] (-1315.986) * (-1322.206) (-1325.841) [-1321.304] (-1326.565) -- 0:01:07
      287000 -- [-1319.759] (-1323.952) (-1327.190) (-1331.189) * (-1324.965) (-1321.864) [-1325.339] (-1325.791) -- 0:01:07
      287500 -- (-1319.593) [-1326.665] (-1323.946) (-1323.636) * (-1331.790) [-1325.693] (-1323.916) (-1323.051) -- 0:01:06
      288000 -- (-1326.654) (-1326.335) [-1323.210] (-1331.762) * (-1322.546) [-1330.845] (-1321.059) (-1327.792) -- 0:01:06
      288500 -- (-1324.695) [-1319.245] (-1338.595) (-1326.820) * (-1320.306) (-1320.447) (-1325.263) [-1316.025] -- 0:01:06
      289000 -- (-1326.343) [-1329.865] (-1325.681) (-1323.350) * (-1318.190) (-1322.050) (-1323.988) [-1321.964] -- 0:01:06
      289500 -- (-1319.648) (-1323.571) (-1329.466) [-1319.035] * (-1328.197) [-1318.290] (-1319.374) (-1328.348) -- 0:01:06
      290000 -- [-1325.256] (-1317.371) (-1323.347) (-1324.034) * (-1331.660) (-1329.453) [-1320.478] (-1322.759) -- 0:01:06

      Average standard deviation of split frequencies: 0.014449

      290500 -- (-1321.900) (-1324.810) (-1328.963) [-1318.648] * (-1324.254) [-1322.357] (-1327.049) (-1321.289) -- 0:01:05
      291000 -- [-1334.350] (-1326.987) (-1326.028) (-1324.949) * (-1320.953) (-1320.649) [-1321.868] (-1324.587) -- 0:01:05
      291500 -- (-1322.693) (-1319.709) [-1320.913] (-1327.903) * (-1328.269) (-1319.627) (-1322.445) [-1319.252] -- 0:01:05
      292000 -- [-1318.424] (-1325.123) (-1324.998) (-1325.508) * (-1326.952) [-1318.837] (-1326.451) (-1325.364) -- 0:01:05
      292500 -- [-1324.189] (-1317.420) (-1322.563) (-1327.385) * (-1325.476) (-1324.887) (-1332.163) [-1320.830] -- 0:01:05
      293000 -- (-1316.293) [-1326.807] (-1325.138) (-1321.268) * [-1325.805] (-1334.475) (-1320.177) (-1333.028) -- 0:01:05
      293500 -- (-1326.966) (-1330.287) [-1319.258] (-1323.015) * (-1322.273) [-1324.556] (-1326.265) (-1329.443) -- 0:01:04
      294000 -- [-1317.781] (-1324.578) (-1326.584) (-1328.437) * (-1326.720) (-1321.832) (-1329.783) [-1321.148] -- 0:01:07
      294500 -- (-1328.284) (-1323.928) (-1327.035) [-1319.053] * (-1330.301) [-1322.364] (-1324.957) (-1317.995) -- 0:01:07
      295000 -- [-1324.505] (-1319.294) (-1327.159) (-1322.068) * (-1316.910) [-1329.687] (-1323.362) (-1328.258) -- 0:01:06

      Average standard deviation of split frequencies: 0.013899

      295500 -- [-1319.969] (-1318.183) (-1325.606) (-1323.229) * (-1320.355) [-1324.298] (-1316.897) (-1324.696) -- 0:01:06
      296000 -- (-1324.637) (-1326.417) [-1320.054] (-1321.498) * [-1318.863] (-1329.081) (-1322.700) (-1325.126) -- 0:01:06
      296500 -- [-1319.873] (-1323.422) (-1327.456) (-1326.579) * (-1329.975) (-1318.333) [-1318.762] (-1321.837) -- 0:01:06
      297000 -- (-1324.101) (-1325.225) (-1323.176) [-1318.911] * [-1315.693] (-1322.223) (-1328.243) (-1325.726) -- 0:01:06
      297500 -- (-1322.875) (-1331.428) (-1325.313) [-1318.079] * [-1322.492] (-1315.251) (-1321.787) (-1328.489) -- 0:01:06
      298000 -- (-1321.252) (-1328.891) [-1319.380] (-1321.491) * [-1319.645] (-1325.310) (-1332.083) (-1328.067) -- 0:01:05
      298500 -- [-1319.614] (-1331.459) (-1323.451) (-1329.504) * [-1322.344] (-1316.596) (-1317.967) (-1321.769) -- 0:01:05
      299000 -- [-1321.721] (-1331.126) (-1324.060) (-1326.198) * (-1325.290) (-1321.159) [-1320.409] (-1323.906) -- 0:01:05
      299500 -- [-1318.244] (-1318.089) (-1321.730) (-1327.514) * (-1327.014) (-1321.781) (-1329.908) [-1326.231] -- 0:01:05
      300000 -- [-1316.803] (-1325.978) (-1322.409) (-1324.100) * [-1323.786] (-1324.834) (-1329.789) (-1329.978) -- 0:01:05

      Average standard deviation of split frequencies: 0.013968

      300500 -- (-1328.152) [-1325.039] (-1324.889) (-1325.849) * (-1321.211) (-1330.224) (-1325.454) [-1319.917] -- 0:01:05
      301000 -- (-1324.727) (-1316.459) [-1324.988] (-1328.654) * [-1318.998] (-1324.062) (-1321.892) (-1322.589) -- 0:01:05
      301500 -- (-1320.328) (-1321.882) (-1322.630) [-1323.137] * (-1317.450) [-1324.263] (-1319.985) (-1325.042) -- 0:01:04
      302000 -- (-1319.334) [-1317.806] (-1326.072) (-1331.487) * [-1321.299] (-1320.166) (-1331.966) (-1323.316) -- 0:01:04
      302500 -- (-1316.534) (-1319.473) (-1323.963) [-1319.245] * (-1321.812) (-1317.579) [-1318.269] (-1316.120) -- 0:01:04
      303000 -- (-1328.092) (-1321.808) [-1327.515] (-1326.564) * (-1321.685) [-1317.113] (-1322.578) (-1320.698) -- 0:01:04
      303500 -- (-1326.044) [-1321.051] (-1325.034) (-1317.060) * (-1323.549) [-1322.784] (-1323.560) (-1321.959) -- 0:01:04
      304000 -- (-1321.397) (-1323.094) (-1331.513) [-1318.023] * [-1321.971] (-1320.482) (-1321.153) (-1318.367) -- 0:01:04
      304500 -- (-1324.978) (-1317.578) [-1332.427] (-1330.734) * (-1325.778) (-1317.439) (-1318.100) [-1324.663] -- 0:01:03
      305000 -- (-1324.443) (-1322.044) [-1320.663] (-1320.330) * [-1325.570] (-1323.691) (-1331.108) (-1328.349) -- 0:01:06

      Average standard deviation of split frequencies: 0.013165

      305500 -- (-1322.661) (-1321.705) (-1324.820) [-1321.200] * (-1323.322) (-1324.710) (-1324.643) [-1322.435] -- 0:01:05
      306000 -- (-1329.625) (-1318.407) (-1319.407) [-1326.052] * (-1325.465) [-1325.780] (-1329.596) (-1325.159) -- 0:01:05
      306500 -- (-1317.596) (-1317.523) [-1326.251] (-1331.563) * (-1321.727) (-1320.135) (-1333.289) [-1319.389] -- 0:01:05
      307000 -- [-1324.218] (-1320.986) (-1328.858) (-1321.943) * (-1323.542) (-1326.717) [-1316.664] (-1324.857) -- 0:01:05
      307500 -- (-1324.797) (-1325.361) [-1321.012] (-1324.562) * (-1328.687) (-1325.634) (-1327.964) [-1321.727] -- 0:01:05
      308000 -- [-1322.104] (-1324.750) (-1321.569) (-1321.795) * (-1321.363) [-1317.984] (-1322.202) (-1323.315) -- 0:01:05
      308500 -- (-1323.891) (-1319.954) (-1323.452) [-1319.883] * (-1323.514) (-1337.793) (-1329.435) [-1324.220] -- 0:01:05
      309000 -- [-1323.147] (-1331.623) (-1322.493) (-1326.287) * (-1327.106) [-1319.151] (-1333.197) (-1324.257) -- 0:01:04
      309500 -- (-1318.296) (-1326.241) [-1326.591] (-1319.363) * (-1326.271) (-1319.647) [-1321.347] (-1320.440) -- 0:01:04
      310000 -- (-1320.414) [-1321.664] (-1324.574) (-1329.439) * (-1323.645) [-1327.527] (-1322.153) (-1325.937) -- 0:01:04

      Average standard deviation of split frequencies: 0.013795

      310500 -- (-1323.356) (-1322.198) (-1323.597) [-1318.083] * (-1330.216) (-1325.255) [-1323.112] (-1325.830) -- 0:01:04
      311000 -- (-1322.041) (-1326.780) (-1321.991) [-1320.233] * (-1324.683) [-1320.112] (-1330.822) (-1321.867) -- 0:01:04
      311500 -- (-1325.938) (-1326.050) (-1320.522) [-1316.996] * [-1323.544] (-1320.236) (-1328.469) (-1333.337) -- 0:01:04
      312000 -- (-1321.043) (-1323.459) (-1323.654) [-1326.434] * (-1326.715) (-1321.385) [-1314.573] (-1321.607) -- 0:01:03
      312500 -- (-1323.458) (-1325.081) [-1318.408] (-1323.104) * [-1324.487] (-1323.259) (-1324.313) (-1325.012) -- 0:01:03
      313000 -- [-1325.460] (-1323.094) (-1326.651) (-1321.954) * (-1323.134) [-1322.465] (-1320.027) (-1317.524) -- 0:01:03
      313500 -- (-1327.037) (-1325.275) (-1325.808) [-1323.131] * [-1319.235] (-1324.310) (-1322.215) (-1326.366) -- 0:01:03
      314000 -- (-1321.713) [-1320.578] (-1319.986) (-1319.400) * [-1322.419] (-1323.366) (-1327.186) (-1324.625) -- 0:01:03
      314500 -- (-1331.924) (-1323.978) (-1321.648) [-1320.575] * (-1325.925) (-1324.810) [-1321.012] (-1322.330) -- 0:01:03
      315000 -- (-1332.822) [-1316.103] (-1313.718) (-1320.681) * (-1333.947) (-1323.558) [-1316.486] (-1326.913) -- 0:01:03

      Average standard deviation of split frequencies: 0.013833

      315500 -- (-1322.508) (-1320.001) (-1323.081) [-1321.124] * (-1321.661) (-1323.535) [-1322.462] (-1331.458) -- 0:01:02
      316000 -- (-1324.307) (-1320.449) (-1323.947) [-1317.694] * (-1325.157) (-1329.748) (-1329.358) [-1321.281] -- 0:01:04
      316500 -- [-1319.757] (-1324.102) (-1329.421) (-1336.357) * (-1327.708) (-1325.266) (-1325.569) [-1322.997] -- 0:01:04
      317000 -- (-1325.437) [-1319.971] (-1323.429) (-1316.151) * (-1316.399) (-1322.290) [-1322.673] (-1319.835) -- 0:01:04
      317500 -- (-1325.496) (-1330.431) [-1319.929] (-1320.137) * (-1330.245) [-1323.120] (-1320.408) (-1321.293) -- 0:01:04
      318000 -- (-1320.756) [-1319.578] (-1329.737) (-1325.426) * (-1324.602) (-1323.451) (-1323.370) [-1321.576] -- 0:01:04
      318500 -- (-1323.806) (-1324.544) [-1322.333] (-1324.907) * (-1323.869) [-1322.636] (-1328.427) (-1324.264) -- 0:01:04
      319000 -- [-1315.804] (-1327.539) (-1322.198) (-1322.177) * (-1329.147) [-1322.617] (-1329.572) (-1325.465) -- 0:01:04
      319500 -- (-1316.551) (-1321.368) (-1315.809) [-1319.258] * (-1320.573) (-1323.928) (-1323.792) [-1327.808] -- 0:01:03
      320000 -- (-1329.334) [-1321.301] (-1323.285) (-1316.086) * [-1325.137] (-1320.172) (-1319.706) (-1326.761) -- 0:01:03

      Average standard deviation of split frequencies: 0.013097

      320500 -- [-1319.956] (-1320.749) (-1324.379) (-1321.362) * (-1324.869) (-1327.473) (-1319.817) [-1325.637] -- 0:01:03
      321000 -- (-1326.009) (-1322.327) (-1321.485) [-1318.616] * (-1326.355) (-1331.051) [-1317.473] (-1320.654) -- 0:01:03
      321500 -- (-1320.197) (-1321.647) [-1318.657] (-1326.707) * (-1325.483) (-1319.727) [-1323.842] (-1324.348) -- 0:01:03
      322000 -- (-1321.355) (-1323.803) [-1323.595] (-1318.121) * (-1323.692) (-1322.571) (-1329.835) [-1321.250] -- 0:01:03
      322500 -- (-1327.445) (-1324.135) [-1318.537] (-1322.590) * (-1329.310) [-1323.285] (-1319.089) (-1330.851) -- 0:01:03
      323000 -- (-1323.054) (-1323.594) [-1323.681] (-1319.753) * (-1322.692) (-1320.823) (-1318.321) [-1321.215] -- 0:01:02
      323500 -- (-1323.178) [-1318.124] (-1326.495) (-1323.732) * (-1327.946) (-1322.776) (-1324.649) [-1333.741] -- 0:01:02
      324000 -- (-1323.055) (-1323.329) [-1321.761] (-1329.242) * (-1319.734) (-1327.273) [-1317.625] (-1326.670) -- 0:01:02
      324500 -- (-1331.522) [-1323.768] (-1317.070) (-1323.151) * (-1329.018) (-1316.492) [-1317.409] (-1317.709) -- 0:01:02
      325000 -- [-1330.240] (-1326.458) (-1329.477) (-1321.893) * (-1323.888) [-1322.836] (-1326.227) (-1322.358) -- 0:01:02

      Average standard deviation of split frequencies: 0.012357

      325500 -- (-1327.651) [-1317.032] (-1323.998) (-1322.084) * (-1321.386) (-1321.367) [-1326.986] (-1322.450) -- 0:01:02
      326000 -- [-1320.942] (-1317.079) (-1318.390) (-1320.036) * [-1321.491] (-1322.223) (-1323.018) (-1319.514) -- 0:01:02
      326500 -- (-1317.175) [-1318.277] (-1326.885) (-1325.283) * (-1322.261) [-1321.973] (-1320.668) (-1325.124) -- 0:01:01
      327000 -- (-1325.929) (-1320.307) (-1328.962) [-1329.755] * (-1322.857) [-1322.370] (-1328.047) (-1325.461) -- 0:01:03
      327500 -- [-1315.959] (-1320.976) (-1336.870) (-1325.179) * (-1336.482) (-1330.312) (-1331.214) [-1328.301] -- 0:01:03
      328000 -- (-1324.536) (-1325.215) [-1323.524] (-1321.565) * (-1319.227) (-1325.633) [-1318.821] (-1322.371) -- 0:01:03
      328500 -- (-1323.426) (-1323.927) (-1319.562) [-1322.315] * (-1321.734) (-1321.320) (-1328.719) [-1322.194] -- 0:01:03
      329000 -- (-1329.166) [-1321.861] (-1318.610) (-1329.671) * (-1321.558) (-1318.772) [-1322.440] (-1321.540) -- 0:01:03
      329500 -- (-1319.096) (-1324.244) (-1322.927) [-1317.450] * [-1323.201] (-1322.713) (-1327.785) (-1325.805) -- 0:01:03
      330000 -- (-1323.051) [-1327.166] (-1324.750) (-1321.392) * (-1321.116) [-1322.505] (-1319.062) (-1324.867) -- 0:01:02

      Average standard deviation of split frequencies: 0.011664

      330500 -- (-1325.278) (-1321.366) (-1320.177) [-1316.088] * [-1320.827] (-1321.100) (-1319.104) (-1324.560) -- 0:01:02
      331000 -- (-1324.296) (-1321.031) (-1336.411) [-1324.877] * (-1321.477) [-1318.089] (-1320.118) (-1326.430) -- 0:01:02
      331500 -- (-1321.470) (-1326.455) [-1319.607] (-1326.933) * (-1322.741) (-1329.358) (-1321.026) [-1322.676] -- 0:01:02
      332000 -- (-1322.190) (-1328.816) [-1320.958] (-1319.938) * [-1324.067] (-1328.076) (-1322.197) (-1324.381) -- 0:01:02
      332500 -- (-1319.591) [-1319.839] (-1329.670) (-1320.207) * (-1316.304) (-1318.460) (-1329.590) [-1321.266] -- 0:01:02
      333000 -- (-1325.337) [-1318.959] (-1324.120) (-1323.156) * (-1322.050) (-1317.920) (-1328.263) [-1325.450] -- 0:01:02
      333500 -- [-1322.249] (-1317.836) (-1324.889) (-1326.672) * (-1332.081) [-1324.613] (-1321.578) (-1319.833) -- 0:01:01
      334000 -- (-1322.390) (-1324.686) (-1321.363) [-1322.047] * (-1326.644) [-1325.666] (-1327.123) (-1329.471) -- 0:01:01
      334500 -- (-1326.618) [-1323.023] (-1321.156) (-1328.971) * (-1325.140) (-1324.603) [-1322.161] (-1324.118) -- 0:01:01
      335000 -- [-1323.957] (-1322.335) (-1323.944) (-1327.445) * (-1327.656) [-1321.981] (-1326.889) (-1319.878) -- 0:01:01

      Average standard deviation of split frequencies: 0.010459

      335500 -- (-1323.830) (-1317.865) (-1330.166) [-1319.470] * (-1329.118) [-1322.906] (-1332.251) (-1324.696) -- 0:01:01
      336000 -- [-1325.345] (-1324.311) (-1324.856) (-1323.269) * (-1327.391) (-1323.175) [-1322.763] (-1325.662) -- 0:01:01
      336500 -- [-1322.406] (-1323.343) (-1327.039) (-1318.363) * [-1325.339] (-1321.483) (-1326.277) (-1330.245) -- 0:01:01
      337000 -- (-1322.611) [-1318.731] (-1328.650) (-1321.650) * [-1323.273] (-1322.599) (-1318.429) (-1334.395) -- 0:01:00
      337500 -- (-1328.886) [-1318.061] (-1323.480) (-1324.268) * [-1318.510] (-1321.752) (-1328.432) (-1328.009) -- 0:01:00
      338000 -- (-1320.422) (-1327.489) (-1320.746) [-1317.232] * (-1321.522) [-1320.718] (-1327.763) (-1326.851) -- 0:01:02
      338500 -- (-1323.379) [-1317.379] (-1322.446) (-1319.908) * [-1318.713] (-1324.143) (-1321.030) (-1324.241) -- 0:01:02
      339000 -- (-1321.855) (-1322.921) [-1319.852] (-1326.619) * (-1320.006) (-1324.589) [-1318.835] (-1326.923) -- 0:01:02
      339500 -- (-1323.211) [-1320.512] (-1322.229) (-1327.047) * (-1327.072) (-1324.497) [-1319.388] (-1331.226) -- 0:01:02
      340000 -- (-1320.869) (-1320.088) [-1319.697] (-1324.183) * (-1321.954) [-1323.858] (-1322.038) (-1330.798) -- 0:01:02

      Average standard deviation of split frequencies: 0.009812

      340500 -- (-1324.823) (-1324.370) (-1326.024) [-1316.361] * (-1322.770) [-1322.735] (-1336.994) (-1324.712) -- 0:01:01
      341000 -- (-1320.860) (-1325.514) (-1321.726) [-1322.123] * (-1326.518) [-1324.082] (-1323.556) (-1325.418) -- 0:01:01
      341500 -- (-1325.024) [-1321.497] (-1320.753) (-1322.174) * (-1320.148) (-1322.217) [-1325.798] (-1325.799) -- 0:01:01
      342000 -- (-1321.525) (-1329.423) [-1318.062] (-1319.456) * (-1323.249) (-1318.277) [-1318.132] (-1320.756) -- 0:01:01
      342500 -- (-1317.218) (-1325.483) (-1326.215) [-1322.253] * (-1319.183) (-1323.544) (-1324.899) [-1324.581] -- 0:01:01
      343000 -- (-1320.597) (-1322.176) (-1333.056) [-1319.155] * (-1321.885) (-1322.768) [-1317.225] (-1324.695) -- 0:01:01
      343500 -- (-1331.259) (-1325.574) (-1322.226) [-1323.533] * [-1325.262] (-1322.055) (-1327.171) (-1325.163) -- 0:01:01
      344000 -- (-1327.583) (-1332.019) (-1321.385) [-1326.666] * [-1320.390] (-1326.552) (-1325.833) (-1322.773) -- 0:01:01
      344500 -- [-1326.445] (-1322.135) (-1324.425) (-1332.333) * [-1319.065] (-1317.610) (-1327.161) (-1317.556) -- 0:01:00
      345000 -- [-1321.113] (-1333.649) (-1327.676) (-1326.941) * (-1324.991) [-1321.399] (-1323.936) (-1322.588) -- 0:01:00

      Average standard deviation of split frequencies: 0.009661

      345500 -- [-1323.443] (-1329.401) (-1321.724) (-1323.857) * (-1335.191) [-1319.190] (-1319.188) (-1324.545) -- 0:01:00
      346000 -- [-1319.072] (-1317.447) (-1324.852) (-1332.849) * (-1326.222) (-1315.000) (-1321.512) [-1318.453] -- 0:01:00
      346500 -- [-1325.203] (-1322.769) (-1326.895) (-1323.333) * (-1326.894) (-1323.019) (-1333.986) [-1324.614] -- 0:01:00
      347000 -- (-1322.858) (-1322.665) (-1326.555) [-1320.501] * (-1321.037) (-1327.360) (-1329.736) [-1316.326] -- 0:01:00
      347500 -- (-1321.261) (-1318.946) (-1321.630) [-1325.014] * [-1327.438] (-1324.921) (-1326.915) (-1321.047) -- 0:01:00
      348000 -- [-1319.532] (-1324.208) (-1324.649) (-1326.598) * [-1320.532] (-1323.823) (-1327.223) (-1325.113) -- 0:00:59
      348500 -- (-1321.995) [-1323.572] (-1326.357) (-1328.117) * (-1331.883) (-1317.002) (-1326.953) [-1327.269] -- 0:01:01
      349000 -- (-1322.551) [-1310.933] (-1327.695) (-1315.805) * (-1318.274) [-1321.014] (-1325.620) (-1328.660) -- 0:01:01
      349500 -- (-1323.544) [-1323.600] (-1322.520) (-1326.556) * (-1328.454) [-1320.913] (-1320.520) (-1325.162) -- 0:01:01
      350000 -- (-1323.970) (-1327.808) (-1317.345) [-1321.414] * (-1324.952) [-1318.229] (-1324.490) (-1321.425) -- 0:01:01

      Average standard deviation of split frequencies: 0.010266

      350500 -- [-1319.724] (-1322.077) (-1318.343) (-1317.951) * (-1324.579) (-1322.000) (-1325.315) [-1320.959] -- 0:01:01
      351000 -- (-1323.028) (-1319.001) [-1315.752] (-1319.138) * [-1322.389] (-1324.361) (-1325.054) (-1324.366) -- 0:01:01
      351500 -- (-1325.377) (-1323.089) [-1321.698] (-1318.978) * (-1323.870) (-1320.857) (-1326.424) [-1319.237] -- 0:01:00
      352000 -- (-1321.210) (-1328.396) [-1321.640] (-1323.271) * (-1329.557) [-1331.211] (-1322.770) (-1324.096) -- 0:01:00
      352500 -- (-1324.650) (-1319.871) [-1322.610] (-1326.216) * (-1320.569) (-1331.082) [-1321.643] (-1327.413) -- 0:01:00
      353000 -- (-1319.864) (-1327.639) (-1325.302) [-1320.939] * (-1327.877) (-1318.049) [-1324.477] (-1323.088) -- 0:01:00
      353500 -- [-1320.589] (-1324.842) (-1319.773) (-1322.337) * [-1325.243] (-1325.703) (-1320.548) (-1323.863) -- 0:01:00
      354000 -- [-1318.197] (-1326.551) (-1323.829) (-1328.179) * [-1318.070] (-1318.199) (-1330.279) (-1322.005) -- 0:01:00
      354500 -- (-1322.461) (-1322.998) (-1320.778) [-1323.031] * (-1323.938) (-1325.424) (-1323.877) [-1321.883] -- 0:01:00
      355000 -- [-1323.849] (-1329.121) (-1321.959) (-1328.853) * (-1326.291) (-1329.947) [-1318.646] (-1319.699) -- 0:00:59

      Average standard deviation of split frequencies: 0.010834

      355500 -- (-1321.492) (-1323.312) [-1320.383] (-1324.540) * (-1324.021) (-1323.495) (-1317.973) [-1320.313] -- 0:00:59
      356000 -- (-1325.389) [-1317.570] (-1319.386) (-1327.921) * (-1325.004) (-1319.254) [-1324.440] (-1319.504) -- 0:00:59
      356500 -- [-1322.980] (-1325.897) (-1327.399) (-1321.267) * [-1321.424] (-1319.163) (-1329.046) (-1325.552) -- 0:00:59
      357000 -- (-1327.480) (-1329.195) (-1326.964) [-1321.782] * [-1323.113] (-1329.432) (-1321.555) (-1321.324) -- 0:00:59
      357500 -- (-1324.661) (-1329.330) (-1329.106) [-1318.540] * (-1321.564) (-1321.017) (-1324.019) [-1321.546] -- 0:00:59
      358000 -- (-1326.850) [-1326.834] (-1322.004) (-1321.044) * [-1325.877] (-1322.041) (-1323.824) (-1322.148) -- 0:00:59
      358500 -- (-1328.640) (-1320.092) [-1322.984] (-1328.010) * (-1329.384) (-1320.023) (-1322.073) [-1316.052] -- 0:00:59
      359000 -- (-1323.566) [-1317.062] (-1324.885) (-1320.308) * (-1322.699) [-1318.534] (-1326.204) (-1328.408) -- 0:00:58
      359500 -- [-1322.954] (-1326.115) (-1320.616) (-1324.983) * (-1321.181) [-1323.747] (-1331.479) (-1322.571) -- 0:01:00
      360000 -- [-1320.336] (-1319.779) (-1324.073) (-1327.753) * (-1327.807) [-1315.054] (-1323.774) (-1319.533) -- 0:01:00

      Average standard deviation of split frequencies: 0.009506

      360500 -- (-1329.903) (-1321.719) (-1323.175) [-1322.592] * (-1320.492) (-1320.272) [-1330.214] (-1321.482) -- 0:01:00
      361000 -- (-1321.989) (-1324.610) (-1321.631) [-1316.171] * [-1320.547] (-1323.172) (-1321.046) (-1324.098) -- 0:01:00
      361500 -- (-1318.784) (-1321.813) [-1322.058] (-1319.675) * [-1325.452] (-1327.447) (-1328.387) (-1325.099) -- 0:01:00
      362000 -- (-1328.075) (-1327.467) [-1319.943] (-1320.437) * [-1328.210] (-1328.266) (-1323.133) (-1324.753) -- 0:00:59
      362500 -- (-1323.450) [-1319.845] (-1324.440) (-1325.894) * [-1319.835] (-1322.459) (-1325.319) (-1323.236) -- 0:00:59
      363000 -- (-1319.742) [-1322.551] (-1320.462) (-1327.766) * (-1321.466) (-1318.125) [-1319.156] (-1320.455) -- 0:00:59
      363500 -- (-1319.287) (-1324.299) [-1323.233] (-1319.520) * [-1321.454] (-1319.829) (-1323.684) (-1317.941) -- 0:00:59
      364000 -- (-1332.423) [-1317.008] (-1321.202) (-1327.160) * (-1327.900) (-1321.783) (-1322.932) [-1320.968] -- 0:00:59
      364500 -- (-1324.684) (-1319.189) (-1323.111) [-1322.827] * (-1319.830) [-1321.810] (-1321.073) (-1321.902) -- 0:00:59
      365000 -- (-1318.109) [-1320.000] (-1325.069) (-1318.554) * (-1322.347) (-1324.049) (-1329.840) [-1322.205] -- 0:00:59

      Average standard deviation of split frequencies: 0.010772

      365500 -- (-1325.328) [-1317.360] (-1319.279) (-1323.440) * (-1326.637) (-1323.592) (-1320.436) [-1316.995] -- 0:00:59
      366000 -- (-1321.764) [-1321.934] (-1318.239) (-1322.935) * (-1329.739) (-1322.053) [-1320.122] (-1325.111) -- 0:00:58
      366500 -- (-1321.846) (-1322.777) (-1328.783) [-1327.712] * [-1324.511] (-1327.592) (-1324.087) (-1319.631) -- 0:00:58
      367000 -- [-1317.986] (-1326.046) (-1320.858) (-1327.906) * [-1319.603] (-1320.886) (-1323.157) (-1323.850) -- 0:00:58
      367500 -- (-1324.796) (-1325.556) [-1321.681] (-1332.716) * [-1318.483] (-1320.692) (-1322.224) (-1317.702) -- 0:00:58
      368000 -- (-1323.010) (-1327.746) [-1314.507] (-1326.048) * [-1325.378] (-1320.097) (-1322.362) (-1318.700) -- 0:00:58
      368500 -- (-1323.297) (-1321.575) [-1318.288] (-1321.569) * (-1328.090) (-1318.942) [-1322.829] (-1321.987) -- 0:00:58
      369000 -- (-1321.323) (-1324.212) [-1322.424] (-1325.295) * (-1324.991) (-1324.817) (-1326.097) [-1323.629] -- 0:00:58
      369500 -- (-1322.515) [-1323.411] (-1320.913) (-1322.993) * (-1327.967) (-1325.891) (-1327.399) [-1325.663] -- 0:00:58
      370000 -- [-1317.251] (-1323.550) (-1328.106) (-1319.824) * (-1325.625) (-1317.578) [-1319.662] (-1322.903) -- 0:00:57

      Average standard deviation of split frequencies: 0.010637

      370500 -- (-1324.157) (-1327.606) (-1321.980) [-1319.657] * (-1326.445) (-1321.426) (-1326.144) [-1322.305] -- 0:00:59
      371000 -- (-1323.691) (-1322.395) [-1320.784] (-1328.501) * (-1327.680) (-1322.176) [-1326.465] (-1322.914) -- 0:00:59
      371500 -- (-1318.855) [-1321.544] (-1325.976) (-1327.199) * (-1328.041) (-1319.315) [-1329.165] (-1319.387) -- 0:00:59
      372000 -- (-1323.228) [-1321.732] (-1322.044) (-1322.657) * (-1326.398) (-1325.345) [-1323.019] (-1321.107) -- 0:00:59
      372500 -- (-1328.097) (-1324.087) (-1322.699) [-1321.054] * (-1319.755) (-1321.154) (-1316.795) [-1323.616] -- 0:00:58
      373000 -- (-1320.519) (-1322.904) [-1319.739] (-1318.683) * (-1322.887) [-1318.284] (-1321.027) (-1327.959) -- 0:00:58
      373500 -- (-1329.326) (-1317.315) (-1322.443) [-1323.901] * (-1323.666) (-1323.469) (-1322.715) [-1326.131] -- 0:00:58
      374000 -- (-1325.348) [-1325.332] (-1320.405) (-1324.038) * (-1324.666) (-1324.919) (-1321.299) [-1322.958] -- 0:00:58
      374500 -- (-1319.376) [-1324.234] (-1330.860) (-1329.199) * (-1329.238) [-1320.737] (-1326.647) (-1323.908) -- 0:00:58
      375000 -- (-1321.156) (-1321.975) (-1326.113) [-1321.314] * [-1325.550] (-1319.086) (-1326.643) (-1324.974) -- 0:00:58

      Average standard deviation of split frequencies: 0.010030

      375500 -- (-1320.131) (-1326.073) (-1327.795) [-1319.249] * (-1327.965) (-1322.275) (-1324.789) [-1325.677] -- 0:00:58
      376000 -- (-1330.561) [-1319.189] (-1322.412) (-1324.801) * (-1328.892) (-1324.085) [-1318.719] (-1333.350) -- 0:00:58
      376500 -- [-1327.335] (-1321.356) (-1315.711) (-1319.937) * (-1323.167) [-1319.332] (-1323.469) (-1328.792) -- 0:00:57
      377000 -- (-1321.797) (-1324.566) [-1318.459] (-1319.223) * (-1322.496) (-1329.464) (-1328.025) [-1319.653] -- 0:00:57
      377500 -- (-1317.212) (-1320.972) (-1325.984) [-1320.428] * (-1322.968) (-1325.423) [-1327.807] (-1323.407) -- 0:00:57
      378000 -- (-1326.104) (-1325.238) [-1323.398] (-1324.940) * (-1324.148) [-1321.941] (-1317.655) (-1321.386) -- 0:00:57
      378500 -- (-1329.793) (-1321.709) (-1327.870) [-1318.314] * (-1321.629) [-1318.334] (-1331.638) (-1317.495) -- 0:00:57
      379000 -- (-1328.396) (-1323.595) (-1325.443) [-1322.213] * [-1316.518] (-1311.138) (-1320.661) (-1328.343) -- 0:00:57
      379500 -- [-1324.667] (-1320.562) (-1329.023) (-1327.881) * [-1315.958] (-1321.594) (-1331.466) (-1326.958) -- 0:00:57
      380000 -- (-1325.677) (-1318.867) (-1318.684) [-1323.888] * (-1320.674) [-1320.754] (-1321.029) (-1317.929) -- 0:00:57

      Average standard deviation of split frequencies: 0.010808

      380500 -- [-1325.124] (-1331.200) (-1324.259) (-1326.703) * [-1322.113] (-1320.506) (-1324.885) (-1321.071) -- 0:00:56
      381000 -- (-1325.232) (-1330.838) (-1320.827) [-1322.454] * (-1319.255) (-1329.432) [-1321.460] (-1328.600) -- 0:00:56
      381500 -- (-1321.326) (-1321.556) [-1322.658] (-1324.759) * (-1320.385) (-1319.060) [-1319.818] (-1333.563) -- 0:00:58
      382000 -- (-1320.371) [-1324.923] (-1320.200) (-1327.850) * (-1325.173) [-1318.702] (-1325.101) (-1323.932) -- 0:00:58
      382500 -- (-1320.898) (-1318.475) [-1318.347] (-1324.959) * (-1329.640) [-1322.271] (-1320.029) (-1325.839) -- 0:00:58
      383000 -- (-1319.932) [-1319.855] (-1326.874) (-1324.263) * (-1316.539) [-1321.115] (-1331.880) (-1325.628) -- 0:00:57
      383500 -- (-1324.140) (-1326.921) [-1316.635] (-1322.281) * (-1323.950) [-1320.638] (-1326.771) (-1324.602) -- 0:00:57
      384000 -- [-1322.163] (-1319.700) (-1321.760) (-1324.392) * (-1316.149) [-1326.259] (-1329.636) (-1323.777) -- 0:00:57
      384500 -- [-1323.038] (-1320.028) (-1327.622) (-1326.931) * [-1318.916] (-1328.191) (-1328.669) (-1326.330) -- 0:00:57
      385000 -- (-1325.688) [-1318.087] (-1326.466) (-1327.547) * (-1327.546) (-1322.823) (-1326.746) [-1319.970] -- 0:00:57

      Average standard deviation of split frequencies: 0.009770

      385500 -- [-1316.118] (-1325.210) (-1324.739) (-1327.419) * (-1326.384) [-1325.401] (-1321.178) (-1325.879) -- 0:00:57
      386000 -- [-1322.697] (-1331.019) (-1316.581) (-1328.888) * (-1323.837) (-1327.464) [-1318.458] (-1327.174) -- 0:00:57
      386500 -- [-1328.451] (-1326.219) (-1324.017) (-1323.918) * [-1318.490] (-1325.548) (-1329.996) (-1322.592) -- 0:00:57
      387000 -- (-1322.227) [-1316.516] (-1326.408) (-1327.553) * (-1320.163) [-1323.025] (-1322.950) (-1321.458) -- 0:00:57
      387500 -- (-1328.398) [-1317.939] (-1326.629) (-1319.758) * [-1321.940] (-1326.901) (-1329.123) (-1327.268) -- 0:00:56
      388000 -- [-1326.169] (-1328.113) (-1323.711) (-1325.295) * (-1320.424) (-1318.490) [-1317.245] (-1316.678) -- 0:00:56
      388500 -- [-1318.395] (-1323.636) (-1332.840) (-1325.375) * (-1323.210) (-1316.833) (-1328.958) [-1327.580] -- 0:00:56
      389000 -- [-1323.938] (-1324.945) (-1322.708) (-1324.313) * [-1320.290] (-1318.781) (-1331.897) (-1325.448) -- 0:00:56
      389500 -- (-1328.515) [-1320.498] (-1324.484) (-1321.208) * (-1327.838) [-1320.096] (-1324.208) (-1323.688) -- 0:00:56
      390000 -- (-1320.405) (-1320.949) (-1321.031) [-1323.955] * (-1327.387) (-1327.185) [-1318.515] (-1339.053) -- 0:00:56

      Average standard deviation of split frequencies: 0.010092

      390500 -- (-1324.494) (-1317.327) (-1331.679) [-1316.991] * (-1323.169) [-1319.792] (-1320.159) (-1324.020) -- 0:00:56
      391000 -- (-1323.139) (-1320.826) (-1330.472) [-1335.137] * (-1326.668) (-1318.937) (-1324.124) [-1321.312] -- 0:00:56
      391500 -- [-1319.927] (-1321.060) (-1322.902) (-1321.193) * [-1323.725] (-1326.373) (-1328.642) (-1327.252) -- 0:00:55
      392000 -- (-1325.614) (-1321.474) [-1319.181] (-1326.281) * (-1320.332) [-1320.825] (-1319.098) (-1329.920) -- 0:00:55
      392500 -- (-1324.122) (-1321.844) (-1325.675) [-1318.765] * (-1318.630) (-1323.169) (-1320.198) [-1327.487] -- 0:00:57
      393000 -- (-1327.339) (-1326.368) [-1322.196] (-1320.435) * [-1323.142] (-1324.077) (-1323.782) (-1320.202) -- 0:00:57
      393500 -- [-1320.932] (-1324.937) (-1325.716) (-1327.221) * [-1321.602] (-1325.766) (-1325.088) (-1319.553) -- 0:00:57
      394000 -- (-1324.616) [-1323.341] (-1324.925) (-1325.090) * (-1322.252) (-1323.337) [-1323.268] (-1325.873) -- 0:00:56
      394500 -- (-1322.532) (-1320.762) (-1324.954) [-1326.239] * (-1326.505) (-1325.877) [-1322.357] (-1320.179) -- 0:00:56
      395000 -- (-1321.351) (-1322.883) (-1331.893) [-1323.970] * (-1322.640) (-1324.495) (-1322.581) [-1323.329] -- 0:00:56

      Average standard deviation of split frequencies: 0.010173

      395500 -- (-1323.473) (-1325.652) (-1322.280) [-1320.072] * (-1321.316) (-1322.396) (-1328.891) [-1320.741] -- 0:00:56
      396000 -- (-1331.399) (-1331.764) [-1322.805] (-1325.432) * (-1322.860) (-1321.583) (-1318.867) [-1320.061] -- 0:00:56
      396500 -- [-1323.015] (-1327.073) (-1324.562) (-1316.732) * (-1320.998) (-1327.858) [-1319.978] (-1325.340) -- 0:00:56
      397000 -- (-1324.740) (-1320.739) (-1325.865) [-1322.553] * [-1322.389] (-1332.816) (-1317.584) (-1323.328) -- 0:00:56
      397500 -- (-1328.175) [-1319.808] (-1327.664) (-1331.408) * (-1319.869) (-1320.394) (-1325.333) [-1319.150] -- 0:00:56
      398000 -- (-1321.500) (-1318.033) (-1318.457) [-1322.080] * (-1323.507) [-1320.893] (-1335.836) (-1321.456) -- 0:00:55
      398500 -- (-1328.565) [-1328.464] (-1320.080) (-1324.234) * [-1322.386] (-1331.862) (-1326.830) (-1329.299) -- 0:00:55
      399000 -- [-1322.115] (-1325.038) (-1325.403) (-1329.140) * (-1323.697) (-1333.705) (-1320.118) [-1325.442] -- 0:00:55
      399500 -- [-1319.994] (-1325.001) (-1337.657) (-1323.182) * (-1326.899) (-1317.257) [-1323.102] (-1323.163) -- 0:00:55
      400000 -- (-1324.124) [-1325.302] (-1326.012) (-1320.156) * (-1328.527) (-1321.188) (-1319.021) [-1328.534] -- 0:00:55

      Average standard deviation of split frequencies: 0.009840

      400500 -- (-1318.510) (-1321.869) [-1326.727] (-1322.803) * (-1327.692) (-1321.214) [-1318.653] (-1326.141) -- 0:00:55
      401000 -- (-1330.909) [-1321.178] (-1323.762) (-1316.805) * [-1319.232] (-1316.659) (-1326.255) (-1326.834) -- 0:00:55
      401500 -- (-1320.627) (-1322.571) [-1318.919] (-1317.640) * (-1327.995) (-1324.257) [-1320.052] (-1319.339) -- 0:00:55
      402000 -- (-1329.543) (-1320.081) [-1318.939] (-1323.311) * (-1320.263) (-1324.800) (-1326.831) [-1317.412] -- 0:00:55
      402500 -- [-1316.628] (-1320.250) (-1325.703) (-1319.673) * (-1326.178) (-1322.404) (-1331.926) [-1324.723] -- 0:00:54
      403000 -- (-1322.307) [-1323.764] (-1322.031) (-1323.921) * [-1328.297] (-1326.284) (-1319.772) (-1331.827) -- 0:00:54
      403500 -- (-1323.924) (-1325.297) [-1324.803] (-1322.481) * (-1326.366) (-1324.302) [-1316.872] (-1330.892) -- 0:00:56
      404000 -- (-1329.258) (-1322.141) [-1319.118] (-1323.258) * [-1319.165] (-1318.618) (-1322.873) (-1324.059) -- 0:00:56
      404500 -- (-1325.241) (-1333.294) (-1314.967) [-1321.734] * (-1321.133) (-1327.760) (-1317.398) [-1324.556] -- 0:00:55
      405000 -- [-1322.124] (-1329.380) (-1321.435) (-1319.865) * [-1329.332] (-1324.769) (-1323.758) (-1325.117) -- 0:00:55

      Average standard deviation of split frequencies: 0.010133

      405500 -- [-1318.884] (-1326.583) (-1328.115) (-1327.393) * (-1334.712) (-1319.118) (-1326.176) [-1320.181] -- 0:00:55
      406000 -- (-1325.097) [-1323.255] (-1323.340) (-1324.651) * (-1325.717) (-1328.902) (-1325.413) [-1322.513] -- 0:00:55
      406500 -- (-1319.585) (-1320.710) (-1331.956) [-1319.647] * (-1326.466) (-1325.267) (-1323.973) [-1320.255] -- 0:00:55
      407000 -- (-1324.243) (-1334.030) [-1326.864] (-1324.983) * (-1323.765) [-1325.592] (-1323.418) (-1316.705) -- 0:00:55
      407500 -- (-1323.231) (-1323.882) [-1315.085] (-1322.367) * [-1327.294] (-1330.151) (-1323.696) (-1325.220) -- 0:00:55
      408000 -- [-1326.015] (-1328.775) (-1334.225) (-1320.074) * (-1325.172) (-1319.479) [-1322.078] (-1322.769) -- 0:00:55
      408500 -- (-1319.267) (-1330.672) (-1322.710) [-1316.889] * (-1326.369) (-1325.576) (-1321.555) [-1324.880] -- 0:00:55
      409000 -- (-1318.916) (-1334.683) (-1324.467) [-1316.988] * (-1321.144) (-1322.937) (-1322.670) [-1323.203] -- 0:00:54
      409500 -- (-1333.656) (-1327.397) (-1319.425) [-1321.314] * (-1329.608) (-1322.492) [-1326.892] (-1325.846) -- 0:00:54
      410000 -- [-1320.396] (-1328.275) (-1328.546) (-1313.693) * (-1322.433) (-1333.837) (-1322.092) [-1323.649] -- 0:00:54

      Average standard deviation of split frequencies: 0.009183

      410500 -- [-1324.859] (-1326.532) (-1328.015) (-1317.004) * (-1323.760) (-1322.324) [-1323.326] (-1323.216) -- 0:00:54
      411000 -- (-1328.758) (-1320.660) [-1323.037] (-1320.481) * [-1326.990] (-1326.930) (-1338.822) (-1325.546) -- 0:00:54
      411500 -- (-1328.027) (-1327.214) (-1320.481) [-1319.475] * (-1332.854) [-1320.712] (-1329.878) (-1326.315) -- 0:00:54
      412000 -- (-1330.364) [-1326.855] (-1322.083) (-1327.329) * (-1324.789) (-1322.809) (-1323.508) [-1325.683] -- 0:00:54
      412500 -- [-1323.552] (-1321.683) (-1329.631) (-1325.230) * (-1328.942) (-1321.259) (-1333.714) [-1324.510] -- 0:00:54
      413000 -- (-1327.401) [-1326.251] (-1322.964) (-1334.005) * (-1324.220) (-1327.324) [-1324.538] (-1327.069) -- 0:00:54
      413500 -- (-1318.858) (-1324.848) (-1332.267) [-1326.017] * (-1321.580) (-1326.184) (-1317.440) [-1325.162] -- 0:00:53
      414000 -- (-1324.147) (-1323.826) (-1327.112) [-1317.814] * (-1325.201) (-1319.657) (-1331.058) [-1316.637] -- 0:00:53
      414500 -- (-1323.978) (-1324.684) (-1325.310) [-1314.525] * (-1317.423) (-1329.255) (-1328.125) [-1324.046] -- 0:00:55
      415000 -- (-1325.974) (-1321.079) (-1326.970) [-1322.845] * (-1317.358) (-1320.419) [-1327.535] (-1322.958) -- 0:00:54

      Average standard deviation of split frequencies: 0.008859

      415500 -- (-1325.403) [-1321.947] (-1328.619) (-1329.486) * (-1320.775) [-1322.664] (-1326.703) (-1318.756) -- 0:00:54
      416000 -- (-1327.649) (-1326.576) [-1325.709] (-1319.366) * (-1339.411) (-1324.915) [-1323.613] (-1320.345) -- 0:00:54
      416500 -- (-1327.935) [-1322.146] (-1324.736) (-1329.311) * (-1321.966) [-1325.353] (-1325.611) (-1322.565) -- 0:00:54
      417000 -- (-1333.622) (-1321.978) [-1322.309] (-1316.823) * (-1324.125) [-1322.744] (-1331.586) (-1317.512) -- 0:00:54
      417500 -- (-1323.522) (-1323.314) [-1322.893] (-1320.538) * (-1326.766) [-1324.170] (-1327.964) (-1332.190) -- 0:00:54
      418000 -- (-1328.838) (-1320.846) [-1321.340] (-1324.600) * [-1317.974] (-1325.483) (-1334.368) (-1320.919) -- 0:00:54
      418500 -- [-1321.138] (-1323.440) (-1328.622) (-1319.274) * (-1320.566) [-1320.441] (-1331.544) (-1321.214) -- 0:00:54
      419000 -- (-1325.541) (-1324.411) [-1321.324] (-1325.258) * (-1318.160) (-1323.203) [-1321.342] (-1326.440) -- 0:00:54
      419500 -- (-1327.082) (-1320.430) (-1319.738) [-1322.595] * (-1321.355) [-1325.022] (-1323.780) (-1324.073) -- 0:00:53
      420000 -- (-1324.471) (-1323.863) (-1326.778) [-1321.503] * (-1317.421) [-1323.365] (-1321.313) (-1326.083) -- 0:00:53

      Average standard deviation of split frequencies: 0.009372

      420500 -- (-1323.519) (-1324.527) (-1327.050) [-1320.953] * (-1321.089) (-1324.910) (-1334.660) [-1318.100] -- 0:00:53
      421000 -- (-1321.577) (-1323.284) [-1325.141] (-1326.834) * [-1321.067] (-1319.330) (-1324.343) (-1326.845) -- 0:00:53
      421500 -- (-1323.607) [-1317.826] (-1321.943) (-1323.647) * (-1326.214) (-1324.186) (-1331.131) [-1318.680] -- 0:00:53
      422000 -- (-1323.611) (-1326.230) [-1326.909] (-1321.550) * (-1319.931) [-1316.786] (-1328.368) (-1323.333) -- 0:00:53
      422500 -- (-1319.620) (-1328.279) [-1321.880] (-1320.795) * (-1328.142) (-1324.424) [-1316.946] (-1327.269) -- 0:00:53
      423000 -- (-1327.625) (-1330.905) (-1319.270) [-1315.877] * (-1330.647) (-1319.053) [-1320.046] (-1331.263) -- 0:00:53
      423500 -- (-1320.384) (-1324.495) (-1324.517) [-1328.058] * [-1324.272] (-1329.185) (-1324.462) (-1329.574) -- 0:00:53
      424000 -- [-1316.318] (-1323.458) (-1323.483) (-1317.472) * (-1318.170) (-1333.379) [-1319.078] (-1321.335) -- 0:00:52
      424500 -- (-1328.093) (-1326.973) [-1322.360] (-1321.399) * (-1326.147) (-1323.487) [-1317.174] (-1324.507) -- 0:00:52
      425000 -- (-1324.170) (-1324.767) [-1320.451] (-1327.434) * [-1319.552] (-1321.784) (-1324.358) (-1323.350) -- 0:00:52

      Average standard deviation of split frequencies: 0.009054

      425500 -- (-1319.020) (-1321.718) (-1320.317) [-1321.578] * (-1326.780) (-1322.776) [-1319.352] (-1334.529) -- 0:00:54
      426000 -- [-1321.112] (-1320.992) (-1322.489) (-1328.236) * (-1326.914) [-1321.202] (-1319.692) (-1325.297) -- 0:00:53
      426500 -- [-1319.237] (-1320.383) (-1318.889) (-1321.158) * (-1319.854) (-1325.920) [-1318.185] (-1327.353) -- 0:00:53
      427000 -- (-1321.888) (-1323.944) (-1321.215) [-1318.687] * (-1325.687) (-1320.332) [-1322.038] (-1324.501) -- 0:00:53
      427500 -- (-1320.784) (-1322.057) (-1333.689) [-1321.440] * (-1328.483) (-1322.810) (-1328.579) [-1321.094] -- 0:00:53
      428000 -- (-1317.932) (-1322.639) (-1327.633) [-1320.118] * (-1321.538) (-1316.601) [-1320.509] (-1328.843) -- 0:00:53
      428500 -- (-1321.069) (-1320.948) (-1320.938) [-1322.294] * (-1319.903) [-1318.771] (-1322.160) (-1334.712) -- 0:00:53
      429000 -- (-1325.641) (-1322.909) [-1319.629] (-1324.981) * (-1318.418) (-1325.350) [-1319.179] (-1323.888) -- 0:00:53
      429500 -- (-1322.116) (-1322.452) (-1315.744) [-1321.146] * [-1318.254] (-1322.194) (-1323.870) (-1325.432) -- 0:00:53
      430000 -- [-1320.167] (-1320.136) (-1328.178) (-1326.023) * (-1320.572) (-1322.730) [-1321.449] (-1320.648) -- 0:00:53

      Average standard deviation of split frequencies: 0.010150

      430500 -- (-1325.040) (-1322.053) [-1322.743] (-1334.459) * [-1320.301] (-1318.616) (-1319.344) (-1323.631) -- 0:00:52
      431000 -- [-1323.742] (-1324.135) (-1320.946) (-1325.526) * (-1324.276) [-1329.366] (-1324.720) (-1320.565) -- 0:00:52
      431500 -- (-1322.594) (-1316.079) (-1323.091) [-1322.715] * (-1319.965) (-1319.207) (-1321.932) [-1319.721] -- 0:00:52
      432000 -- (-1325.623) [-1321.182] (-1328.439) (-1322.720) * [-1322.214] (-1323.891) (-1328.082) (-1327.625) -- 0:00:52
      432500 -- [-1319.096] (-1331.540) (-1321.639) (-1332.132) * (-1323.052) (-1333.522) [-1325.304] (-1333.506) -- 0:00:52
      433000 -- [-1322.367] (-1321.319) (-1318.900) (-1324.934) * (-1323.381) (-1323.783) (-1327.835) [-1319.336] -- 0:00:52
      433500 -- (-1321.191) [-1320.874] (-1323.257) (-1328.862) * (-1326.164) (-1317.804) (-1328.674) [-1326.177] -- 0:00:52
      434000 -- [-1322.461] (-1320.186) (-1321.061) (-1318.571) * (-1321.621) [-1319.392] (-1326.645) (-1321.502) -- 0:00:52
      434500 -- (-1330.515) [-1318.884] (-1326.275) (-1320.783) * (-1323.323) [-1316.785] (-1321.439) (-1323.448) -- 0:00:52
      435000 -- [-1327.881] (-1326.156) (-1317.830) (-1320.529) * (-1316.722) (-1326.335) (-1322.256) [-1322.008] -- 0:00:51

      Average standard deviation of split frequencies: 0.010615

      435500 -- [-1326.083] (-1329.273) (-1324.484) (-1329.569) * [-1318.338] (-1331.713) (-1321.034) (-1332.738) -- 0:00:51
      436000 -- [-1314.636] (-1325.035) (-1327.257) (-1323.830) * (-1317.481) [-1327.502] (-1321.358) (-1318.066) -- 0:00:51
      436500 -- (-1319.229) (-1328.483) [-1327.832] (-1324.736) * (-1320.566) (-1322.523) (-1324.839) [-1326.928] -- 0:00:52
      437000 -- [-1315.984] (-1320.959) (-1318.750) (-1331.134) * (-1321.219) (-1323.001) [-1323.817] (-1321.831) -- 0:00:52
      437500 -- (-1315.070) (-1320.072) [-1320.291] (-1322.995) * (-1323.689) [-1321.454] (-1324.728) (-1326.434) -- 0:00:52
      438000 -- (-1320.242) (-1323.096) (-1329.637) [-1322.558] * (-1327.560) [-1322.819] (-1327.069) (-1316.501) -- 0:00:52
      438500 -- [-1320.213] (-1323.687) (-1319.893) (-1320.441) * [-1320.154] (-1328.404) (-1324.767) (-1317.571) -- 0:00:52
      439000 -- [-1316.749] (-1334.375) (-1326.068) (-1321.327) * [-1325.699] (-1332.599) (-1325.740) (-1320.113) -- 0:00:52
      439500 -- (-1316.693) [-1319.772] (-1317.814) (-1324.147) * [-1318.118] (-1323.495) (-1333.693) (-1318.955) -- 0:00:52
      440000 -- (-1321.251) (-1320.598) [-1323.299] (-1324.409) * [-1327.661] (-1329.912) (-1321.115) (-1324.784) -- 0:00:52

      Average standard deviation of split frequencies: 0.010698

      440500 -- (-1323.102) [-1315.980] (-1322.217) (-1329.350) * (-1320.398) [-1321.573] (-1331.384) (-1327.077) -- 0:00:52
      441000 -- (-1327.232) (-1316.529) (-1320.505) [-1323.348] * (-1324.750) (-1320.330) [-1313.678] (-1324.870) -- 0:00:51
      441500 -- (-1315.306) [-1327.467] (-1321.811) (-1322.659) * (-1327.265) (-1318.334) [-1331.235] (-1325.781) -- 0:00:51
      442000 -- (-1321.107) (-1323.748) [-1320.927] (-1318.079) * (-1329.056) [-1318.036] (-1322.910) (-1324.452) -- 0:00:51
      442500 -- [-1325.241] (-1318.788) (-1320.256) (-1317.164) * (-1331.165) (-1320.504) (-1324.475) [-1319.517] -- 0:00:51
      443000 -- (-1320.311) (-1323.836) [-1322.606] (-1321.286) * [-1324.425] (-1334.590) (-1328.752) (-1320.982) -- 0:00:51
      443500 -- (-1317.497) (-1325.385) (-1321.194) [-1323.194] * (-1327.956) [-1320.764] (-1323.064) (-1330.105) -- 0:00:51
      444000 -- [-1320.563] (-1329.772) (-1317.528) (-1323.597) * (-1324.258) (-1327.565) [-1321.720] (-1322.071) -- 0:00:51
      444500 -- [-1319.175] (-1324.867) (-1318.642) (-1319.700) * [-1328.597] (-1325.190) (-1323.630) (-1329.845) -- 0:00:51
      445000 -- (-1329.292) (-1327.512) [-1325.670] (-1322.942) * [-1326.906] (-1325.249) (-1326.361) (-1331.121) -- 0:00:51

      Average standard deviation of split frequencies: 0.010377

      445500 -- (-1323.002) (-1323.483) [-1318.546] (-1325.664) * (-1322.079) (-1319.272) (-1324.479) [-1328.879] -- 0:00:51
      446000 -- (-1321.250) [-1328.407] (-1326.422) (-1329.125) * (-1331.246) (-1319.569) [-1323.546] (-1330.615) -- 0:00:50
      446500 -- (-1318.142) [-1322.701] (-1323.387) (-1322.861) * (-1324.643) (-1317.260) (-1319.381) [-1317.088] -- 0:00:50
      447000 -- [-1319.303] (-1324.022) (-1330.261) (-1320.403) * (-1327.564) (-1332.340) [-1322.359] (-1320.655) -- 0:00:50
      447500 -- (-1318.703) (-1325.908) [-1322.005] (-1323.497) * (-1323.609) (-1319.452) (-1322.058) [-1315.922] -- 0:00:50
      448000 -- (-1326.065) [-1328.147] (-1324.495) (-1327.964) * [-1323.892] (-1325.548) (-1323.096) (-1327.873) -- 0:00:51
      448500 -- [-1320.582] (-1321.684) (-1323.302) (-1324.775) * (-1331.580) (-1324.425) [-1321.537] (-1317.752) -- 0:00:51
      449000 -- (-1319.148) (-1320.955) [-1316.597] (-1318.917) * (-1329.858) (-1326.173) (-1322.658) [-1322.689] -- 0:00:51
      449500 -- [-1321.785] (-1324.172) (-1330.038) (-1321.548) * (-1320.692) (-1323.142) (-1323.363) [-1323.012] -- 0:00:51
      450000 -- (-1317.149) (-1319.784) (-1325.314) [-1327.621] * [-1324.509] (-1319.506) (-1321.033) (-1326.733) -- 0:00:51

      Average standard deviation of split frequencies: 0.010841

      450500 -- [-1319.372] (-1332.117) (-1322.645) (-1324.184) * (-1320.970) (-1318.742) (-1321.107) [-1324.432] -- 0:00:51
      451000 -- (-1319.768) (-1324.573) (-1328.140) [-1323.333] * (-1321.863) [-1317.319] (-1322.371) (-1336.835) -- 0:00:51
      451500 -- (-1320.348) (-1329.995) [-1320.180] (-1325.117) * (-1325.934) (-1321.196) [-1323.341] (-1322.298) -- 0:00:51
      452000 -- (-1320.855) [-1325.047] (-1322.394) (-1328.961) * (-1325.568) (-1325.991) (-1315.443) [-1321.675] -- 0:00:50
      452500 -- (-1322.229) [-1318.579] (-1320.227) (-1325.172) * (-1320.280) (-1322.559) [-1325.200] (-1320.812) -- 0:00:50
      453000 -- (-1320.777) (-1322.330) [-1320.483] (-1325.963) * [-1321.086] (-1327.341) (-1326.264) (-1326.370) -- 0:00:50
      453500 -- (-1321.513) (-1318.919) [-1324.771] (-1323.883) * [-1314.360] (-1324.114) (-1322.459) (-1322.255) -- 0:00:50
      454000 -- (-1320.193) (-1325.501) [-1319.280] (-1318.439) * [-1320.839] (-1322.514) (-1317.336) (-1320.567) -- 0:00:50
      454500 -- (-1324.842) (-1330.841) [-1318.153] (-1326.492) * (-1327.383) (-1318.906) [-1324.656] (-1324.280) -- 0:00:50
      455000 -- (-1326.622) (-1327.382) (-1327.238) [-1320.366] * (-1322.534) [-1320.190] (-1325.173) (-1319.507) -- 0:00:50

      Average standard deviation of split frequencies: 0.011654

      455500 -- (-1322.658) [-1323.086] (-1329.427) (-1319.976) * [-1320.513] (-1322.669) (-1318.786) (-1320.998) -- 0:00:50
      456000 -- (-1317.683) (-1324.880) (-1324.384) [-1323.652] * (-1320.368) [-1327.348] (-1321.860) (-1326.444) -- 0:00:50
      456500 -- (-1325.027) (-1318.912) [-1326.932] (-1317.797) * (-1324.704) (-1320.159) [-1320.095] (-1325.301) -- 0:00:50
      457000 -- (-1320.431) (-1325.435) (-1330.239) [-1324.260] * [-1320.985] (-1326.735) (-1318.392) (-1332.015) -- 0:00:49
      457500 -- (-1328.476) (-1323.615) (-1332.170) [-1318.518] * (-1324.526) (-1327.659) [-1318.044] (-1324.648) -- 0:00:49
      458000 -- (-1325.031) [-1323.283] (-1329.098) (-1320.008) * (-1323.885) (-1317.561) (-1326.367) [-1325.489] -- 0:00:49
      458500 -- [-1323.126] (-1322.486) (-1323.041) (-1324.335) * [-1320.067] (-1321.785) (-1320.360) (-1323.380) -- 0:00:49
      459000 -- (-1330.747) [-1318.644] (-1324.400) (-1322.501) * (-1323.736) (-1316.704) [-1322.627] (-1322.687) -- 0:00:50
      459500 -- (-1315.249) (-1323.681) (-1324.715) [-1317.803] * (-1322.224) [-1319.743] (-1319.506) (-1325.220) -- 0:00:50
      460000 -- [-1321.941] (-1326.741) (-1327.007) (-1331.090) * [-1323.243] (-1327.500) (-1317.978) (-1322.217) -- 0:00:50

      Average standard deviation of split frequencies: 0.011908

      460500 -- (-1325.959) (-1330.694) (-1321.164) [-1324.986] * [-1320.400] (-1327.762) (-1323.477) (-1336.443) -- 0:00:50
      461000 -- [-1325.704] (-1328.603) (-1322.862) (-1322.341) * (-1323.059) (-1324.934) (-1323.928) [-1322.928] -- 0:00:50
      461500 -- (-1317.663) (-1326.209) [-1324.820] (-1331.844) * (-1325.544) (-1333.817) (-1322.641) [-1320.412] -- 0:00:50
      462000 -- [-1324.086] (-1321.963) (-1323.089) (-1335.021) * (-1319.642) (-1323.652) (-1322.257) [-1322.859] -- 0:00:50
      462500 -- (-1323.992) (-1323.172) [-1321.543] (-1320.911) * (-1323.209) [-1321.155] (-1330.402) (-1327.548) -- 0:00:49
      463000 -- (-1324.423) (-1320.749) [-1319.101] (-1321.927) * [-1322.106] (-1322.909) (-1321.099) (-1317.870) -- 0:00:49
      463500 -- [-1321.034] (-1326.058) (-1321.102) (-1323.789) * (-1319.608) (-1323.254) [-1316.318] (-1325.900) -- 0:00:49
      464000 -- (-1321.769) (-1314.614) (-1327.461) [-1314.968] * [-1323.752] (-1321.236) (-1324.607) (-1327.046) -- 0:00:49
      464500 -- (-1330.051) [-1324.478] (-1317.823) (-1327.391) * [-1323.644] (-1321.314) (-1325.223) (-1326.728) -- 0:00:49
      465000 -- [-1323.868] (-1326.744) (-1323.868) (-1322.660) * (-1323.670) [-1316.092] (-1322.367) (-1321.482) -- 0:00:49

      Average standard deviation of split frequencies: 0.011403

      465500 -- (-1329.268) (-1321.974) (-1324.013) [-1321.431] * (-1317.440) [-1322.070] (-1320.120) (-1319.269) -- 0:00:49
      466000 -- (-1321.806) (-1327.009) [-1320.340] (-1315.764) * [-1320.130] (-1317.719) (-1317.403) (-1322.706) -- 0:00:49
      466500 -- (-1324.704) (-1327.200) (-1319.355) [-1325.883] * [-1321.145] (-1316.855) (-1325.268) (-1326.855) -- 0:00:49
      467000 -- (-1322.060) (-1324.571) (-1322.638) [-1325.015] * [-1324.631] (-1319.325) (-1322.943) (-1326.667) -- 0:00:49
      467500 -- (-1330.330) (-1330.099) [-1324.092] (-1320.983) * [-1323.271] (-1324.306) (-1323.564) (-1326.612) -- 0:00:48
      468000 -- (-1319.195) [-1327.618] (-1323.937) (-1323.146) * (-1321.441) [-1329.508] (-1326.892) (-1322.003) -- 0:00:48
      468500 -- (-1324.748) (-1322.603) (-1325.014) [-1321.721] * [-1321.198] (-1321.627) (-1323.924) (-1328.553) -- 0:00:48
      469000 -- [-1322.619] (-1328.272) (-1313.252) (-1327.182) * (-1323.280) (-1322.267) (-1327.090) [-1317.813] -- 0:00:48
      469500 -- (-1322.144) (-1322.024) [-1320.198] (-1324.378) * (-1324.556) [-1315.580] (-1316.966) (-1328.811) -- 0:00:48
      470000 -- (-1323.214) (-1332.589) [-1325.286] (-1323.009) * [-1317.755] (-1323.645) (-1323.350) (-1319.908) -- 0:00:49

      Average standard deviation of split frequencies: 0.011108

      470500 -- (-1320.098) [-1323.561] (-1321.600) (-1323.104) * (-1326.118) (-1327.730) (-1320.853) [-1320.072] -- 0:00:49
      471000 -- (-1326.601) (-1323.390) [-1319.311] (-1323.862) * (-1323.078) (-1324.640) [-1322.486] (-1320.162) -- 0:00:49
      471500 -- (-1321.056) [-1322.768] (-1327.780) (-1324.852) * [-1317.360] (-1323.092) (-1327.324) (-1331.340) -- 0:00:49
      472000 -- (-1322.099) (-1327.155) (-1322.329) [-1322.214] * (-1322.659) (-1321.567) [-1316.409] (-1319.263) -- 0:00:49
      472500 -- (-1325.512) (-1324.547) [-1316.354] (-1319.300) * (-1321.471) (-1320.147) [-1325.076] (-1323.872) -- 0:00:49
      473000 -- (-1325.265) (-1327.983) [-1319.213] (-1328.798) * (-1321.736) (-1319.039) (-1322.831) [-1325.740] -- 0:00:49
      473500 -- (-1319.976) [-1318.015] (-1324.031) (-1330.452) * (-1326.212) (-1326.929) [-1320.129] (-1321.089) -- 0:00:48
      474000 -- (-1323.456) [-1315.702] (-1327.263) (-1329.755) * (-1323.826) (-1327.256) [-1319.169] (-1321.323) -- 0:00:48
      474500 -- (-1321.457) (-1322.908) [-1316.008] (-1323.762) * (-1320.016) [-1323.326] (-1321.923) (-1322.509) -- 0:00:48
      475000 -- (-1322.057) (-1323.496) [-1322.121] (-1321.008) * (-1320.588) [-1326.089] (-1322.314) (-1323.397) -- 0:00:48

      Average standard deviation of split frequencies: 0.011164

      475500 -- (-1318.719) (-1323.274) [-1323.872] (-1325.896) * [-1318.341] (-1327.261) (-1326.654) (-1320.301) -- 0:00:48
      476000 -- (-1325.444) (-1325.469) [-1323.140] (-1320.271) * [-1325.602] (-1326.331) (-1324.996) (-1320.148) -- 0:00:48
      476500 -- (-1322.745) [-1321.890] (-1323.722) (-1328.789) * (-1324.083) (-1322.775) [-1317.689] (-1322.696) -- 0:00:48
      477000 -- (-1323.441) [-1318.907] (-1325.928) (-1326.672) * (-1324.859) (-