>C1
VCNHECGALGESVTLEQLGEFAVIDRLVRGRRQPAVVALGPGDDAAVVTA
SDGRIVVSTDVLVQDRHFRLDWSTPHDVGRKAIAQNAADIEAMGARATTF
VVGLGAPGDTPVAQVDALVDGLWDEAGRIGAGIVGGDLVSCPQWVLSVTV
LGDLDGRAPVLRSGAKNGSMVAVAGALGRSAAGYALWHKGIDGFDDLRRR
HLVPEPPYGKGVAAAACGAQAMIDVSDGLIADLRHVARASGVSIDLSTAA
LAADHAALIAAATAVGGDPWPWVLGGGEDHALVACFAGTALSGWRIIGRV
FDGPARVLVDGQEWRGHAGWQSFGG
>C2
VCNHECGALGESVTLEQLGEFAVIDRLVRGRRQPAVVALGPGDDAAVVTA
SDGRIVVSTDVLVQDRHFRLDWSTPHDVGRKAIAQNAADIEAMGARATTF
VVGLGAPGDTPVAQVDALVDGLWDEAGRIGAGIVGGDLVSCPQWVLSVTV
LGDLDGRAPVLRSGAKNGSMVAVAGALGRSAAGYALWHKGIDGFDDLRRR
HLVPEPPYGKGVAAAACGAQAMIDVSDGLIADLRHVARASGVSIDLSTAA
LAADHAALIAAATAVGGDPWPWVLGGGEDHALVACFAGTALSGWRIIGRV
FDGPARVLVDGQEWRGHAGWQSFGG
>C3
VCNHECGALGESVTLEQLGEFAVIDRLVRGRRQPAVVALGPGDDAAVVTA
SDGRIVVSTDVLVQDRHFRLDWSTPHDVGRKAIAQNAADIEAMGARATTF
VVGLGAPGDTPVAQVDALVDGLWDEAGRIGAGIVGGDLVSCPQWVLSVTV
LGDLDGRAPVLRSGAKNGSMVAVAGALGRSAAGYALWHKGIDGFDDLRRR
HLVPEPPYGKGVAAAACGAQAMIDVSDGLIADLRHVARASGVSIDLSTAA
LAADHAALIAAATAVGGDPWPWVLGGGEDHALVACFAGTALSGWRIIGRV
FDGPARVLVDGQEWRGHAGWQSFGG
>C4
VCNHECGALGESVTLEQLGEFAVIDRLVRGRRQPAVVALGPGDDAAVVTA
SDGRIVVSTDVLVQDRHFRLDWSTPHDVGRKAIAQNAADIEAMGARATTF
VVGLGAPGDTPVAQVDALVDGLWDEAGRIGAGIVGGDLVSCPQWVLSVTV
LGDLDGRAPVLRSGAKNGSMVAVAGALGRSAAGYALWHKGIDGFDDLRRR
HLVPEPPYGKGVAAAACGAQAMIDVSDGLIADLRHVARASGVSIDLSTAA
LAADHAALIAAATAVGGDPWPWVLGGGEDHALVACFAGTALSGWRIIGRV
FDGPARVLVDGQEWRGHAGWQSFGG
>C5
VCNHECGALGESVTLEQLGEFAVIDRLVRGRRQPAVVALGPGDDAAVVTA
SDGRIVVSTDVLVQDRHFRLDWSTPHDVGRKAIAQNAADIEAMGARATTF
VVGLGAPGDTPVAQVDALVDGLWDEAGRIGAGIVGGDLVSCPQWVLSVTV
LGDLDGRAPVLRSGAKNGSMVAVAGALGRSAAGYALWHKGIDGFDDLRRR
HLVPEPPYGKGVAAAACGAQAMIDVSDGLIADLRHVARASGVSIDLSTAA
LAADHAALIAAATAVGGDPWPWVLGGGEDHALVACFAGTALSGWRIIGRV
FDGPARVLVDGQEWRGHAGWQSFGG
>C6
VCNHECGALGESVTLEQLGEFAVIDRLVRGRRQPAVVALGPGDDAAVVTA
SDGRIVVSTDVLVQDRHFRLDWSTPHDVGRKAIAQNAADIEAMGARATTF
VVGLGAPGDTPVAQVDALVDGLWDEAGRIGAGIVGGDLVSCPQWVLSVTV
LGDLDGRAPVLRSGAKNGSMVAVAGALGRSAAGYALWHKGIDGFDDLRRR
HLVPEPPYGKGVAAAACGAQAMIDVSDGLIADLRHVARASGVSIDLSTAA
LAADHAALIAAATAVGGDPWPWVLGGGEDHALVACFAGTALSGWRIIGRV
FDGPARVLVDGQEWRGHAGWQSFGG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=325
C1 VCNHECGALGESVTLEQLGEFAVIDRLVRGRRQPAVVALGPGDDAAVVTA
C2 VCNHECGALGESVTLEQLGEFAVIDRLVRGRRQPAVVALGPGDDAAVVTA
C3 VCNHECGALGESVTLEQLGEFAVIDRLVRGRRQPAVVALGPGDDAAVVTA
C4 VCNHECGALGESVTLEQLGEFAVIDRLVRGRRQPAVVALGPGDDAAVVTA
C5 VCNHECGALGESVTLEQLGEFAVIDRLVRGRRQPAVVALGPGDDAAVVTA
C6 VCNHECGALGESVTLEQLGEFAVIDRLVRGRRQPAVVALGPGDDAAVVTA
**************************************************
C1 SDGRIVVSTDVLVQDRHFRLDWSTPHDVGRKAIAQNAADIEAMGARATTF
C2 SDGRIVVSTDVLVQDRHFRLDWSTPHDVGRKAIAQNAADIEAMGARATTF
C3 SDGRIVVSTDVLVQDRHFRLDWSTPHDVGRKAIAQNAADIEAMGARATTF
C4 SDGRIVVSTDVLVQDRHFRLDWSTPHDVGRKAIAQNAADIEAMGARATTF
C5 SDGRIVVSTDVLVQDRHFRLDWSTPHDVGRKAIAQNAADIEAMGARATTF
C6 SDGRIVVSTDVLVQDRHFRLDWSTPHDVGRKAIAQNAADIEAMGARATTF
**************************************************
C1 VVGLGAPGDTPVAQVDALVDGLWDEAGRIGAGIVGGDLVSCPQWVLSVTV
C2 VVGLGAPGDTPVAQVDALVDGLWDEAGRIGAGIVGGDLVSCPQWVLSVTV
C3 VVGLGAPGDTPVAQVDALVDGLWDEAGRIGAGIVGGDLVSCPQWVLSVTV
C4 VVGLGAPGDTPVAQVDALVDGLWDEAGRIGAGIVGGDLVSCPQWVLSVTV
C5 VVGLGAPGDTPVAQVDALVDGLWDEAGRIGAGIVGGDLVSCPQWVLSVTV
C6 VVGLGAPGDTPVAQVDALVDGLWDEAGRIGAGIVGGDLVSCPQWVLSVTV
**************************************************
C1 LGDLDGRAPVLRSGAKNGSMVAVAGALGRSAAGYALWHKGIDGFDDLRRR
C2 LGDLDGRAPVLRSGAKNGSMVAVAGALGRSAAGYALWHKGIDGFDDLRRR
C3 LGDLDGRAPVLRSGAKNGSMVAVAGALGRSAAGYALWHKGIDGFDDLRRR
C4 LGDLDGRAPVLRSGAKNGSMVAVAGALGRSAAGYALWHKGIDGFDDLRRR
C5 LGDLDGRAPVLRSGAKNGSMVAVAGALGRSAAGYALWHKGIDGFDDLRRR
C6 LGDLDGRAPVLRSGAKNGSMVAVAGALGRSAAGYALWHKGIDGFDDLRRR
**************************************************
C1 HLVPEPPYGKGVAAAACGAQAMIDVSDGLIADLRHVARASGVSIDLSTAA
C2 HLVPEPPYGKGVAAAACGAQAMIDVSDGLIADLRHVARASGVSIDLSTAA
C3 HLVPEPPYGKGVAAAACGAQAMIDVSDGLIADLRHVARASGVSIDLSTAA
C4 HLVPEPPYGKGVAAAACGAQAMIDVSDGLIADLRHVARASGVSIDLSTAA
C5 HLVPEPPYGKGVAAAACGAQAMIDVSDGLIADLRHVARASGVSIDLSTAA
C6 HLVPEPPYGKGVAAAACGAQAMIDVSDGLIADLRHVARASGVSIDLSTAA
**************************************************
C1 LAADHAALIAAATAVGGDPWPWVLGGGEDHALVACFAGTALSGWRIIGRV
C2 LAADHAALIAAATAVGGDPWPWVLGGGEDHALVACFAGTALSGWRIIGRV
C3 LAADHAALIAAATAVGGDPWPWVLGGGEDHALVACFAGTALSGWRIIGRV
C4 LAADHAALIAAATAVGGDPWPWVLGGGEDHALVACFAGTALSGWRIIGRV
C5 LAADHAALIAAATAVGGDPWPWVLGGGEDHALVACFAGTALSGWRIIGRV
C6 LAADHAALIAAATAVGGDPWPWVLGGGEDHALVACFAGTALSGWRIIGRV
**************************************************
C1 FDGPARVLVDGQEWRGHAGWQSFGG
C2 FDGPARVLVDGQEWRGHAGWQSFGG
C3 FDGPARVLVDGQEWRGHAGWQSFGG
C4 FDGPARVLVDGQEWRGHAGWQSFGG
C5 FDGPARVLVDGQEWRGHAGWQSFGG
C6 FDGPARVLVDGQEWRGHAGWQSFGG
*************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 325 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 325 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9750]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [9750]--->[9750]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.503 Mb, Max= 30.881 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VCNHECGALGESVTLEQLGEFAVIDRLVRGRRQPAVVALGPGDDAAVVTA
C2 VCNHECGALGESVTLEQLGEFAVIDRLVRGRRQPAVVALGPGDDAAVVTA
C3 VCNHECGALGESVTLEQLGEFAVIDRLVRGRRQPAVVALGPGDDAAVVTA
C4 VCNHECGALGESVTLEQLGEFAVIDRLVRGRRQPAVVALGPGDDAAVVTA
C5 VCNHECGALGESVTLEQLGEFAVIDRLVRGRRQPAVVALGPGDDAAVVTA
C6 VCNHECGALGESVTLEQLGEFAVIDRLVRGRRQPAVVALGPGDDAAVVTA
**************************************************
C1 SDGRIVVSTDVLVQDRHFRLDWSTPHDVGRKAIAQNAADIEAMGARATTF
C2 SDGRIVVSTDVLVQDRHFRLDWSTPHDVGRKAIAQNAADIEAMGARATTF
C3 SDGRIVVSTDVLVQDRHFRLDWSTPHDVGRKAIAQNAADIEAMGARATTF
C4 SDGRIVVSTDVLVQDRHFRLDWSTPHDVGRKAIAQNAADIEAMGARATTF
C5 SDGRIVVSTDVLVQDRHFRLDWSTPHDVGRKAIAQNAADIEAMGARATTF
C6 SDGRIVVSTDVLVQDRHFRLDWSTPHDVGRKAIAQNAADIEAMGARATTF
**************************************************
C1 VVGLGAPGDTPVAQVDALVDGLWDEAGRIGAGIVGGDLVSCPQWVLSVTV
C2 VVGLGAPGDTPVAQVDALVDGLWDEAGRIGAGIVGGDLVSCPQWVLSVTV
C3 VVGLGAPGDTPVAQVDALVDGLWDEAGRIGAGIVGGDLVSCPQWVLSVTV
C4 VVGLGAPGDTPVAQVDALVDGLWDEAGRIGAGIVGGDLVSCPQWVLSVTV
C5 VVGLGAPGDTPVAQVDALVDGLWDEAGRIGAGIVGGDLVSCPQWVLSVTV
C6 VVGLGAPGDTPVAQVDALVDGLWDEAGRIGAGIVGGDLVSCPQWVLSVTV
**************************************************
C1 LGDLDGRAPVLRSGAKNGSMVAVAGALGRSAAGYALWHKGIDGFDDLRRR
C2 LGDLDGRAPVLRSGAKNGSMVAVAGALGRSAAGYALWHKGIDGFDDLRRR
C3 LGDLDGRAPVLRSGAKNGSMVAVAGALGRSAAGYALWHKGIDGFDDLRRR
C4 LGDLDGRAPVLRSGAKNGSMVAVAGALGRSAAGYALWHKGIDGFDDLRRR
C5 LGDLDGRAPVLRSGAKNGSMVAVAGALGRSAAGYALWHKGIDGFDDLRRR
C6 LGDLDGRAPVLRSGAKNGSMVAVAGALGRSAAGYALWHKGIDGFDDLRRR
**************************************************
C1 HLVPEPPYGKGVAAAACGAQAMIDVSDGLIADLRHVARASGVSIDLSTAA
C2 HLVPEPPYGKGVAAAACGAQAMIDVSDGLIADLRHVARASGVSIDLSTAA
C3 HLVPEPPYGKGVAAAACGAQAMIDVSDGLIADLRHVARASGVSIDLSTAA
C4 HLVPEPPYGKGVAAAACGAQAMIDVSDGLIADLRHVARASGVSIDLSTAA
C5 HLVPEPPYGKGVAAAACGAQAMIDVSDGLIADLRHVARASGVSIDLSTAA
C6 HLVPEPPYGKGVAAAACGAQAMIDVSDGLIADLRHVARASGVSIDLSTAA
**************************************************
C1 LAADHAALIAAATAVGGDPWPWVLGGGEDHALVACFAGTALSGWRIIGRV
C2 LAADHAALIAAATAVGGDPWPWVLGGGEDHALVACFAGTALSGWRIIGRV
C3 LAADHAALIAAATAVGGDPWPWVLGGGEDHALVACFAGTALSGWRIIGRV
C4 LAADHAALIAAATAVGGDPWPWVLGGGEDHALVACFAGTALSGWRIIGRV
C5 LAADHAALIAAATAVGGDPWPWVLGGGEDHALVACFAGTALSGWRIIGRV
C6 LAADHAALIAAATAVGGDPWPWVLGGGEDHALVACFAGTALSGWRIIGRV
**************************************************
C1 FDGPARVLVDGQEWRGHAGWQSFGG
C2 FDGPARVLVDGQEWRGHAGWQSFGG
C3 FDGPARVLVDGQEWRGHAGWQSFGG
C4 FDGPARVLVDGQEWRGHAGWQSFGG
C5 FDGPARVLVDGQEWRGHAGWQSFGG
C6 FDGPARVLVDGQEWRGHAGWQSFGG
*************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGTGCAACCATGAATGTGGGGCGTTAGGGGAGTCTGTAACGCTTGAGCA
C2 GTGTGCAACCATGAATGTGGGGCGTTAGGGGAGTCTGTAACGCTTGAGCA
C3 GTGTGCAACCATGAATGTGGGGCGTTAGGGGAGTCTGTAACGCTTGAGCA
C4 GTGTGCAACCATGAATGTGGGGCGTTAGGGGAGTCTGTAACGCTTGAGCA
C5 GTGTGCAACCATGAATGTGGGGCGTTAGGGGAGTCTGTAACGCTTGAGCA
C6 GTGTGCAACCATGAATGTGGGGCGTTAGGGGAGTCTGTAACGCTTGAGCA
**************************************************
C1 GCTCGGTGAGTTCGCGGTAATCGACCGGCTGGTGCGAGGCCGCAGGCAGC
C2 GCTCGGTGAGTTCGCGGTAATCGACCGGCTGGTGCGAGGCCGCAGGCAGC
C3 GCTCGGTGAGTTCGCGGTAATCGACCGGCTGGTGCGAGGCCGCAGGCAGC
C4 GCTCGGTGAGTTCGCGGTAATCGACCGGCTGGTGCGAGGCCGCAGGCAGC
C5 GCTCGGTGAGTTCGCGGTAATCGACCGGCTGGTGCGAGGCCGCAGGCAGC
C6 GCTCGGTGAGTTCGCGGTAATCGACCGGCTGGTGCGAGGCCGCAGGCAGC
**************************************************
C1 CGGCTGTGGTCGCACTCGGGCCCGGCGATGATGCAGCGGTGGTGACTGCC
C2 CGGCTGTGGTCGCACTCGGGCCCGGCGATGATGCAGCGGTGGTGACTGCC
C3 CGGCTGTGGTCGCACTCGGGCCCGGCGATGATGCAGCGGTGGTGACTGCC
C4 CGGCTGTGGTCGCACTCGGGCCCGGCGATGATGCAGCGGTGGTGACTGCC
C5 CGGCTGTGGTCGCACTCGGGCCCGGCGATGATGCAGCGGTGGTGACTGCC
C6 CGGCTGTGGTCGCACTCGGGCCCGGCGATGATGCAGCGGTGGTGACTGCC
**************************************************
C1 AGCGACGGTCGCATCGTGGTATCAACAGATGTGTTGGTGCAGGATCGCCA
C2 AGCGACGGTCGCATCGTGGTATCAACAGATGTGTTGGTGCAGGATCGCCA
C3 AGCGACGGTCGCATCGTGGTATCAACAGATGTGTTGGTGCAGGATCGCCA
C4 AGCGACGGTCGCATCGTGGTATCAACAGATGTGTTGGTGCAGGATCGCCA
C5 AGCGACGGTCGCATCGTGGTATCAACAGATGTGTTGGTGCAGGATCGCCA
C6 AGCGACGGTCGCATCGTGGTATCAACAGATGTGTTGGTGCAGGATCGCCA
**************************************************
C1 TTTCCGGCTGGACTGGTCAACACCGCACGATGTCGGCCGTAAGGCAATCG
C2 TTTCCGGCTGGACTGGTCAACACCGCACGATGTCGGCCGTAAGGCAATCG
C3 TTTCCGGCTGGACTGGTCAACACCGCACGATGTCGGCCGTAAGGCAATCG
C4 TTTCCGGCTGGACTGGTCAACACCGCACGATGTCGGCCGTAAGGCAATCG
C5 TTTCCGGCTGGACTGGTCAACACCGCACGATGTCGGCCGTAAGGCAATCG
C6 TTTCCGGCTGGACTGGTCAACACCGCACGATGTCGGCCGTAAGGCAATCG
**************************************************
C1 CGCAGAACGCGGCCGACATAGAGGCGATGGGGGCGCGGGCCACCACATTC
C2 CGCAGAACGCGGCCGACATAGAGGCGATGGGGGCGCGGGCCACCACATTC
C3 CGCAGAACGCGGCCGACATAGAGGCGATGGGGGCGCGGGCCACCACATTC
C4 CGCAGAACGCGGCCGACATAGAGGCGATGGGGGCGCGGGCCACCACATTC
C5 CGCAGAACGCGGCCGACATAGAGGCGATGGGGGCGCGGGCCACCACATTC
C6 CGCAGAACGCGGCCGACATAGAGGCGATGGGGGCGCGGGCCACCACATTC
**************************************************
C1 GTTGTGGGTTTGGGAGCGCCTGGTGATACGCCGGTGGCGCAGGTGGACGC
C2 GTTGTGGGTTTGGGAGCGCCTGGTGATACGCCGGTGGCGCAGGTGGACGC
C3 GTTGTGGGTTTGGGAGCGCCTGGTGATACGCCGGTGGCGCAGGTGGACGC
C4 GTTGTGGGTTTGGGAGCGCCTGGTGATACGCCGGTGGCGCAGGTGGACGC
C5 GTTGTGGGTTTGGGAGCGCCTGGTGATACGCCGGTGGCGCAGGTGGACGC
C6 GTTGTGGGTTTGGGAGCGCCTGGTGATACGCCGGTGGCGCAGGTGGACGC
**************************************************
C1 GTTGGTCGATGGGCTGTGGGACGAGGCCGGGCGCATTGGTGCCGGCATCG
C2 GTTGGTCGATGGGCTGTGGGACGAGGCCGGGCGCATTGGTGCCGGCATCG
C3 GTTGGTCGATGGGCTGTGGGACGAGGCCGGGCGCATTGGTGCCGGCATCG
C4 GTTGGTCGATGGGCTGTGGGACGAGGCCGGGCGCATTGGTGCCGGCATCG
C5 GTTGGTCGATGGGCTGTGGGACGAGGCCGGGCGCATTGGTGCCGGCATCG
C6 GTTGGTCGATGGGCTGTGGGACGAGGCCGGGCGCATTGGTGCCGGCATCG
**************************************************
C1 TCGGCGGCGATTTAGTTAGCTGTCCTCAATGGGTGCTCTCCGTTACCGTG
C2 TCGGCGGCGATTTAGTTAGCTGTCCTCAATGGGTGCTCTCCGTTACCGTG
C3 TCGGCGGCGATTTAGTTAGCTGTCCTCAATGGGTGCTCTCCGTTACCGTG
C4 TCGGCGGCGATTTAGTTAGCTGTCCTCAATGGGTGCTCTCCGTTACCGTG
C5 TCGGCGGCGATTTAGTTAGCTGTCCTCAATGGGTGCTCTCCGTTACCGTG
C6 TCGGCGGCGATTTAGTTAGCTGTCCTCAATGGGTGCTCTCCGTTACCGTG
**************************************************
C1 TTGGGCGATCTTGACGGCCGCGCACCAGTATTGCGGTCTGGGGCTAAAAA
C2 TTGGGCGATCTTGACGGCCGCGCACCAGTATTGCGGTCTGGGGCTAAAAA
C3 TTGGGCGATCTTGACGGCCGCGCACCAGTATTGCGGTCTGGGGCTAAAAA
C4 TTGGGCGATCTTGACGGCCGCGCACCAGTATTGCGGTCTGGGGCTAAAAA
C5 TTGGGCGATCTTGACGGCCGCGCACCAGTATTGCGGTCTGGGGCTAAAAA
C6 TTGGGCGATCTTGACGGCCGCGCACCAGTATTGCGGTCTGGGGCTAAAAA
**************************************************
C1 CGGCTCCATGGTTGCTGTCGCTGGCGCCCTGGGTCGCTCGGCTGCCGGTT
C2 CGGCTCCATGGTTGCTGTCGCTGGCGCCCTGGGTCGCTCGGCTGCCGGTT
C3 CGGCTCCATGGTTGCTGTCGCTGGCGCCCTGGGTCGCTCGGCTGCCGGTT
C4 CGGCTCCATGGTTGCTGTCGCTGGCGCCCTGGGTCGCTCGGCTGCCGGTT
C5 CGGCTCCATGGTTGCTGTCGCTGGCGCCCTGGGTCGCTCGGCTGCCGGTT
C6 CGGCTCCATGGTTGCTGTCGCTGGCGCCCTGGGTCGCTCGGCTGCCGGTT
**************************************************
C1 ATGCCCTGTGGCATAAAGGGATTGACGGATTCGATGATCTGCGGCGCCGT
C2 ATGCCCTGTGGCATAAAGGGATTGACGGATTCGATGATCTGCGGCGCCGT
C3 ATGCCCTGTGGCATAAAGGGATTGACGGATTCGATGATCTGCGGCGCCGT
C4 ATGCCCTGTGGCATAAAGGGATTGACGGATTCGATGATCTGCGGCGCCGT
C5 ATGCCCTGTGGCATAAAGGGATTGACGGATTCGATGATCTGCGGCGCCGT
C6 ATGCCCTGTGGCATAAAGGGATTGACGGATTCGATGATCTGCGGCGCCGT
**************************************************
C1 CATCTGGTGCCTGAGCCGCCATATGGTAAGGGGGTTGCTGCTGCGGCTTG
C2 CATCTGGTGCCTGAGCCGCCATATGGTAAGGGGGTTGCTGCTGCGGCTTG
C3 CATCTGGTGCCTGAGCCGCCATATGGTAAGGGGGTTGCTGCTGCGGCTTG
C4 CATCTGGTGCCTGAGCCGCCATATGGTAAGGGGGTTGCTGCTGCGGCTTG
C5 CATCTGGTGCCTGAGCCGCCATATGGTAAGGGGGTTGCTGCTGCGGCTTG
C6 CATCTGGTGCCTGAGCCGCCATATGGTAAGGGGGTTGCTGCTGCGGCTTG
**************************************************
C1 CGGGGCTCAAGCAATGATCGACGTCTCCGACGGTCTGATCGCCGACCTGC
C2 CGGGGCTCAAGCAATGATCGACGTCTCCGACGGTCTGATCGCCGACCTGC
C3 CGGGGCTCAAGCAATGATCGACGTCTCCGACGGTCTGATCGCCGACCTGC
C4 CGGGGCTCAAGCAATGATCGACGTCTCCGACGGTCTGATCGCCGACCTGC
C5 CGGGGCTCAAGCAATGATCGACGTCTCCGACGGTCTGATCGCCGACCTGC
C6 CGGGGCTCAAGCAATGATCGACGTCTCCGACGGTCTGATCGCCGACCTGC
**************************************************
C1 GTCACGTCGCGCGGGCATCCGGGGTGTCGATTGACCTATCCACCGCGGCG
C2 GTCACGTCGCGCGGGCATCCGGGGTGTCGATTGACCTATCCACCGCGGCG
C3 GTCACGTCGCGCGGGCATCCGGGGTGTCGATTGACCTATCCACCGCGGCG
C4 GTCACGTCGCGCGGGCATCCGGGGTGTCGATTGACCTATCCACCGCGGCG
C5 GTCACGTCGCGCGGGCATCCGGGGTGTCGATTGACCTATCCACCGCGGCG
C6 GTCACGTCGCGCGGGCATCCGGGGTGTCGATTGACCTATCCACCGCGGCG
**************************************************
C1 CTGGCTGCAGACCACGCCGCGCTGATTGCAGCCGCGACCGCGGTGGGCGG
C2 CTGGCTGCAGACCACGCCGCGCTGATTGCAGCCGCGACCGCGGTGGGCGG
C3 CTGGCTGCAGACCACGCCGCGCTGATTGCAGCCGCGACCGCGGTGGGCGG
C4 CTGGCTGCAGACCACGCCGCGCTGATTGCAGCCGCGACCGCGGTGGGCGG
C5 CTGGCTGCAGACCACGCCGCGCTGATTGCAGCCGCGACCGCGGTGGGCGG
C6 CTGGCTGCAGACCACGCCGCGCTGATTGCAGCCGCGACCGCGGTGGGCGG
**************************************************
C1 TGATCCGTGGCCGTGGGTGCTGGGTGGCGGTGAAGACCACGCCCTGGTGG
C2 TGATCCGTGGCCGTGGGTGCTGGGTGGCGGTGAAGACCACGCCCTGGTGG
C3 TGATCCGTGGCCGTGGGTGCTGGGTGGCGGTGAAGACCACGCCCTGGTGG
C4 TGATCCGTGGCCGTGGGTGCTGGGTGGCGGTGAAGACCACGCCCTGGTGG
C5 TGATCCGTGGCCGTGGGTGCTGGGTGGCGGTGAAGACCACGCCCTGGTGG
C6 TGATCCGTGGCCGTGGGTGCTGGGTGGCGGTGAAGACCACGCCCTGGTGG
**************************************************
C1 CCTGTTTCGCCGGTACGGCACTGTCTGGCTGGCGCATCATCGGGCGGGTA
C2 CCTGTTTCGCCGGTACGGCACTGTCTGGCTGGCGCATCATCGGGCGGGTA
C3 CCTGTTTCGCCGGTACGGCACTGTCTGGCTGGCGCATCATCGGGCGGGTA
C4 CCTGTTTCGCCGGTACGGCACTGTCTGGCTGGCGCATCATCGGGCGGGTA
C5 CCTGTTTCGCCGGTACGGCACTGTCTGGCTGGCGCATCATCGGGCGGGTA
C6 CCTGTTTCGCCGGTACGGCACTGTCTGGCTGGCGCATCATCGGGCGGGTA
**************************************************
C1 TTCGACGGGCCTGCCAGGGTGCTTGTCGATGGGCAGGAGTGGCGGGGACA
C2 TTCGACGGGCCTGCCAGGGTGCTTGTCGATGGGCAGGAGTGGCGGGGACA
C3 TTCGACGGGCCTGCCAGGGTGCTTGTCGATGGGCAGGAGTGGCGGGGACA
C4 TTCGACGGGCCTGCCAGGGTGCTTGTCGATGGGCAGGAGTGGCGGGGACA
C5 TTCGACGGGCCTGCCAGGGTGCTTGTCGATGGGCAGGAGTGGCGGGGACA
C6 TTCGACGGGCCTGCCAGGGTGCTTGTCGATGGGCAGGAGTGGCGGGGACA
**************************************************
C1 TGCGGGTTGGCAATCCTTTGGAGGT
C2 TGCGGGTTGGCAATCCTTTGGAGGT
C3 TGCGGGTTGGCAATCCTTTGGAGGT
C4 TGCGGGTTGGCAATCCTTTGGAGGT
C5 TGCGGGTTGGCAATCCTTTGGAGGT
C6 TGCGGGTTGGCAATCCTTTGGAGGT
*************************
>C1
GTGTGCAACCATGAATGTGGGGCGTTAGGGGAGTCTGTAACGCTTGAGCA
GCTCGGTGAGTTCGCGGTAATCGACCGGCTGGTGCGAGGCCGCAGGCAGC
CGGCTGTGGTCGCACTCGGGCCCGGCGATGATGCAGCGGTGGTGACTGCC
AGCGACGGTCGCATCGTGGTATCAACAGATGTGTTGGTGCAGGATCGCCA
TTTCCGGCTGGACTGGTCAACACCGCACGATGTCGGCCGTAAGGCAATCG
CGCAGAACGCGGCCGACATAGAGGCGATGGGGGCGCGGGCCACCACATTC
GTTGTGGGTTTGGGAGCGCCTGGTGATACGCCGGTGGCGCAGGTGGACGC
GTTGGTCGATGGGCTGTGGGACGAGGCCGGGCGCATTGGTGCCGGCATCG
TCGGCGGCGATTTAGTTAGCTGTCCTCAATGGGTGCTCTCCGTTACCGTG
TTGGGCGATCTTGACGGCCGCGCACCAGTATTGCGGTCTGGGGCTAAAAA
CGGCTCCATGGTTGCTGTCGCTGGCGCCCTGGGTCGCTCGGCTGCCGGTT
ATGCCCTGTGGCATAAAGGGATTGACGGATTCGATGATCTGCGGCGCCGT
CATCTGGTGCCTGAGCCGCCATATGGTAAGGGGGTTGCTGCTGCGGCTTG
CGGGGCTCAAGCAATGATCGACGTCTCCGACGGTCTGATCGCCGACCTGC
GTCACGTCGCGCGGGCATCCGGGGTGTCGATTGACCTATCCACCGCGGCG
CTGGCTGCAGACCACGCCGCGCTGATTGCAGCCGCGACCGCGGTGGGCGG
TGATCCGTGGCCGTGGGTGCTGGGTGGCGGTGAAGACCACGCCCTGGTGG
CCTGTTTCGCCGGTACGGCACTGTCTGGCTGGCGCATCATCGGGCGGGTA
TTCGACGGGCCTGCCAGGGTGCTTGTCGATGGGCAGGAGTGGCGGGGACA
TGCGGGTTGGCAATCCTTTGGAGGT
>C2
GTGTGCAACCATGAATGTGGGGCGTTAGGGGAGTCTGTAACGCTTGAGCA
GCTCGGTGAGTTCGCGGTAATCGACCGGCTGGTGCGAGGCCGCAGGCAGC
CGGCTGTGGTCGCACTCGGGCCCGGCGATGATGCAGCGGTGGTGACTGCC
AGCGACGGTCGCATCGTGGTATCAACAGATGTGTTGGTGCAGGATCGCCA
TTTCCGGCTGGACTGGTCAACACCGCACGATGTCGGCCGTAAGGCAATCG
CGCAGAACGCGGCCGACATAGAGGCGATGGGGGCGCGGGCCACCACATTC
GTTGTGGGTTTGGGAGCGCCTGGTGATACGCCGGTGGCGCAGGTGGACGC
GTTGGTCGATGGGCTGTGGGACGAGGCCGGGCGCATTGGTGCCGGCATCG
TCGGCGGCGATTTAGTTAGCTGTCCTCAATGGGTGCTCTCCGTTACCGTG
TTGGGCGATCTTGACGGCCGCGCACCAGTATTGCGGTCTGGGGCTAAAAA
CGGCTCCATGGTTGCTGTCGCTGGCGCCCTGGGTCGCTCGGCTGCCGGTT
ATGCCCTGTGGCATAAAGGGATTGACGGATTCGATGATCTGCGGCGCCGT
CATCTGGTGCCTGAGCCGCCATATGGTAAGGGGGTTGCTGCTGCGGCTTG
CGGGGCTCAAGCAATGATCGACGTCTCCGACGGTCTGATCGCCGACCTGC
GTCACGTCGCGCGGGCATCCGGGGTGTCGATTGACCTATCCACCGCGGCG
CTGGCTGCAGACCACGCCGCGCTGATTGCAGCCGCGACCGCGGTGGGCGG
TGATCCGTGGCCGTGGGTGCTGGGTGGCGGTGAAGACCACGCCCTGGTGG
CCTGTTTCGCCGGTACGGCACTGTCTGGCTGGCGCATCATCGGGCGGGTA
TTCGACGGGCCTGCCAGGGTGCTTGTCGATGGGCAGGAGTGGCGGGGACA
TGCGGGTTGGCAATCCTTTGGAGGT
>C3
GTGTGCAACCATGAATGTGGGGCGTTAGGGGAGTCTGTAACGCTTGAGCA
GCTCGGTGAGTTCGCGGTAATCGACCGGCTGGTGCGAGGCCGCAGGCAGC
CGGCTGTGGTCGCACTCGGGCCCGGCGATGATGCAGCGGTGGTGACTGCC
AGCGACGGTCGCATCGTGGTATCAACAGATGTGTTGGTGCAGGATCGCCA
TTTCCGGCTGGACTGGTCAACACCGCACGATGTCGGCCGTAAGGCAATCG
CGCAGAACGCGGCCGACATAGAGGCGATGGGGGCGCGGGCCACCACATTC
GTTGTGGGTTTGGGAGCGCCTGGTGATACGCCGGTGGCGCAGGTGGACGC
GTTGGTCGATGGGCTGTGGGACGAGGCCGGGCGCATTGGTGCCGGCATCG
TCGGCGGCGATTTAGTTAGCTGTCCTCAATGGGTGCTCTCCGTTACCGTG
TTGGGCGATCTTGACGGCCGCGCACCAGTATTGCGGTCTGGGGCTAAAAA
CGGCTCCATGGTTGCTGTCGCTGGCGCCCTGGGTCGCTCGGCTGCCGGTT
ATGCCCTGTGGCATAAAGGGATTGACGGATTCGATGATCTGCGGCGCCGT
CATCTGGTGCCTGAGCCGCCATATGGTAAGGGGGTTGCTGCTGCGGCTTG
CGGGGCTCAAGCAATGATCGACGTCTCCGACGGTCTGATCGCCGACCTGC
GTCACGTCGCGCGGGCATCCGGGGTGTCGATTGACCTATCCACCGCGGCG
CTGGCTGCAGACCACGCCGCGCTGATTGCAGCCGCGACCGCGGTGGGCGG
TGATCCGTGGCCGTGGGTGCTGGGTGGCGGTGAAGACCACGCCCTGGTGG
CCTGTTTCGCCGGTACGGCACTGTCTGGCTGGCGCATCATCGGGCGGGTA
TTCGACGGGCCTGCCAGGGTGCTTGTCGATGGGCAGGAGTGGCGGGGACA
TGCGGGTTGGCAATCCTTTGGAGGT
>C4
GTGTGCAACCATGAATGTGGGGCGTTAGGGGAGTCTGTAACGCTTGAGCA
GCTCGGTGAGTTCGCGGTAATCGACCGGCTGGTGCGAGGCCGCAGGCAGC
CGGCTGTGGTCGCACTCGGGCCCGGCGATGATGCAGCGGTGGTGACTGCC
AGCGACGGTCGCATCGTGGTATCAACAGATGTGTTGGTGCAGGATCGCCA
TTTCCGGCTGGACTGGTCAACACCGCACGATGTCGGCCGTAAGGCAATCG
CGCAGAACGCGGCCGACATAGAGGCGATGGGGGCGCGGGCCACCACATTC
GTTGTGGGTTTGGGAGCGCCTGGTGATACGCCGGTGGCGCAGGTGGACGC
GTTGGTCGATGGGCTGTGGGACGAGGCCGGGCGCATTGGTGCCGGCATCG
TCGGCGGCGATTTAGTTAGCTGTCCTCAATGGGTGCTCTCCGTTACCGTG
TTGGGCGATCTTGACGGCCGCGCACCAGTATTGCGGTCTGGGGCTAAAAA
CGGCTCCATGGTTGCTGTCGCTGGCGCCCTGGGTCGCTCGGCTGCCGGTT
ATGCCCTGTGGCATAAAGGGATTGACGGATTCGATGATCTGCGGCGCCGT
CATCTGGTGCCTGAGCCGCCATATGGTAAGGGGGTTGCTGCTGCGGCTTG
CGGGGCTCAAGCAATGATCGACGTCTCCGACGGTCTGATCGCCGACCTGC
GTCACGTCGCGCGGGCATCCGGGGTGTCGATTGACCTATCCACCGCGGCG
CTGGCTGCAGACCACGCCGCGCTGATTGCAGCCGCGACCGCGGTGGGCGG
TGATCCGTGGCCGTGGGTGCTGGGTGGCGGTGAAGACCACGCCCTGGTGG
CCTGTTTCGCCGGTACGGCACTGTCTGGCTGGCGCATCATCGGGCGGGTA
TTCGACGGGCCTGCCAGGGTGCTTGTCGATGGGCAGGAGTGGCGGGGACA
TGCGGGTTGGCAATCCTTTGGAGGT
>C5
GTGTGCAACCATGAATGTGGGGCGTTAGGGGAGTCTGTAACGCTTGAGCA
GCTCGGTGAGTTCGCGGTAATCGACCGGCTGGTGCGAGGCCGCAGGCAGC
CGGCTGTGGTCGCACTCGGGCCCGGCGATGATGCAGCGGTGGTGACTGCC
AGCGACGGTCGCATCGTGGTATCAACAGATGTGTTGGTGCAGGATCGCCA
TTTCCGGCTGGACTGGTCAACACCGCACGATGTCGGCCGTAAGGCAATCG
CGCAGAACGCGGCCGACATAGAGGCGATGGGGGCGCGGGCCACCACATTC
GTTGTGGGTTTGGGAGCGCCTGGTGATACGCCGGTGGCGCAGGTGGACGC
GTTGGTCGATGGGCTGTGGGACGAGGCCGGGCGCATTGGTGCCGGCATCG
TCGGCGGCGATTTAGTTAGCTGTCCTCAATGGGTGCTCTCCGTTACCGTG
TTGGGCGATCTTGACGGCCGCGCACCAGTATTGCGGTCTGGGGCTAAAAA
CGGCTCCATGGTTGCTGTCGCTGGCGCCCTGGGTCGCTCGGCTGCCGGTT
ATGCCCTGTGGCATAAAGGGATTGACGGATTCGATGATCTGCGGCGCCGT
CATCTGGTGCCTGAGCCGCCATATGGTAAGGGGGTTGCTGCTGCGGCTTG
CGGGGCTCAAGCAATGATCGACGTCTCCGACGGTCTGATCGCCGACCTGC
GTCACGTCGCGCGGGCATCCGGGGTGTCGATTGACCTATCCACCGCGGCG
CTGGCTGCAGACCACGCCGCGCTGATTGCAGCCGCGACCGCGGTGGGCGG
TGATCCGTGGCCGTGGGTGCTGGGTGGCGGTGAAGACCACGCCCTGGTGG
CCTGTTTCGCCGGTACGGCACTGTCTGGCTGGCGCATCATCGGGCGGGTA
TTCGACGGGCCTGCCAGGGTGCTTGTCGATGGGCAGGAGTGGCGGGGACA
TGCGGGTTGGCAATCCTTTGGAGGT
>C6
GTGTGCAACCATGAATGTGGGGCGTTAGGGGAGTCTGTAACGCTTGAGCA
GCTCGGTGAGTTCGCGGTAATCGACCGGCTGGTGCGAGGCCGCAGGCAGC
CGGCTGTGGTCGCACTCGGGCCCGGCGATGATGCAGCGGTGGTGACTGCC
AGCGACGGTCGCATCGTGGTATCAACAGATGTGTTGGTGCAGGATCGCCA
TTTCCGGCTGGACTGGTCAACACCGCACGATGTCGGCCGTAAGGCAATCG
CGCAGAACGCGGCCGACATAGAGGCGATGGGGGCGCGGGCCACCACATTC
GTTGTGGGTTTGGGAGCGCCTGGTGATACGCCGGTGGCGCAGGTGGACGC
GTTGGTCGATGGGCTGTGGGACGAGGCCGGGCGCATTGGTGCCGGCATCG
TCGGCGGCGATTTAGTTAGCTGTCCTCAATGGGTGCTCTCCGTTACCGTG
TTGGGCGATCTTGACGGCCGCGCACCAGTATTGCGGTCTGGGGCTAAAAA
CGGCTCCATGGTTGCTGTCGCTGGCGCCCTGGGTCGCTCGGCTGCCGGTT
ATGCCCTGTGGCATAAAGGGATTGACGGATTCGATGATCTGCGGCGCCGT
CATCTGGTGCCTGAGCCGCCATATGGTAAGGGGGTTGCTGCTGCGGCTTG
CGGGGCTCAAGCAATGATCGACGTCTCCGACGGTCTGATCGCCGACCTGC
GTCACGTCGCGCGGGCATCCGGGGTGTCGATTGACCTATCCACCGCGGCG
CTGGCTGCAGACCACGCCGCGCTGATTGCAGCCGCGACCGCGGTGGGCGG
TGATCCGTGGCCGTGGGTGCTGGGTGGCGGTGAAGACCACGCCCTGGTGG
CCTGTTTCGCCGGTACGGCACTGTCTGGCTGGCGCATCATCGGGCGGGTA
TTCGACGGGCCTGCCAGGGTGCTTGTCGATGGGCAGGAGTGGCGGGGACA
TGCGGGTTGGCAATCCTTTGGAGGT
>C1
VCNHECGALGESVTLEQLGEFAVIDRLVRGRRQPAVVALGPGDDAAVVTA
SDGRIVVSTDVLVQDRHFRLDWSTPHDVGRKAIAQNAADIEAMGARATTF
VVGLGAPGDTPVAQVDALVDGLWDEAGRIGAGIVGGDLVSCPQWVLSVTV
LGDLDGRAPVLRSGAKNGSMVAVAGALGRSAAGYALWHKGIDGFDDLRRR
HLVPEPPYGKGVAAAACGAQAMIDVSDGLIADLRHVARASGVSIDLSTAA
LAADHAALIAAATAVGGDPWPWVLGGGEDHALVACFAGTALSGWRIIGRV
FDGPARVLVDGQEWRGHAGWQSFGG
>C2
VCNHECGALGESVTLEQLGEFAVIDRLVRGRRQPAVVALGPGDDAAVVTA
SDGRIVVSTDVLVQDRHFRLDWSTPHDVGRKAIAQNAADIEAMGARATTF
VVGLGAPGDTPVAQVDALVDGLWDEAGRIGAGIVGGDLVSCPQWVLSVTV
LGDLDGRAPVLRSGAKNGSMVAVAGALGRSAAGYALWHKGIDGFDDLRRR
HLVPEPPYGKGVAAAACGAQAMIDVSDGLIADLRHVARASGVSIDLSTAA
LAADHAALIAAATAVGGDPWPWVLGGGEDHALVACFAGTALSGWRIIGRV
FDGPARVLVDGQEWRGHAGWQSFGG
>C3
VCNHECGALGESVTLEQLGEFAVIDRLVRGRRQPAVVALGPGDDAAVVTA
SDGRIVVSTDVLVQDRHFRLDWSTPHDVGRKAIAQNAADIEAMGARATTF
VVGLGAPGDTPVAQVDALVDGLWDEAGRIGAGIVGGDLVSCPQWVLSVTV
LGDLDGRAPVLRSGAKNGSMVAVAGALGRSAAGYALWHKGIDGFDDLRRR
HLVPEPPYGKGVAAAACGAQAMIDVSDGLIADLRHVARASGVSIDLSTAA
LAADHAALIAAATAVGGDPWPWVLGGGEDHALVACFAGTALSGWRIIGRV
FDGPARVLVDGQEWRGHAGWQSFGG
>C4
VCNHECGALGESVTLEQLGEFAVIDRLVRGRRQPAVVALGPGDDAAVVTA
SDGRIVVSTDVLVQDRHFRLDWSTPHDVGRKAIAQNAADIEAMGARATTF
VVGLGAPGDTPVAQVDALVDGLWDEAGRIGAGIVGGDLVSCPQWVLSVTV
LGDLDGRAPVLRSGAKNGSMVAVAGALGRSAAGYALWHKGIDGFDDLRRR
HLVPEPPYGKGVAAAACGAQAMIDVSDGLIADLRHVARASGVSIDLSTAA
LAADHAALIAAATAVGGDPWPWVLGGGEDHALVACFAGTALSGWRIIGRV
FDGPARVLVDGQEWRGHAGWQSFGG
>C5
VCNHECGALGESVTLEQLGEFAVIDRLVRGRRQPAVVALGPGDDAAVVTA
SDGRIVVSTDVLVQDRHFRLDWSTPHDVGRKAIAQNAADIEAMGARATTF
VVGLGAPGDTPVAQVDALVDGLWDEAGRIGAGIVGGDLVSCPQWVLSVTV
LGDLDGRAPVLRSGAKNGSMVAVAGALGRSAAGYALWHKGIDGFDDLRRR
HLVPEPPYGKGVAAAACGAQAMIDVSDGLIADLRHVARASGVSIDLSTAA
LAADHAALIAAATAVGGDPWPWVLGGGEDHALVACFAGTALSGWRIIGRV
FDGPARVLVDGQEWRGHAGWQSFGG
>C6
VCNHECGALGESVTLEQLGEFAVIDRLVRGRRQPAVVALGPGDDAAVVTA
SDGRIVVSTDVLVQDRHFRLDWSTPHDVGRKAIAQNAADIEAMGARATTF
VVGLGAPGDTPVAQVDALVDGLWDEAGRIGAGIVGGDLVSCPQWVLSVTV
LGDLDGRAPVLRSGAKNGSMVAVAGALGRSAAGYALWHKGIDGFDDLRRR
HLVPEPPYGKGVAAAACGAQAMIDVSDGLIADLRHVARASGVSIDLSTAA
LAADHAALIAAATAVGGDPWPWVLGGGEDHALVACFAGTALSGWRIIGRV
FDGPARVLVDGQEWRGHAGWQSFGG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/12res/thiL/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 975 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579789854
Setting output file names to "/data/12res/thiL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 348618380
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0169203976
Seed = 715190369
Swapseed = 1579789854
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2182.096732 -- -24.965149
Chain 2 -- -2182.096400 -- -24.965149
Chain 3 -- -2182.096732 -- -24.965149
Chain 4 -- -2182.096732 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2182.096732 -- -24.965149
Chain 2 -- -2182.096732 -- -24.965149
Chain 3 -- -2182.096604 -- -24.965149
Chain 4 -- -2182.096604 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2182.097] (-2182.096) (-2182.097) (-2182.097) * [-2182.097] (-2182.097) (-2182.097) (-2182.097)
500 -- (-1348.871) (-1357.366) (-1346.150) [-1307.019] * (-1343.192) [-1300.896] (-1300.572) (-1307.722) -- 0:00:00
1000 -- (-1323.332) (-1305.086) [-1314.571] (-1299.775) * (-1345.657) (-1301.352) [-1296.009] (-1302.050) -- 0:00:00
1500 -- (-1316.705) (-1307.235) [-1305.868] (-1307.735) * (-1307.708) (-1312.574) (-1301.113) [-1302.259] -- 0:00:00
2000 -- (-1312.200) [-1302.843] (-1315.545) (-1301.748) * (-1297.830) (-1303.192) (-1303.805) [-1304.341] -- 0:00:00
2500 -- [-1299.804] (-1304.831) (-1297.188) (-1301.836) * (-1306.370) [-1295.996] (-1303.369) (-1299.143) -- 0:00:00
3000 -- [-1299.810] (-1299.156) (-1300.696) (-1308.015) * (-1306.314) [-1299.676] (-1303.360) (-1305.463) -- 0:00:00
3500 -- (-1308.651) [-1298.364] (-1304.536) (-1300.782) * (-1305.849) [-1298.655] (-1304.921) (-1301.966) -- 0:00:00
4000 -- (-1299.998) (-1304.301) [-1307.532] (-1303.426) * [-1302.228] (-1303.404) (-1302.487) (-1296.695) -- 0:00:00
4500 -- (-1303.057) (-1315.341) (-1306.546) [-1302.190] * [-1303.336] (-1297.986) (-1299.532) (-1306.398) -- 0:00:00
5000 -- (-1305.907) (-1308.304) (-1307.059) [-1305.039] * (-1308.697) (-1313.178) (-1301.851) [-1304.671] -- 0:00:00
Average standard deviation of split frequencies: 0.094281
5500 -- (-1304.628) (-1301.203) (-1299.830) [-1302.777] * (-1300.504) (-1304.992) (-1305.918) [-1307.629] -- 0:00:00
6000 -- [-1303.696] (-1300.108) (-1297.329) (-1299.030) * (-1296.431) (-1302.414) [-1295.625] (-1309.787) -- 0:00:00
6500 -- (-1306.523) [-1310.210] (-1304.100) (-1306.772) * (-1301.728) (-1302.417) (-1299.458) [-1301.355] -- 0:00:00
7000 -- [-1297.855] (-1306.348) (-1301.718) (-1310.797) * (-1304.251) (-1310.422) [-1302.251] (-1297.234) -- 0:00:00
7500 -- [-1304.039] (-1304.118) (-1301.838) (-1307.291) * (-1305.249) (-1303.600) (-1297.793) [-1303.332] -- 0:00:00
8000 -- (-1307.549) (-1303.970) [-1300.216] (-1302.133) * [-1304.326] (-1310.107) (-1304.059) (-1300.835) -- 0:00:00
8500 -- (-1306.349) (-1310.043) (-1301.303) [-1301.661] * (-1299.768) (-1314.216) (-1305.924) [-1302.207] -- 0:00:00
9000 -- (-1318.505) (-1307.714) [-1302.956] (-1299.921) * [-1302.898] (-1304.717) (-1306.384) (-1313.383) -- 0:00:00
9500 -- (-1293.539) [-1305.427] (-1302.317) (-1303.451) * [-1302.102] (-1306.712) (-1311.470) (-1306.873) -- 0:00:00
10000 -- (-1293.946) [-1298.687] (-1299.791) (-1304.468) * (-1299.672) (-1304.223) (-1307.976) [-1297.070] -- 0:00:00
Average standard deviation of split frequencies: 0.095366
10500 -- (-1292.926) (-1304.494) [-1298.159] (-1301.206) * (-1306.056) (-1300.379) (-1304.074) [-1303.482] -- 0:00:00
11000 -- (-1292.860) (-1302.080) [-1301.282] (-1304.006) * (-1302.229) (-1302.869) (-1313.902) [-1305.536] -- 0:01:29
11500 -- (-1292.889) (-1301.236) (-1307.476) [-1306.247] * (-1295.562) (-1302.128) (-1308.071) [-1301.261] -- 0:01:25
12000 -- [-1294.965] (-1302.501) (-1297.701) (-1302.215) * (-1298.936) (-1307.598) (-1308.851) [-1300.987] -- 0:01:22
12500 -- (-1295.478) [-1305.338] (-1300.603) (-1304.334) * [-1302.674] (-1303.237) (-1304.829) (-1307.619) -- 0:01:19
13000 -- [-1296.656] (-1308.529) (-1307.133) (-1300.232) * (-1309.444) (-1310.720) (-1299.845) [-1299.095] -- 0:01:15
13500 -- (-1295.320) (-1300.129) [-1302.081] (-1306.384) * (-1307.505) (-1302.736) [-1301.800] (-1307.261) -- 0:01:13
14000 -- (-1294.607) (-1309.162) [-1308.237] (-1300.720) * [-1296.709] (-1304.157) (-1299.349) (-1307.755) -- 0:01:10
14500 -- (-1294.639) [-1292.074] (-1307.230) (-1305.434) * (-1300.769) (-1309.767) [-1297.483] (-1298.333) -- 0:01:07
15000 -- (-1294.724) (-1291.750) [-1291.812] (-1301.007) * (-1298.619) [-1297.926] (-1298.706) (-1311.396) -- 0:01:05
Average standard deviation of split frequencies: 0.068133
15500 -- (-1294.721) [-1294.364] (-1293.677) (-1302.960) * (-1302.179) (-1299.284) [-1305.469] (-1302.474) -- 0:01:03
16000 -- (-1292.927) [-1291.506] (-1297.514) (-1308.017) * [-1305.461] (-1297.266) (-1299.901) (-1306.130) -- 0:01:01
16500 -- (-1291.677) [-1293.040] (-1297.465) (-1306.447) * [-1304.312] (-1311.882) (-1301.866) (-1302.377) -- 0:00:59
17000 -- [-1291.572] (-1299.029) (-1296.455) (-1310.659) * (-1301.150) [-1300.908] (-1299.112) (-1306.922) -- 0:00:57
17500 -- (-1291.657) (-1293.567) (-1292.932) [-1297.791] * (-1304.936) (-1295.399) (-1302.606) [-1302.142] -- 0:00:56
18000 -- (-1292.849) (-1294.868) (-1292.896) [-1301.596] * (-1308.727) (-1294.768) (-1304.843) [-1299.382] -- 0:00:54
18500 -- (-1293.254) [-1294.821] (-1293.122) (-1297.992) * (-1306.853) (-1294.474) [-1296.972] (-1311.426) -- 0:00:53
19000 -- [-1292.694] (-1293.192) (-1291.750) (-1302.427) * (-1302.971) [-1292.207] (-1302.131) (-1308.102) -- 0:00:51
19500 -- [-1293.962] (-1291.541) (-1291.821) (-1302.997) * [-1298.413] (-1295.688) (-1305.711) (-1292.644) -- 0:00:50
20000 -- (-1293.139) (-1291.236) (-1292.676) [-1307.641] * (-1305.916) (-1293.039) [-1301.595] (-1293.909) -- 0:00:49
Average standard deviation of split frequencies: 0.046887
20500 -- (-1292.159) [-1291.408] (-1291.501) (-1307.963) * (-1297.896) (-1293.052) (-1309.385) [-1293.588] -- 0:00:47
21000 -- (-1292.714) (-1292.684) [-1291.809] (-1301.137) * (-1300.761) [-1293.970] (-1302.076) (-1292.849) -- 0:00:46
21500 -- (-1292.707) [-1292.778] (-1292.523) (-1299.881) * [-1305.513] (-1292.148) (-1301.725) (-1295.221) -- 0:00:45
22000 -- (-1292.857) [-1292.646] (-1293.033) (-1303.821) * (-1298.619) (-1292.187) [-1296.951] (-1296.822) -- 0:00:44
22500 -- (-1293.860) [-1294.441] (-1293.937) (-1302.440) * (-1305.573) (-1294.101) [-1304.262] (-1297.618) -- 0:00:43
23000 -- [-1293.959] (-1297.474) (-1292.262) (-1301.119) * (-1302.288) [-1291.385] (-1304.718) (-1298.031) -- 0:00:42
23500 -- (-1294.966) [-1292.821] (-1291.785) (-1302.490) * (-1308.337) [-1294.737] (-1299.975) (-1299.727) -- 0:00:41
24000 -- (-1292.347) (-1292.452) [-1291.871] (-1301.029) * (-1306.459) (-1291.773) [-1299.227] (-1297.230) -- 0:00:40
24500 -- [-1296.594] (-1294.903) (-1297.357) (-1303.547) * (-1301.201) [-1295.481] (-1302.226) (-1292.359) -- 0:00:39
25000 -- (-1294.687) [-1291.324] (-1297.357) (-1303.100) * (-1301.612) (-1297.949) (-1307.872) [-1294.185] -- 0:00:39
Average standard deviation of split frequencies: 0.051803
25500 -- (-1292.787) (-1291.324) (-1291.568) [-1304.530] * (-1304.457) [-1293.552] (-1303.728) (-1293.917) -- 0:01:16
26000 -- [-1293.409] (-1291.948) (-1291.718) (-1302.590) * (-1307.538) (-1295.517) [-1305.644] (-1303.435) -- 0:01:14
26500 -- (-1293.611) [-1293.665] (-1292.129) (-1303.827) * (-1307.069) (-1294.711) (-1302.654) [-1292.590] -- 0:01:13
27000 -- (-1295.136) [-1293.029] (-1292.466) (-1302.795) * (-1300.074) (-1293.556) [-1304.909] (-1293.645) -- 0:01:12
27500 -- (-1292.621) (-1295.611) [-1294.244] (-1309.142) * (-1309.753) (-1293.238) [-1308.609] (-1292.527) -- 0:01:10
28000 -- (-1292.711) (-1295.970) (-1293.224) [-1309.322] * (-1306.286) (-1296.038) (-1302.935) [-1293.867] -- 0:01:09
28500 -- [-1292.620] (-1294.975) (-1294.013) (-1303.267) * [-1299.887] (-1293.180) (-1303.867) (-1297.030) -- 0:01:08
29000 -- [-1291.601] (-1295.569) (-1292.940) (-1301.417) * (-1303.058) [-1293.981] (-1304.574) (-1296.382) -- 0:01:06
29500 -- (-1292.314) [-1292.639] (-1294.904) (-1302.320) * (-1302.855) (-1295.069) [-1300.980] (-1293.461) -- 0:01:05
30000 -- (-1297.984) [-1294.752] (-1294.865) (-1297.537) * (-1298.634) [-1294.259] (-1306.095) (-1295.087) -- 0:01:04
Average standard deviation of split frequencies: 0.042456
30500 -- (-1300.666) (-1292.736) [-1292.636] (-1314.163) * (-1304.619) [-1293.570] (-1305.614) (-1297.927) -- 0:01:03
31000 -- (-1293.714) (-1294.476) [-1292.796] (-1314.555) * (-1309.047) (-1293.887) (-1307.928) [-1294.925] -- 0:01:02
31500 -- [-1294.064] (-1299.099) (-1296.387) (-1304.657) * (-1301.617) [-1295.472] (-1317.527) (-1297.973) -- 0:01:01
32000 -- [-1291.553] (-1297.455) (-1297.156) (-1301.813) * (-1303.756) [-1291.701] (-1306.127) (-1292.898) -- 0:01:00
32500 -- (-1293.162) (-1304.640) [-1292.774] (-1299.473) * [-1304.463] (-1291.944) (-1302.850) (-1295.234) -- 0:00:59
33000 -- [-1294.529] (-1293.391) (-1292.656) (-1297.099) * (-1303.164) [-1291.588] (-1294.123) (-1293.553) -- 0:00:58
33500 -- (-1294.686) [-1296.075] (-1294.347) (-1298.240) * (-1300.127) (-1295.495) [-1299.716] (-1293.754) -- 0:00:57
34000 -- (-1296.246) (-1297.826) [-1295.667] (-1296.058) * (-1299.591) (-1292.991) (-1299.065) [-1292.875] -- 0:00:56
34500 -- (-1293.103) [-1292.736] (-1292.551) (-1294.497) * (-1295.181) (-1292.665) [-1299.958] (-1295.909) -- 0:00:55
35000 -- (-1291.894) [-1294.909] (-1292.178) (-1297.506) * [-1300.249] (-1293.858) (-1298.196) (-1296.103) -- 0:00:55
Average standard deviation of split frequencies: 0.046865
35500 -- (-1291.056) (-1293.725) (-1293.185) [-1295.952] * (-1303.532) [-1295.459] (-1297.053) (-1296.002) -- 0:00:54
36000 -- (-1296.020) [-1294.247] (-1294.809) (-1295.237) * [-1302.441] (-1293.497) (-1303.711) (-1294.304) -- 0:00:53
36500 -- (-1292.013) (-1294.112) [-1296.908] (-1294.435) * (-1302.143) (-1293.383) (-1304.189) [-1293.744] -- 0:00:52
37000 -- (-1292.013) (-1294.521) [-1294.187] (-1296.696) * [-1301.257] (-1294.598) (-1307.023) (-1296.077) -- 0:00:52
37500 -- (-1291.998) [-1296.762] (-1294.883) (-1297.664) * (-1304.951) (-1295.493) [-1295.546] (-1294.521) -- 0:00:51
38000 -- (-1294.048) (-1292.826) [-1296.752] (-1296.629) * [-1300.120] (-1293.979) (-1300.841) (-1295.391) -- 0:00:50
38500 -- [-1292.114] (-1295.009) (-1296.224) (-1293.402) * (-1297.617) [-1293.058] (-1301.721) (-1295.266) -- 0:00:49
39000 -- (-1292.630) (-1296.868) (-1297.207) [-1295.675] * (-1299.036) (-1292.358) (-1308.394) [-1297.562] -- 0:00:49
39500 -- (-1292.767) (-1295.949) (-1298.984) [-1296.281] * (-1303.069) (-1295.709) (-1300.264) [-1293.377] -- 0:01:12
40000 -- [-1292.659] (-1294.943) (-1293.714) (-1297.255) * [-1299.266] (-1295.121) (-1327.132) (-1294.802) -- 0:01:12
Average standard deviation of split frequencies: 0.046947
40500 -- [-1296.836] (-1294.737) (-1292.231) (-1296.973) * (-1304.181) [-1293.677] (-1298.727) (-1292.410) -- 0:01:11
41000 -- [-1297.755] (-1292.967) (-1291.834) (-1295.855) * (-1300.137) (-1292.046) (-1292.516) [-1293.920] -- 0:01:10
41500 -- [-1294.503] (-1294.370) (-1292.178) (-1293.018) * (-1305.431) (-1293.268) (-1292.589) [-1292.900] -- 0:01:09
42000 -- (-1295.829) [-1295.283] (-1292.557) (-1294.388) * (-1313.106) (-1294.157) [-1291.588] (-1292.384) -- 0:01:08
42500 -- [-1293.990] (-1297.257) (-1293.157) (-1295.969) * [-1303.961] (-1299.169) (-1293.767) (-1293.393) -- 0:01:07
43000 -- [-1293.825] (-1295.660) (-1296.476) (-1294.835) * [-1299.555] (-1292.244) (-1293.052) (-1296.195) -- 0:01:06
43500 -- (-1293.139) (-1294.918) (-1293.760) [-1293.740] * (-1302.312) [-1291.446] (-1293.868) (-1295.285) -- 0:01:05
44000 -- (-1299.605) [-1293.754] (-1291.696) (-1294.881) * (-1298.552) (-1291.110) [-1291.606] (-1292.284) -- 0:01:05
44500 -- (-1294.893) (-1292.007) (-1292.175) [-1293.790] * (-1301.146) [-1292.610] (-1293.867) (-1293.980) -- 0:01:04
45000 -- (-1295.354) [-1292.164] (-1292.077) (-1292.171) * [-1301.838] (-1294.048) (-1292.304) (-1293.845) -- 0:01:03
Average standard deviation of split frequencies: 0.038197
45500 -- (-1292.691) [-1293.727] (-1292.808) (-1292.316) * [-1302.561] (-1292.562) (-1297.734) (-1292.349) -- 0:01:02
46000 -- (-1292.911) (-1292.030) (-1292.694) [-1292.920] * (-1301.871) (-1293.430) (-1295.240) [-1291.827] -- 0:01:02
46500 -- [-1293.202] (-1296.245) (-1297.226) (-1293.288) * [-1298.647] (-1297.461) (-1292.940) (-1302.127) -- 0:01:01
47000 -- (-1296.155) (-1294.254) (-1295.766) [-1293.371] * (-1307.041) [-1295.167] (-1293.418) (-1293.290) -- 0:01:00
47500 -- [-1293.967] (-1296.032) (-1296.633) (-1293.054) * (-1299.258) (-1296.377) (-1295.460) [-1292.420] -- 0:01:00
48000 -- (-1292.817) (-1295.300) (-1294.590) [-1293.981] * (-1301.088) [-1294.913] (-1293.942) (-1294.462) -- 0:00:59
48500 -- [-1293.229] (-1293.313) (-1292.270) (-1298.099) * [-1304.440] (-1292.128) (-1296.469) (-1293.568) -- 0:00:58
49000 -- [-1292.027] (-1292.380) (-1294.121) (-1293.144) * (-1298.625) [-1292.126] (-1292.817) (-1291.117) -- 0:00:58
49500 -- [-1292.256] (-1292.316) (-1295.725) (-1293.351) * (-1301.953) (-1291.879) (-1293.723) [-1292.160] -- 0:00:57
50000 -- [-1293.050] (-1292.682) (-1292.009) (-1295.949) * (-1303.387) [-1294.160] (-1292.350) (-1292.998) -- 0:00:57
Average standard deviation of split frequencies: 0.035102
50500 -- (-1293.095) (-1293.370) [-1293.988] (-1293.832) * (-1305.883) [-1292.726] (-1296.820) (-1291.334) -- 0:00:56
51000 -- (-1293.211) (-1292.706) (-1292.329) [-1293.310] * (-1306.986) (-1292.219) (-1291.869) [-1293.532] -- 0:00:55
51500 -- (-1292.716) (-1293.884) (-1292.475) [-1292.791] * [-1307.114] (-1294.405) (-1292.100) (-1294.687) -- 0:00:55
52000 -- (-1297.791) [-1292.599] (-1295.298) (-1292.408) * (-1301.484) (-1293.222) [-1292.848] (-1294.930) -- 0:00:54
52500 -- (-1292.613) (-1293.793) (-1294.308) [-1291.734] * [-1299.488] (-1294.674) (-1295.459) (-1291.999) -- 0:00:54
53000 -- (-1292.354) (-1293.159) (-1291.898) [-1292.308] * (-1310.184) [-1295.238] (-1295.409) (-1294.521) -- 0:00:53
53500 -- [-1295.175] (-1295.861) (-1293.666) (-1293.038) * (-1303.654) (-1294.545) (-1293.173) [-1292.040] -- 0:00:53
54000 -- (-1293.631) (-1296.291) [-1293.449] (-1294.121) * [-1300.377] (-1295.032) (-1294.204) (-1292.608) -- 0:00:52
54500 -- (-1292.576) (-1297.871) (-1291.901) [-1291.396] * (-1306.797) (-1295.099) (-1292.045) [-1292.118] -- 0:01:09
55000 -- (-1295.182) [-1296.028] (-1293.537) (-1291.392) * (-1308.519) (-1294.405) (-1292.447) [-1292.375] -- 0:01:08
Average standard deviation of split frequencies: 0.036234
55500 -- (-1293.207) (-1295.903) (-1297.601) [-1291.784] * (-1303.451) (-1292.138) [-1292.308] (-1293.494) -- 0:01:08
56000 -- [-1292.999] (-1293.410) (-1292.699) (-1294.667) * (-1302.742) [-1292.967] (-1292.011) (-1294.236) -- 0:01:07
56500 -- [-1293.638] (-1293.482) (-1292.705) (-1294.909) * [-1299.830] (-1293.052) (-1291.328) (-1295.273) -- 0:01:06
57000 -- [-1293.256] (-1293.800) (-1293.561) (-1292.504) * (-1303.641) (-1298.195) (-1293.380) [-1294.369] -- 0:01:06
57500 -- [-1291.779] (-1292.737) (-1293.622) (-1291.939) * [-1304.086] (-1295.595) (-1296.535) (-1294.369) -- 0:01:05
58000 -- (-1292.213) (-1295.481) (-1293.762) [-1292.904] * [-1303.993] (-1296.105) (-1294.619) (-1298.698) -- 0:01:04
58500 -- (-1295.690) (-1292.922) [-1294.099] (-1294.539) * [-1305.486] (-1295.758) (-1297.202) (-1300.867) -- 0:01:04
59000 -- (-1294.858) [-1292.453] (-1294.802) (-1295.319) * (-1302.237) [-1295.112] (-1296.236) (-1299.886) -- 0:01:03
59500 -- (-1294.834) (-1292.723) [-1293.996] (-1294.172) * (-1306.726) (-1294.378) [-1294.799] (-1293.987) -- 0:01:03
60000 -- (-1292.858) [-1292.845] (-1293.089) (-1293.323) * (-1310.758) (-1294.013) (-1292.183) [-1292.864] -- 0:01:02
Average standard deviation of split frequencies: 0.035892
60500 -- [-1293.966] (-1293.391) (-1299.517) (-1293.669) * (-1303.718) (-1293.357) [-1291.342] (-1292.297) -- 0:01:02
61000 -- (-1292.087) (-1292.856) (-1294.800) [-1296.509] * (-1298.928) (-1291.736) (-1294.897) [-1291.897] -- 0:01:01
61500 -- [-1291.831] (-1293.178) (-1292.692) (-1294.269) * [-1303.939] (-1292.126) (-1291.428) (-1292.447) -- 0:01:01
62000 -- [-1291.759] (-1294.079) (-1292.079) (-1293.434) * [-1300.771] (-1291.823) (-1292.317) (-1294.090) -- 0:01:00
62500 -- (-1295.090) (-1291.957) (-1292.037) [-1293.442] * [-1299.242] (-1291.340) (-1291.446) (-1293.766) -- 0:01:00
63000 -- (-1302.337) [-1291.372] (-1292.090) (-1291.370) * [-1302.251] (-1291.965) (-1295.038) (-1292.085) -- 0:00:59
63500 -- (-1302.020) (-1295.361) (-1292.814) [-1291.670] * (-1308.577) (-1291.987) [-1291.615] (-1294.733) -- 0:00:58
64000 -- [-1294.536] (-1293.173) (-1297.786) (-1293.139) * (-1308.257) (-1292.035) (-1292.123) [-1294.969] -- 0:00:58
64500 -- (-1297.139) [-1295.188] (-1296.291) (-1292.979) * (-1306.033) (-1293.853) (-1292.944) [-1295.685] -- 0:00:58
65000 -- [-1296.581] (-1294.942) (-1298.734) (-1293.930) * (-1301.382) (-1292.836) [-1292.956] (-1295.855) -- 0:00:57
Average standard deviation of split frequencies: 0.033849
65500 -- (-1293.803) (-1292.530) (-1294.677) [-1293.706] * (-1301.096) [-1292.448] (-1298.930) (-1295.449) -- 0:00:57
66000 -- (-1295.069) (-1293.781) (-1291.800) [-1293.224] * (-1308.855) [-1292.058] (-1294.455) (-1294.055) -- 0:00:56
66500 -- (-1292.901) [-1294.405] (-1291.949) (-1292.451) * (-1305.561) (-1292.177) (-1292.319) [-1295.563] -- 0:00:56
67000 -- (-1292.582) (-1295.149) [-1293.172] (-1292.518) * (-1300.356) (-1292.147) [-1293.574] (-1296.416) -- 0:00:55
67500 -- (-1292.566) (-1295.363) (-1293.725) [-1294.570] * (-1307.766) (-1292.555) [-1292.213] (-1294.530) -- 0:00:55
68000 -- [-1293.760] (-1295.717) (-1294.057) (-1292.902) * (-1299.717) (-1293.546) (-1293.521) [-1294.474] -- 0:00:54
68500 -- [-1292.668] (-1295.119) (-1293.835) (-1293.875) * (-1299.971) [-1294.062] (-1295.409) (-1295.108) -- 0:01:07
69000 -- (-1292.386) [-1293.203] (-1295.125) (-1292.382) * (-1301.881) (-1293.734) (-1292.797) [-1293.124] -- 0:01:07
69500 -- (-1294.539) [-1294.749] (-1292.952) (-1292.637) * [-1300.455] (-1294.345) (-1292.797) (-1293.196) -- 0:01:06
70000 -- (-1296.487) [-1296.776] (-1295.680) (-1293.615) * (-1309.244) (-1293.914) [-1294.196] (-1294.081) -- 0:01:06
Average standard deviation of split frequencies: 0.030454
70500 -- (-1293.917) [-1298.890] (-1297.598) (-1298.259) * (-1304.483) [-1293.255] (-1293.896) (-1294.075) -- 0:01:05
71000 -- (-1296.567) (-1295.093) (-1296.305) [-1294.187] * [-1306.788] (-1293.439) (-1294.281) (-1293.856) -- 0:01:05
71500 -- (-1291.607) (-1300.239) (-1300.176) [-1294.142] * (-1306.868) [-1292.866] (-1297.692) (-1296.042) -- 0:01:04
72000 -- (-1291.961) (-1296.523) [-1300.623] (-1296.408) * (-1301.936) [-1293.118] (-1293.373) (-1293.410) -- 0:01:04
72500 -- [-1291.861] (-1294.116) (-1304.322) (-1293.706) * [-1300.178] (-1293.550) (-1293.028) (-1296.362) -- 0:01:03
73000 -- (-1291.623) [-1293.739] (-1296.099) (-1293.123) * [-1299.423] (-1293.752) (-1294.327) (-1292.971) -- 0:01:03
73500 -- [-1292.294] (-1293.731) (-1297.271) (-1292.578) * (-1301.154) [-1296.732] (-1296.630) (-1295.114) -- 0:01:03
74000 -- (-1293.453) (-1294.258) (-1293.949) [-1294.395] * [-1297.550] (-1299.097) (-1294.892) (-1295.112) -- 0:01:02
74500 -- (-1293.019) (-1297.239) (-1294.354) [-1292.406] * (-1300.988) [-1297.672] (-1294.535) (-1293.312) -- 0:01:02
75000 -- (-1293.019) (-1293.643) (-1295.165) [-1291.494] * [-1299.474] (-1293.868) (-1294.860) (-1293.400) -- 0:01:01
Average standard deviation of split frequencies: 0.029040
75500 -- [-1293.944] (-1293.791) (-1295.113) (-1291.469) * (-1298.942) (-1293.806) [-1294.367] (-1295.088) -- 0:01:01
76000 -- (-1292.731) (-1296.485) (-1292.557) [-1292.350] * (-1304.444) (-1291.956) (-1292.880) [-1293.135] -- 0:01:00
76500 -- (-1292.947) (-1294.771) [-1293.097] (-1291.816) * (-1307.087) (-1292.661) (-1293.450) [-1293.384] -- 0:01:00
77000 -- (-1294.918) [-1292.981] (-1292.486) (-1297.073) * (-1298.826) [-1293.222] (-1291.611) (-1295.478) -- 0:00:59
77500 -- (-1293.900) (-1292.371) [-1292.405] (-1297.010) * [-1300.590] (-1293.551) (-1293.004) (-1293.546) -- 0:00:59
78000 -- [-1294.122] (-1293.753) (-1296.344) (-1292.787) * [-1296.310] (-1295.483) (-1293.445) (-1293.918) -- 0:00:59
78500 -- (-1294.421) [-1293.980] (-1295.217) (-1293.230) * (-1306.741) (-1300.631) [-1293.122] (-1292.928) -- 0:00:58
79000 -- (-1294.221) (-1294.664) (-1293.666) [-1292.122] * (-1313.499) [-1293.135] (-1291.540) (-1295.101) -- 0:00:58
79500 -- (-1295.448) [-1294.299] (-1293.569) (-1291.899) * (-1314.404) (-1297.390) (-1292.711) [-1295.456] -- 0:00:57
80000 -- (-1297.877) (-1292.092) (-1293.760) [-1292.487] * (-1305.109) (-1297.857) [-1296.785] (-1293.451) -- 0:00:57
Average standard deviation of split frequencies: 0.026451
80500 -- (-1292.695) [-1292.583] (-1294.798) (-1296.540) * [-1292.252] (-1292.777) (-1293.356) (-1293.842) -- 0:00:57
81000 -- (-1296.058) [-1293.910] (-1291.919) (-1294.232) * (-1293.446) (-1294.786) (-1299.413) [-1293.975] -- 0:00:56
81500 -- [-1295.363] (-1291.587) (-1293.693) (-1296.445) * [-1293.098] (-1291.418) (-1298.168) (-1297.099) -- 0:00:56
82000 -- (-1293.039) [-1292.728] (-1297.073) (-1294.805) * [-1292.319] (-1291.413) (-1292.354) (-1293.898) -- 0:00:55
82500 -- (-1293.795) [-1293.673] (-1294.223) (-1295.385) * [-1292.322] (-1291.418) (-1292.198) (-1294.655) -- 0:00:55
83000 -- (-1293.321) [-1293.817] (-1294.693) (-1292.380) * (-1292.991) (-1294.601) (-1293.579) [-1293.614] -- 0:01:06
83500 -- (-1293.707) (-1294.024) [-1295.710] (-1292.231) * [-1291.948] (-1293.567) (-1294.378) (-1292.644) -- 0:01:05
84000 -- [-1293.592] (-1293.447) (-1296.288) (-1293.411) * (-1295.412) (-1292.294) [-1294.575] (-1292.300) -- 0:01:05
84500 -- (-1293.951) (-1291.888) (-1296.531) [-1292.269] * (-1293.573) (-1292.204) [-1294.713] (-1291.941) -- 0:01:05
85000 -- (-1295.311) [-1291.888] (-1297.163) (-1295.025) * (-1292.105) (-1292.920) [-1291.942] (-1295.549) -- 0:01:04
Average standard deviation of split frequencies: 0.025912
85500 -- (-1297.380) (-1293.527) (-1292.875) [-1292.126] * (-1296.399) [-1292.594] (-1293.428) (-1293.928) -- 0:01:04
86000 -- (-1296.551) (-1293.993) [-1294.655] (-1293.116) * [-1294.336] (-1293.162) (-1292.456) (-1293.681) -- 0:01:03
86500 -- (-1294.711) (-1291.920) [-1293.553] (-1293.052) * (-1292.983) [-1297.154] (-1292.005) (-1296.463) -- 0:01:03
87000 -- [-1295.570] (-1293.769) (-1298.099) (-1292.556) * (-1292.671) (-1295.513) [-1291.554] (-1294.022) -- 0:01:02
87500 -- [-1296.496] (-1295.017) (-1298.387) (-1292.095) * (-1299.093) (-1294.162) [-1291.612] (-1294.361) -- 0:01:02
88000 -- (-1298.898) (-1292.542) (-1293.816) [-1292.132] * (-1296.229) (-1292.015) [-1293.305] (-1293.802) -- 0:01:02
88500 -- (-1294.455) [-1291.871] (-1294.179) (-1294.274) * [-1293.815] (-1292.915) (-1292.862) (-1292.606) -- 0:01:01
89000 -- (-1303.845) (-1292.041) [-1298.049] (-1293.606) * [-1293.659] (-1291.816) (-1293.833) (-1292.419) -- 0:01:01
89500 -- (-1292.307) (-1293.630) [-1297.795] (-1294.198) * (-1295.118) (-1291.423) (-1295.324) [-1292.794] -- 0:01:01
90000 -- (-1292.821) (-1292.624) (-1296.422) [-1295.542] * (-1293.495) (-1291.457) [-1292.488] (-1293.076) -- 0:01:00
Average standard deviation of split frequencies: 0.018434
90500 -- [-1292.820] (-1291.966) (-1294.439) (-1293.902) * (-1292.591) (-1293.178) [-1292.917] (-1293.576) -- 0:01:00
91000 -- (-1293.908) (-1294.045) [-1297.547] (-1295.661) * [-1293.671] (-1292.343) (-1299.564) (-1292.065) -- 0:00:59
91500 -- [-1294.247] (-1294.242) (-1295.416) (-1300.041) * (-1298.638) [-1293.858] (-1291.806) (-1292.937) -- 0:00:59
92000 -- (-1293.317) (-1292.121) [-1292.230] (-1293.115) * (-1292.835) (-1295.943) [-1294.676] (-1292.108) -- 0:00:59
92500 -- (-1293.163) [-1294.150] (-1292.475) (-1294.375) * (-1291.958) (-1298.886) (-1294.926) [-1292.083] -- 0:00:58
93000 -- (-1297.132) (-1295.263) [-1292.320] (-1295.797) * (-1292.107) (-1293.241) [-1294.143] (-1293.215) -- 0:00:58
93500 -- [-1295.514] (-1294.057) (-1293.675) (-1294.049) * (-1294.027) [-1297.617] (-1291.740) (-1293.213) -- 0:00:58
94000 -- (-1294.867) (-1293.238) (-1292.056) [-1295.350] * (-1295.196) [-1294.642] (-1291.942) (-1293.079) -- 0:00:57
94500 -- (-1295.384) (-1291.812) [-1294.538] (-1293.195) * (-1294.882) (-1294.014) (-1298.943) [-1293.767] -- 0:00:57
95000 -- (-1295.645) (-1291.556) (-1293.662) [-1292.765] * (-1295.888) (-1293.513) (-1294.071) [-1294.619] -- 0:00:57
Average standard deviation of split frequencies: 0.018473
95500 -- (-1296.888) (-1292.185) (-1293.871) [-1293.710] * (-1293.616) (-1293.577) (-1293.672) [-1291.872] -- 0:00:56
96000 -- (-1296.637) [-1293.381] (-1296.480) (-1293.217) * (-1294.301) (-1295.081) (-1297.711) [-1292.556] -- 0:00:56
96500 -- (-1296.034) [-1293.103] (-1294.899) (-1293.582) * [-1295.450] (-1299.951) (-1297.141) (-1292.292) -- 0:00:56
97000 -- (-1296.162) (-1292.486) [-1295.623] (-1295.970) * [-1293.251] (-1295.610) (-1298.028) (-1295.687) -- 0:00:55
97500 -- (-1295.509) (-1291.818) (-1294.105) [-1292.688] * (-1292.863) (-1294.969) (-1298.908) [-1292.884] -- 0:01:04
98000 -- (-1292.682) (-1293.364) (-1293.115) [-1293.373] * [-1293.606] (-1293.791) (-1294.142) (-1292.730) -- 0:01:04
98500 -- (-1294.298) [-1292.553] (-1293.084) (-1292.971) * [-1293.024] (-1292.758) (-1291.746) (-1293.121) -- 0:01:04
99000 -- (-1293.462) (-1293.054) (-1292.407) [-1294.707] * (-1298.522) (-1296.396) (-1291.919) [-1294.368] -- 0:01:03
99500 -- (-1292.245) [-1292.676] (-1294.459) (-1293.315) * (-1296.150) (-1296.758) [-1293.109] (-1292.897) -- 0:01:03
100000 -- (-1292.592) (-1293.151) (-1293.601) [-1292.296] * (-1294.510) (-1297.316) (-1292.793) [-1291.822] -- 0:01:02
Average standard deviation of split frequencies: 0.018991
100500 -- (-1292.104) (-1292.167) [-1293.465] (-1293.098) * (-1293.498) (-1293.058) (-1293.204) [-1292.120] -- 0:01:02
101000 -- (-1293.940) (-1291.971) (-1295.456) [-1293.331] * (-1292.652) (-1295.012) (-1293.343) [-1294.292] -- 0:01:02
101500 -- [-1293.717] (-1292.841) (-1298.042) (-1293.060) * [-1293.187] (-1292.536) (-1294.578) (-1293.361) -- 0:01:01
102000 -- [-1295.688] (-1291.605) (-1294.833) (-1293.777) * [-1295.625] (-1293.058) (-1294.055) (-1292.797) -- 0:01:01
102500 -- [-1296.855] (-1295.104) (-1297.594) (-1295.003) * (-1291.266) (-1293.366) (-1292.925) [-1293.424] -- 0:01:01
103000 -- (-1294.188) (-1296.806) (-1294.183) [-1291.843] * (-1295.087) (-1299.490) (-1294.946) [-1293.343] -- 0:01:00
103500 -- (-1294.766) (-1292.814) (-1293.837) [-1292.827] * (-1296.190) [-1291.725] (-1294.686) (-1293.840) -- 0:01:00
104000 -- (-1292.985) (-1293.277) [-1292.045] (-1292.470) * (-1293.154) [-1292.104] (-1292.922) (-1293.025) -- 0:01:00
104500 -- [-1294.041] (-1295.302) (-1291.696) (-1291.659) * (-1292.557) (-1294.574) (-1292.056) [-1295.700] -- 0:00:59
105000 -- (-1297.890) [-1294.796] (-1292.157) (-1291.973) * (-1294.077) [-1293.676] (-1292.594) (-1294.340) -- 0:00:59
Average standard deviation of split frequencies: 0.016778
105500 -- (-1291.268) (-1297.160) (-1292.436) [-1295.332] * [-1295.175] (-1291.906) (-1296.751) (-1292.789) -- 0:00:59
106000 -- (-1291.904) (-1295.393) (-1293.742) [-1292.876] * (-1294.624) (-1295.999) [-1295.397] (-1292.882) -- 0:00:59
106500 -- (-1291.453) [-1295.300] (-1292.271) (-1292.453) * (-1294.101) (-1292.991) (-1299.998) [-1292.170] -- 0:00:58
107000 -- [-1295.940] (-1293.580) (-1294.417) (-1296.789) * (-1294.390) (-1293.531) (-1292.440) [-1292.784] -- 0:00:58
107500 -- (-1297.933) [-1292.601] (-1294.331) (-1295.538) * (-1302.226) (-1292.815) (-1294.246) [-1295.254] -- 0:00:58
108000 -- (-1298.275) (-1292.503) [-1292.762] (-1294.300) * [-1291.807] (-1293.597) (-1294.118) (-1294.698) -- 0:00:57
108500 -- (-1295.518) (-1294.430) (-1292.107) [-1291.432] * (-1292.227) [-1293.230] (-1295.999) (-1293.166) -- 0:00:57
109000 -- (-1292.886) (-1293.781) [-1291.874] (-1292.063) * (-1292.584) (-1292.130) (-1294.618) [-1295.516] -- 0:00:57
109500 -- (-1295.672) (-1295.471) (-1291.984) [-1292.143] * (-1292.206) (-1292.559) (-1295.905) [-1291.786] -- 0:00:56
110000 -- (-1294.784) [-1292.246] (-1291.411) (-1292.681) * (-1293.856) (-1294.869) (-1294.751) [-1291.391] -- 0:00:56
Average standard deviation of split frequencies: 0.016590
110500 -- [-1297.777] (-1293.761) (-1291.559) (-1296.679) * (-1291.290) [-1294.683] (-1293.425) (-1294.770) -- 0:00:56
111000 -- (-1294.094) [-1294.634] (-1291.478) (-1294.348) * (-1293.831) (-1293.149) (-1292.482) [-1294.124] -- 0:00:56
111500 -- [-1294.920] (-1294.133) (-1291.478) (-1294.354) * [-1292.342] (-1293.516) (-1292.841) (-1294.291) -- 0:00:55
112000 -- (-1295.123) (-1297.041) (-1291.585) [-1292.171] * [-1291.639] (-1299.303) (-1292.297) (-1293.279) -- 0:00:55
112500 -- (-1298.917) (-1291.928) [-1293.565] (-1292.501) * [-1291.503] (-1295.472) (-1293.453) (-1293.993) -- 0:01:03
113000 -- (-1294.211) (-1292.720) [-1293.211] (-1293.578) * [-1291.950] (-1294.841) (-1294.014) (-1292.305) -- 0:01:02
113500 -- (-1292.884) (-1294.013) (-1293.633) [-1292.394] * [-1293.020] (-1293.827) (-1293.187) (-1293.937) -- 0:01:02
114000 -- (-1292.752) (-1294.932) (-1292.084) [-1292.356] * [-1292.283] (-1296.463) (-1294.320) (-1293.660) -- 0:01:02
114500 -- (-1292.841) [-1291.944] (-1291.676) (-1295.063) * (-1293.120) [-1292.559] (-1293.689) (-1296.256) -- 0:01:01
115000 -- (-1294.406) [-1292.320] (-1291.569) (-1293.613) * (-1293.835) [-1294.038] (-1293.752) (-1297.353) -- 0:01:01
Average standard deviation of split frequencies: 0.017325
115500 -- (-1293.826) (-1293.787) [-1291.152] (-1292.908) * [-1294.635] (-1294.303) (-1295.541) (-1300.693) -- 0:01:01
116000 -- (-1293.933) [-1293.213] (-1293.665) (-1293.049) * (-1293.042) (-1293.860) (-1299.567) [-1294.875] -- 0:01:00
116500 -- (-1294.477) (-1292.316) (-1292.633) [-1293.637] * [-1294.950] (-1292.021) (-1303.398) (-1295.619) -- 0:01:00
117000 -- (-1294.806) [-1292.040] (-1293.994) (-1295.048) * [-1293.769] (-1292.801) (-1293.021) (-1293.407) -- 0:01:00
117500 -- [-1293.637] (-1295.626) (-1292.586) (-1294.890) * (-1298.925) [-1292.489] (-1291.828) (-1294.861) -- 0:01:00
118000 -- (-1292.466) (-1292.903) [-1291.548] (-1295.001) * (-1298.926) (-1293.963) [-1291.739] (-1294.951) -- 0:00:59
118500 -- (-1292.389) (-1295.383) [-1291.659] (-1293.984) * (-1294.320) (-1296.599) [-1292.015] (-1293.482) -- 0:00:59
119000 -- (-1292.192) (-1295.384) [-1291.892] (-1292.392) * (-1294.077) [-1292.383] (-1292.507) (-1293.189) -- 0:00:59
119500 -- (-1293.592) (-1294.631) (-1292.276) [-1296.988] * (-1294.352) [-1291.940] (-1291.984) (-1295.020) -- 0:00:58
120000 -- (-1293.824) (-1294.274) [-1293.504] (-1301.305) * (-1297.238) (-1291.945) (-1296.399) [-1292.596] -- 0:00:58
Average standard deviation of split frequencies: 0.018882
120500 -- (-1292.263) (-1297.143) [-1294.375] (-1298.503) * [-1295.366] (-1293.866) (-1298.148) (-1292.484) -- 0:00:58
121000 -- (-1292.220) [-1295.519] (-1293.468) (-1292.649) * (-1293.156) [-1293.635] (-1293.525) (-1293.360) -- 0:00:58
121500 -- (-1292.754) (-1292.992) (-1293.344) [-1293.130] * (-1293.167) [-1291.398] (-1292.347) (-1293.329) -- 0:00:57
122000 -- (-1292.953) [-1294.185] (-1293.874) (-1293.432) * [-1293.916] (-1293.937) (-1292.593) (-1292.157) -- 0:00:57
122500 -- [-1292.771] (-1299.228) (-1294.822) (-1292.374) * (-1294.439) [-1294.371] (-1294.689) (-1293.472) -- 0:00:57
123000 -- (-1292.914) (-1296.694) [-1296.962] (-1291.490) * (-1292.523) (-1298.372) [-1293.972] (-1292.297) -- 0:00:57
123500 -- [-1293.214] (-1295.463) (-1295.075) (-1292.619) * [-1294.052] (-1296.445) (-1292.747) (-1292.510) -- 0:00:56
124000 -- (-1293.011) (-1293.454) (-1297.074) [-1292.732] * (-1293.708) [-1293.926] (-1292.161) (-1292.016) -- 0:00:56
124500 -- (-1295.335) [-1296.016] (-1293.228) (-1292.344) * [-1298.508] (-1297.237) (-1296.100) (-1292.956) -- 0:00:56
125000 -- (-1292.707) (-1300.448) (-1296.684) [-1292.048] * (-1294.833) [-1293.140] (-1294.195) (-1292.903) -- 0:00:56
Average standard deviation of split frequencies: 0.017131
125500 -- (-1292.820) (-1297.736) (-1301.383) [-1291.282] * (-1295.917) (-1294.572) [-1291.731] (-1292.903) -- 0:00:55
126000 -- [-1291.351] (-1292.816) (-1294.955) (-1291.282) * [-1292.600] (-1292.928) (-1292.213) (-1292.965) -- 0:00:55
126500 -- (-1291.372) [-1292.864] (-1296.651) (-1292.429) * (-1292.601) [-1293.979] (-1291.739) (-1295.656) -- 0:00:55
127000 -- (-1292.010) [-1294.099] (-1292.474) (-1291.649) * (-1292.869) [-1293.275] (-1292.053) (-1296.175) -- 0:00:54
127500 -- (-1292.003) [-1293.571] (-1293.096) (-1291.461) * (-1292.976) [-1292.880] (-1293.102) (-1293.149) -- 0:01:01
128000 -- (-1292.952) (-1292.262) (-1293.183) [-1292.270] * (-1292.800) (-1295.893) (-1292.347) [-1291.834] -- 0:01:01
128500 -- (-1292.783) (-1293.121) (-1295.428) [-1293.749] * [-1292.661] (-1294.458) (-1291.829) (-1293.399) -- 0:01:01
129000 -- (-1291.952) (-1293.045) (-1295.755) [-1294.340] * (-1292.064) [-1293.978] (-1294.118) (-1292.992) -- 0:01:00
129500 -- [-1291.269] (-1294.264) (-1293.053) (-1296.598) * (-1292.373) (-1292.562) (-1292.377) [-1294.242] -- 0:01:00
130000 -- (-1296.214) [-1299.334] (-1293.669) (-1296.838) * [-1292.954] (-1293.227) (-1293.619) (-1297.456) -- 0:01:00
Average standard deviation of split frequencies: 0.018760
130500 -- (-1291.551) (-1296.549) [-1293.048] (-1295.200) * (-1293.839) [-1292.016] (-1294.449) (-1297.337) -- 0:00:59
131000 -- (-1292.687) (-1291.676) [-1293.041] (-1294.485) * [-1292.424] (-1293.302) (-1295.882) (-1294.248) -- 0:00:59
131500 -- (-1292.687) (-1291.962) (-1292.703) [-1292.946] * (-1293.004) [-1291.677] (-1292.615) (-1297.405) -- 0:00:59
132000 -- (-1292.514) (-1292.715) [-1293.177] (-1294.712) * (-1293.462) (-1291.374) [-1292.171] (-1291.362) -- 0:00:59
132500 -- (-1291.854) [-1295.943] (-1292.889) (-1295.430) * [-1295.095] (-1296.618) (-1291.845) (-1293.390) -- 0:00:58
133000 -- (-1291.871) [-1292.793] (-1296.587) (-1293.424) * (-1298.133) (-1296.882) [-1291.925] (-1292.719) -- 0:00:58
133500 -- (-1294.983) (-1293.238) (-1295.421) [-1292.387] * [-1292.823] (-1296.327) (-1292.130) (-1293.385) -- 0:00:58
134000 -- (-1294.227) (-1292.743) (-1299.171) [-1292.388] * (-1292.651) (-1302.635) [-1293.223] (-1293.950) -- 0:00:58
134500 -- (-1296.962) (-1295.602) [-1294.444] (-1292.425) * (-1292.399) [-1293.028] (-1291.975) (-1292.278) -- 0:00:57
135000 -- (-1292.400) [-1293.268] (-1296.207) (-1294.731) * (-1291.959) (-1295.279) (-1291.575) [-1296.174] -- 0:00:57
Average standard deviation of split frequencies: 0.019064
135500 -- (-1294.314) [-1291.691] (-1295.295) (-1293.369) * [-1294.402] (-1298.398) (-1292.187) (-1294.263) -- 0:00:57
136000 -- [-1293.012] (-1295.892) (-1299.051) (-1291.777) * (-1294.941) [-1292.667] (-1291.843) (-1294.001) -- 0:00:57
136500 -- (-1293.838) (-1293.118) [-1295.484] (-1295.817) * [-1295.310] (-1292.569) (-1294.398) (-1297.493) -- 0:00:56
137000 -- (-1292.625) (-1294.740) (-1294.657) [-1291.607] * (-1293.074) (-1294.226) (-1293.391) [-1294.981] -- 0:00:56
137500 -- (-1294.364) (-1293.540) [-1292.662] (-1294.936) * (-1296.948) (-1291.620) [-1293.390] (-1293.614) -- 0:00:56
138000 -- (-1296.019) (-1298.900) (-1293.601) [-1293.521] * (-1295.289) (-1296.004) (-1292.419) [-1295.232] -- 0:00:56
138500 -- [-1294.194] (-1296.468) (-1291.582) (-1293.195) * (-1292.170) [-1295.123] (-1293.638) (-1293.677) -- 0:00:55
139000 -- (-1292.783) (-1292.005) [-1291.895] (-1291.642) * (-1292.041) (-1293.956) [-1291.917] (-1295.928) -- 0:00:55
139500 -- (-1292.868) (-1295.551) (-1293.109) [-1293.338] * (-1292.394) (-1292.446) (-1291.989) [-1291.885] -- 0:00:55
140000 -- (-1292.242) (-1296.468) [-1294.353] (-1293.052) * (-1293.557) (-1293.926) (-1291.994) [-1291.350] -- 0:00:55
Average standard deviation of split frequencies: 0.020636
140500 -- (-1298.931) [-1294.151] (-1294.974) (-1296.442) * (-1294.564) (-1294.586) [-1291.474] (-1292.107) -- 0:00:55
141000 -- (-1293.350) [-1295.059] (-1292.540) (-1299.120) * (-1296.082) [-1293.099] (-1292.840) (-1292.223) -- 0:00:54
141500 -- [-1292.179] (-1294.901) (-1293.932) (-1298.569) * (-1292.545) (-1293.218) [-1292.902] (-1294.036) -- 0:00:54
142000 -- (-1293.021) (-1294.034) (-1293.492) [-1297.141] * [-1292.769] (-1294.888) (-1295.049) (-1295.254) -- 0:00:54
142500 -- [-1292.706] (-1295.638) (-1295.016) (-1292.810) * (-1292.681) (-1292.771) (-1293.034) [-1294.118] -- 0:01:00
143000 -- (-1293.704) [-1292.784] (-1297.144) (-1293.588) * (-1291.867) (-1292.322) [-1292.077] (-1297.560) -- 0:00:59
143500 -- (-1293.929) (-1292.739) (-1296.548) [-1293.175] * [-1294.721] (-1293.718) (-1291.864) (-1294.126) -- 0:00:59
144000 -- (-1294.663) (-1291.774) (-1298.140) [-1294.348] * (-1291.786) [-1293.339] (-1291.906) (-1295.228) -- 0:00:59
144500 -- [-1292.239] (-1293.867) (-1293.646) (-1292.907) * (-1293.554) (-1297.097) [-1294.352] (-1295.631) -- 0:00:59
145000 -- (-1294.590) (-1297.802) [-1292.651] (-1293.389) * (-1296.104) [-1299.787] (-1293.739) (-1296.367) -- 0:00:58
Average standard deviation of split frequencies: 0.021149
145500 -- [-1293.068] (-1293.374) (-1294.104) (-1293.221) * (-1301.283) [-1296.822] (-1294.762) (-1296.116) -- 0:00:58
146000 -- (-1294.956) [-1292.625] (-1293.933) (-1292.789) * (-1293.139) (-1293.380) [-1293.799] (-1296.176) -- 0:00:58
146500 -- (-1296.906) (-1291.608) [-1293.694] (-1293.311) * (-1293.021) (-1291.345) (-1292.759) [-1291.974] -- 0:00:58
147000 -- (-1293.020) (-1291.919) [-1293.552] (-1292.371) * (-1291.970) (-1294.350) [-1294.741] (-1292.835) -- 0:00:58
147500 -- (-1292.986) [-1294.979] (-1293.711) (-1295.369) * (-1291.962) (-1294.564) (-1296.812) [-1299.986] -- 0:00:57
148000 -- [-1291.358] (-1292.492) (-1294.526) (-1293.536) * (-1292.545) (-1292.683) [-1292.269] (-1299.775) -- 0:00:57
148500 -- (-1291.380) (-1298.860) (-1293.898) [-1298.729] * [-1292.173] (-1297.804) (-1293.556) (-1293.901) -- 0:00:57
149000 -- [-1294.027] (-1294.920) (-1292.658) (-1294.689) * (-1293.436) (-1295.350) (-1294.039) [-1294.562] -- 0:00:57
149500 -- (-1292.910) (-1293.410) [-1293.780] (-1296.880) * (-1294.166) (-1295.198) [-1292.627] (-1294.268) -- 0:00:56
150000 -- [-1292.685] (-1293.711) (-1292.664) (-1292.384) * (-1293.360) [-1294.474] (-1292.433) (-1293.942) -- 0:00:56
Average standard deviation of split frequencies: 0.020419
150500 -- [-1294.073] (-1294.880) (-1292.703) (-1292.533) * (-1292.554) [-1294.895] (-1293.097) (-1298.970) -- 0:00:56
151000 -- (-1293.545) (-1294.265) [-1293.570] (-1292.533) * [-1292.853] (-1294.980) (-1293.734) (-1291.771) -- 0:00:56
151500 -- (-1292.664) [-1292.713] (-1295.530) (-1298.882) * (-1293.868) (-1295.714) [-1292.728] (-1291.646) -- 0:00:56
152000 -- (-1297.241) [-1293.448] (-1294.003) (-1300.610) * [-1293.155] (-1296.489) (-1296.536) (-1292.018) -- 0:00:55
152500 -- (-1293.621) [-1294.719] (-1293.589) (-1297.446) * [-1292.402] (-1299.669) (-1293.341) (-1294.686) -- 0:00:55
153000 -- [-1293.020] (-1294.885) (-1301.105) (-1296.579) * (-1292.633) [-1294.139] (-1293.359) (-1295.524) -- 0:00:55
153500 -- [-1291.522] (-1294.806) (-1293.586) (-1294.548) * [-1292.388] (-1295.200) (-1295.205) (-1296.166) -- 0:00:55
154000 -- (-1295.436) [-1293.294] (-1293.227) (-1296.098) * (-1292.033) (-1295.365) (-1296.354) [-1295.104] -- 0:00:54
154500 -- (-1293.888) (-1293.285) (-1292.444) [-1295.138] * (-1292.786) (-1294.457) (-1298.690) [-1291.950] -- 0:00:54
155000 -- (-1291.986) [-1291.804] (-1292.645) (-1294.899) * (-1292.994) (-1293.316) [-1294.986] (-1292.803) -- 0:00:54
Average standard deviation of split frequencies: 0.021312
155500 -- (-1294.638) (-1292.702) (-1292.524) [-1294.990] * (-1293.115) (-1295.092) [-1294.922] (-1292.832) -- 0:00:54
156000 -- (-1295.166) (-1291.840) [-1292.617] (-1295.437) * [-1293.367] (-1300.604) (-1295.791) (-1292.307) -- 0:00:59
156500 -- (-1293.625) (-1292.693) [-1295.433] (-1293.523) * (-1291.827) (-1292.183) [-1292.392] (-1291.760) -- 0:00:59
157000 -- [-1292.633] (-1293.461) (-1292.365) (-1294.626) * (-1297.776) (-1294.230) (-1296.101) [-1296.063] -- 0:00:59
157500 -- (-1292.888) (-1295.152) [-1292.097] (-1295.588) * [-1294.039] (-1291.777) (-1295.344) (-1292.697) -- 0:00:58
158000 -- (-1293.179) [-1293.285] (-1292.258) (-1293.852) * (-1293.871) (-1291.745) [-1292.501] (-1291.633) -- 0:00:58
158500 -- [-1294.033] (-1295.789) (-1293.107) (-1294.596) * (-1293.438) (-1292.694) [-1293.175] (-1296.845) -- 0:00:58
159000 -- [-1293.309] (-1291.305) (-1294.409) (-1293.566) * (-1294.651) (-1292.918) (-1293.226) [-1294.765] -- 0:00:58
159500 -- (-1294.743) (-1294.433) (-1296.546) [-1293.337] * (-1296.854) (-1293.159) [-1292.083] (-1293.562) -- 0:00:57
160000 -- (-1292.803) [-1294.690] (-1293.322) (-1292.686) * (-1293.129) (-1294.437) (-1293.266) [-1295.934] -- 0:00:57
Average standard deviation of split frequencies: 0.022331
160500 -- (-1293.248) (-1293.945) [-1293.604] (-1293.124) * (-1295.937) (-1293.265) [-1293.447] (-1294.722) -- 0:00:57
161000 -- (-1295.354) (-1293.679) [-1295.256] (-1291.615) * (-1293.099) (-1293.027) (-1296.437) [-1295.260] -- 0:00:57
161500 -- [-1295.102] (-1292.325) (-1294.670) (-1292.445) * [-1293.625] (-1293.860) (-1291.262) (-1294.291) -- 0:00:57
162000 -- (-1295.300) (-1291.349) [-1293.775] (-1291.370) * (-1296.406) (-1295.269) (-1293.559) [-1292.690] -- 0:00:56
162500 -- (-1297.950) (-1293.211) [-1293.662] (-1291.633) * [-1296.625] (-1293.241) (-1293.958) (-1295.407) -- 0:00:56
163000 -- (-1296.336) [-1293.044] (-1292.622) (-1292.583) * (-1292.611) (-1292.671) [-1294.864] (-1293.817) -- 0:00:56
163500 -- (-1292.899) (-1291.780) [-1291.536] (-1293.329) * (-1294.607) [-1293.247] (-1295.454) (-1294.625) -- 0:00:56
164000 -- (-1294.951) (-1294.493) [-1292.659] (-1293.329) * [-1294.268] (-1296.238) (-1296.754) (-1294.513) -- 0:00:56
164500 -- (-1294.001) (-1297.059) (-1291.530) [-1293.533] * (-1293.538) (-1293.400) (-1291.879) [-1295.163] -- 0:00:55
165000 -- (-1293.869) (-1295.019) (-1291.456) [-1293.225] * (-1295.483) (-1293.526) [-1292.562] (-1295.204) -- 0:00:55
Average standard deviation of split frequencies: 0.020028
165500 -- (-1292.504) (-1293.511) (-1291.326) [-1294.566] * (-1293.112) (-1293.500) (-1292.993) [-1292.495] -- 0:00:55
166000 -- [-1292.899] (-1294.189) (-1291.667) (-1293.395) * (-1291.578) (-1294.840) (-1295.689) [-1291.261] -- 0:00:55
166500 -- [-1295.632] (-1291.783) (-1292.314) (-1293.889) * (-1291.187) (-1293.158) [-1293.249] (-1294.650) -- 0:00:55
167000 -- (-1295.420) (-1292.435) [-1291.754] (-1291.723) * (-1291.489) (-1292.928) [-1291.650] (-1294.204) -- 0:00:54
167500 -- (-1292.715) (-1291.879) (-1293.773) [-1292.251] * (-1293.056) (-1294.236) (-1291.337) [-1292.343] -- 0:00:54
168000 -- [-1294.123] (-1293.135) (-1294.732) (-1292.992) * (-1291.507) (-1295.812) [-1291.403] (-1292.336) -- 0:00:54
168500 -- [-1292.992] (-1294.592) (-1295.389) (-1291.948) * [-1294.206] (-1294.417) (-1291.973) (-1292.626) -- 0:00:54
169000 -- (-1293.475) (-1294.700) [-1294.432] (-1292.320) * (-1292.436) (-1293.842) (-1292.449) [-1292.666] -- 0:00:54
169500 -- (-1295.432) [-1295.184] (-1294.331) (-1291.998) * (-1292.323) [-1294.623] (-1294.296) (-1291.570) -- 0:00:53
170000 -- (-1294.183) (-1296.183) (-1294.840) [-1294.950] * (-1293.614) [-1295.190] (-1295.873) (-1291.302) -- 0:00:53
Average standard deviation of split frequencies: 0.019626
170500 -- [-1297.094] (-1292.362) (-1296.747) (-1293.939) * (-1294.032) (-1293.743) (-1291.458) [-1295.446] -- 0:00:58
171000 -- [-1296.537] (-1291.354) (-1296.904) (-1294.934) * (-1293.790) (-1293.216) [-1292.353] (-1294.892) -- 0:00:58
171500 -- (-1294.389) (-1291.539) [-1292.221] (-1295.132) * (-1294.426) (-1295.412) (-1292.972) [-1299.364] -- 0:00:57
172000 -- (-1300.502) (-1291.283) [-1294.550] (-1297.615) * (-1294.864) (-1292.902) (-1292.575) [-1298.842] -- 0:00:57
172500 -- (-1294.357) [-1293.734] (-1298.811) (-1295.791) * (-1294.280) [-1295.526] (-1295.581) (-1299.931) -- 0:00:57
173000 -- [-1292.212] (-1292.334) (-1296.116) (-1292.841) * [-1296.270] (-1295.306) (-1297.260) (-1292.222) -- 0:00:57
173500 -- [-1292.834] (-1292.315) (-1293.990) (-1291.559) * (-1293.545) (-1293.281) (-1292.800) [-1291.477] -- 0:00:57
174000 -- (-1292.269) [-1292.960] (-1294.060) (-1291.766) * (-1292.159) (-1294.311) [-1294.543] (-1293.858) -- 0:00:56
174500 -- (-1291.467) [-1291.754] (-1295.338) (-1293.087) * (-1292.487) [-1295.227] (-1293.240) (-1292.997) -- 0:00:56
175000 -- (-1293.792) (-1294.436) (-1292.475) [-1292.982] * (-1292.950) (-1294.581) [-1291.880] (-1296.021) -- 0:00:56
Average standard deviation of split frequencies: 0.018898
175500 -- (-1294.182) [-1294.229] (-1292.476) (-1292.704) * (-1292.138) [-1292.158] (-1291.411) (-1292.175) -- 0:00:56
176000 -- (-1297.156) (-1295.054) (-1294.625) [-1292.376] * [-1293.019] (-1292.595) (-1292.213) (-1293.581) -- 0:00:56
176500 -- (-1298.941) (-1298.535) [-1294.128] (-1292.242) * (-1291.698) (-1292.524) (-1292.713) [-1292.721] -- 0:00:55
177000 -- (-1300.389) (-1295.517) (-1294.401) [-1293.321] * (-1294.308) (-1291.647) (-1292.352) [-1292.690] -- 0:00:55
177500 -- [-1294.045] (-1295.008) (-1293.270) (-1294.682) * (-1294.523) (-1293.818) [-1291.336] (-1294.044) -- 0:00:55
178000 -- (-1292.013) (-1297.740) (-1294.930) [-1292.501] * (-1292.835) [-1294.587] (-1293.354) (-1293.197) -- 0:00:55
178500 -- (-1293.377) [-1294.322] (-1297.302) (-1297.198) * (-1291.644) [-1295.932] (-1292.133) (-1294.818) -- 0:00:55
179000 -- (-1291.308) [-1294.760] (-1301.328) (-1296.060) * (-1292.487) [-1292.355] (-1293.235) (-1293.106) -- 0:00:55
179500 -- (-1291.533) [-1293.299] (-1305.500) (-1293.541) * [-1292.135] (-1293.034) (-1295.648) (-1294.282) -- 0:00:54
180000 -- (-1291.612) (-1293.830) (-1297.484) [-1295.668] * [-1292.385] (-1291.760) (-1293.760) (-1293.220) -- 0:00:54
Average standard deviation of split frequencies: 0.018845
180500 -- [-1291.612] (-1291.675) (-1293.443) (-1297.955) * (-1291.916) (-1291.760) [-1292.850] (-1299.666) -- 0:00:54
181000 -- (-1296.421) [-1291.674] (-1294.027) (-1298.430) * (-1291.279) [-1291.347] (-1292.747) (-1295.311) -- 0:00:54
181500 -- (-1296.325) (-1291.962) [-1293.675] (-1297.069) * (-1294.603) (-1291.547) (-1292.895) [-1294.698] -- 0:00:54
182000 -- (-1297.350) [-1294.536] (-1293.699) (-1292.261) * (-1296.825) (-1292.355) (-1292.401) [-1294.034] -- 0:00:53
182500 -- (-1294.154) [-1291.991] (-1292.506) (-1291.581) * (-1294.838) [-1292.681] (-1292.840) (-1295.968) -- 0:00:53
183000 -- [-1295.141] (-1292.058) (-1295.649) (-1291.581) * (-1295.727) [-1291.913] (-1293.075) (-1292.915) -- 0:00:53
183500 -- [-1294.652] (-1294.487) (-1292.832) (-1292.618) * (-1295.213) (-1295.033) (-1293.791) [-1292.511] -- 0:00:57
184000 -- (-1297.191) (-1292.574) [-1293.051] (-1293.555) * [-1296.326] (-1294.400) (-1292.668) (-1295.961) -- 0:00:57
184500 -- (-1295.640) (-1292.033) [-1293.189] (-1291.744) * [-1296.735] (-1293.785) (-1294.362) (-1296.518) -- 0:00:57
185000 -- (-1296.652) (-1292.202) [-1295.765] (-1291.581) * [-1293.329] (-1293.166) (-1293.385) (-1293.465) -- 0:00:57
Average standard deviation of split frequencies: 0.019994
185500 -- (-1294.773) (-1294.147) [-1296.747] (-1292.135) * (-1292.986) (-1293.702) (-1293.483) [-1293.688] -- 0:00:57
186000 -- (-1295.004) (-1293.832) (-1292.329) [-1293.113] * [-1296.480] (-1295.609) (-1294.371) (-1293.778) -- 0:00:56
186500 -- (-1293.339) (-1296.421) [-1293.007] (-1293.633) * (-1298.460) [-1294.754] (-1294.404) (-1294.245) -- 0:00:56
187000 -- (-1291.867) [-1292.902] (-1294.087) (-1293.442) * (-1297.438) (-1291.702) [-1293.593] (-1294.394) -- 0:00:56
187500 -- [-1293.137] (-1292.955) (-1295.798) (-1292.401) * (-1295.857) (-1294.285) (-1296.955) [-1292.049] -- 0:00:56
188000 -- (-1291.202) (-1294.461) (-1293.994) [-1292.878] * (-1295.710) [-1292.803] (-1294.875) (-1295.385) -- 0:00:56
188500 -- (-1291.265) [-1292.498] (-1296.768) (-1291.843) * (-1298.299) [-1291.570] (-1292.037) (-1292.572) -- 0:00:55
189000 -- [-1297.515] (-1295.670) (-1292.362) (-1292.772) * (-1296.913) (-1293.034) (-1292.370) [-1292.440] -- 0:00:55
189500 -- (-1295.763) [-1293.036] (-1293.993) (-1293.890) * (-1293.599) (-1293.886) [-1292.468] (-1294.283) -- 0:00:55
190000 -- [-1293.306] (-1292.465) (-1293.698) (-1295.699) * (-1292.587) (-1292.913) (-1292.813) [-1294.294] -- 0:00:55
Average standard deviation of split frequencies: 0.020300
190500 -- [-1292.238] (-1294.934) (-1296.112) (-1295.127) * [-1294.271] (-1293.137) (-1292.544) (-1291.726) -- 0:00:55
191000 -- [-1297.325] (-1292.386) (-1296.486) (-1294.621) * (-1293.980) [-1292.198] (-1291.989) (-1292.386) -- 0:00:55
191500 -- (-1294.597) (-1292.595) (-1293.253) [-1295.471] * [-1292.830] (-1292.724) (-1294.728) (-1292.473) -- 0:00:54
192000 -- (-1292.065) (-1294.169) (-1293.693) [-1292.589] * (-1293.761) (-1291.776) (-1295.627) [-1293.846] -- 0:00:54
192500 -- (-1291.875) [-1291.741] (-1294.733) (-1293.689) * (-1291.879) [-1292.200] (-1292.886) (-1291.690) -- 0:00:54
193000 -- (-1293.106) (-1291.801) [-1293.561] (-1293.508) * [-1293.500] (-1292.325) (-1292.863) (-1291.917) -- 0:00:54
193500 -- (-1293.417) [-1294.210] (-1296.128) (-1296.041) * (-1293.240) (-1293.975) (-1294.229) [-1295.224] -- 0:00:54
194000 -- (-1292.942) [-1294.621] (-1291.451) (-1294.300) * (-1292.483) [-1291.728] (-1293.676) (-1292.100) -- 0:00:54
194500 -- (-1292.899) (-1296.099) [-1291.421] (-1292.907) * (-1291.559) (-1292.086) (-1292.224) [-1297.115] -- 0:00:53
195000 -- [-1292.489] (-1297.247) (-1292.402) (-1293.598) * (-1291.535) [-1292.756] (-1293.670) (-1296.110) -- 0:00:53
Average standard deviation of split frequencies: 0.018228
195500 -- (-1292.364) [-1293.792] (-1291.609) (-1292.757) * [-1291.524] (-1292.540) (-1295.440) (-1298.544) -- 0:00:53
196000 -- (-1294.684) (-1292.408) [-1292.308] (-1292.033) * (-1292.267) (-1292.001) (-1295.353) [-1295.268] -- 0:00:53
196500 -- (-1294.925) (-1291.647) [-1292.528] (-1292.364) * (-1293.589) (-1292.026) (-1292.271) [-1296.752] -- 0:00:53
197000 -- (-1293.214) (-1292.452) [-1291.787] (-1295.111) * (-1292.661) [-1294.551] (-1292.948) (-1292.304) -- 0:00:52
197500 -- [-1294.665] (-1291.632) (-1296.733) (-1292.904) * [-1293.624] (-1293.236) (-1294.281) (-1298.398) -- 0:00:52
198000 -- (-1293.783) (-1292.391) [-1295.095] (-1292.232) * (-1293.483) [-1291.664] (-1292.865) (-1292.258) -- 0:00:56
198500 -- (-1293.813) [-1291.179] (-1292.608) (-1294.597) * [-1292.807] (-1293.684) (-1295.558) (-1294.121) -- 0:00:56
199000 -- [-1292.058] (-1293.789) (-1292.597) (-1292.583) * (-1294.181) [-1296.264] (-1295.823) (-1296.761) -- 0:00:56
199500 -- (-1292.032) [-1293.732] (-1292.155) (-1296.104) * (-1294.327) (-1298.234) [-1293.119] (-1293.949) -- 0:00:56
200000 -- [-1295.129] (-1296.269) (-1292.155) (-1293.140) * (-1291.784) (-1299.625) (-1300.789) [-1294.575] -- 0:00:55
Average standard deviation of split frequencies: 0.019623
200500 -- [-1293.439] (-1295.246) (-1292.180) (-1296.353) * (-1295.886) (-1294.949) (-1294.193) [-1293.123] -- 0:00:55
201000 -- (-1297.968) (-1292.311) [-1296.258] (-1294.148) * (-1298.215) (-1294.617) [-1293.949] (-1298.468) -- 0:00:55
201500 -- (-1300.698) [-1293.114] (-1292.447) (-1293.272) * (-1291.907) [-1296.525] (-1294.630) (-1299.695) -- 0:00:55
202000 -- (-1294.791) (-1296.768) [-1292.268] (-1295.543) * (-1292.189) [-1299.136] (-1304.540) (-1293.358) -- 0:00:55
202500 -- (-1296.681) (-1293.490) [-1296.586] (-1295.323) * [-1291.465] (-1295.080) (-1296.542) (-1293.232) -- 0:00:55
203000 -- [-1295.059] (-1294.583) (-1293.978) (-1298.675) * [-1291.521] (-1293.101) (-1293.575) (-1295.290) -- 0:00:54
203500 -- (-1292.438) (-1295.127) (-1292.290) [-1292.355] * (-1294.274) [-1293.945] (-1293.598) (-1294.190) -- 0:00:54
204000 -- (-1292.819) (-1292.980) (-1292.457) [-1292.321] * [-1291.612] (-1295.009) (-1293.974) (-1293.742) -- 0:00:54
204500 -- [-1294.005] (-1293.885) (-1292.048) (-1291.053) * [-1291.723] (-1294.791) (-1299.320) (-1294.878) -- 0:00:54
205000 -- (-1292.034) [-1293.559] (-1292.436) (-1294.879) * (-1291.271) [-1292.265] (-1295.870) (-1294.580) -- 0:00:54
Average standard deviation of split frequencies: 0.018053
205500 -- [-1291.682] (-1294.457) (-1294.365) (-1293.349) * (-1292.307) (-1292.702) [-1293.243] (-1292.403) -- 0:00:54
206000 -- (-1299.142) (-1295.626) [-1292.906] (-1294.414) * (-1295.363) (-1293.459) (-1296.513) [-1292.646] -- 0:00:53
206500 -- (-1295.050) (-1292.248) [-1292.835] (-1293.227) * [-1291.458] (-1293.502) (-1296.311) (-1295.284) -- 0:00:53
207000 -- [-1295.771] (-1291.903) (-1293.821) (-1295.061) * [-1292.008] (-1291.497) (-1298.611) (-1292.667) -- 0:00:53
207500 -- (-1295.012) [-1293.033] (-1293.055) (-1294.174) * [-1296.616] (-1293.565) (-1297.764) (-1291.502) -- 0:00:53
208000 -- (-1292.777) (-1293.141) (-1294.065) [-1292.449] * (-1295.882) (-1291.503) [-1296.813] (-1293.590) -- 0:00:53
208500 -- (-1293.214) (-1293.162) [-1293.153] (-1294.565) * (-1295.527) (-1292.327) [-1294.892] (-1294.220) -- 0:00:53
209000 -- (-1292.242) [-1295.977] (-1295.199) (-1295.393) * (-1293.231) [-1291.373] (-1292.632) (-1293.506) -- 0:00:52
209500 -- (-1292.917) [-1296.249] (-1293.264) (-1293.048) * (-1293.829) [-1292.183] (-1295.360) (-1295.362) -- 0:00:52
210000 -- (-1293.638) (-1294.644) (-1299.223) [-1294.520] * (-1293.844) (-1292.185) (-1295.622) [-1295.565] -- 0:00:52
Average standard deviation of split frequencies: 0.017528
210500 -- (-1293.331) [-1293.099] (-1299.214) (-1293.813) * (-1293.802) (-1293.633) [-1294.316] (-1296.798) -- 0:00:52
211000 -- (-1294.557) (-1291.512) [-1294.999] (-1293.664) * (-1294.178) [-1291.928] (-1296.493) (-1295.918) -- 0:00:56
211500 -- (-1293.320) [-1292.034] (-1291.723) (-1295.451) * (-1297.404) (-1294.452) [-1293.253] (-1298.263) -- 0:00:55
212000 -- [-1293.066] (-1293.868) (-1293.299) (-1291.947) * [-1294.167] (-1292.314) (-1292.088) (-1300.285) -- 0:00:55
212500 -- (-1292.446) (-1295.380) [-1295.461] (-1292.115) * [-1298.075] (-1292.341) (-1292.398) (-1297.552) -- 0:00:55
213000 -- [-1292.551] (-1295.259) (-1291.620) (-1293.059) * [-1293.462] (-1291.609) (-1295.363) (-1298.338) -- 0:00:55
213500 -- [-1293.785] (-1293.652) (-1292.020) (-1293.565) * (-1293.003) [-1293.510] (-1292.922) (-1295.627) -- 0:00:55
214000 -- (-1294.021) [-1292.350] (-1296.394) (-1293.784) * (-1291.701) (-1294.507) [-1293.068] (-1302.213) -- 0:00:55
214500 -- (-1294.376) (-1293.838) (-1294.286) [-1292.204] * (-1294.683) (-1294.929) (-1292.170) [-1294.883] -- 0:00:54
215000 -- (-1293.167) [-1292.434] (-1291.780) (-1293.705) * (-1292.815) (-1295.336) [-1295.484] (-1297.420) -- 0:00:54
Average standard deviation of split frequencies: 0.017217
215500 -- (-1293.853) (-1291.878) (-1295.721) [-1291.949] * [-1293.002] (-1293.888) (-1294.317) (-1297.315) -- 0:00:54
216000 -- (-1292.530) (-1291.969) [-1294.545] (-1294.455) * (-1291.801) [-1292.573] (-1294.136) (-1293.457) -- 0:00:54
216500 -- (-1296.292) (-1294.418) (-1292.160) [-1292.381] * (-1292.899) (-1294.919) (-1295.208) [-1293.390] -- 0:00:54
217000 -- [-1295.038] (-1294.892) (-1292.914) (-1291.999) * (-1291.668) (-1296.490) [-1294.747] (-1293.984) -- 0:00:54
217500 -- (-1292.859) (-1292.841) [-1293.722] (-1294.062) * (-1292.178) (-1294.772) [-1293.820] (-1296.237) -- 0:00:53
218000 -- (-1295.821) (-1293.323) [-1292.736] (-1294.900) * [-1293.970] (-1295.385) (-1293.417) (-1297.608) -- 0:00:53
218500 -- [-1294.553] (-1292.561) (-1292.656) (-1291.762) * [-1295.021] (-1296.808) (-1293.840) (-1297.592) -- 0:00:53
219000 -- (-1293.031) [-1292.121] (-1294.036) (-1292.751) * (-1296.072) [-1297.263] (-1294.665) (-1295.075) -- 0:00:53
219500 -- (-1291.898) (-1293.731) [-1292.104] (-1294.500) * [-1293.507] (-1295.062) (-1293.520) (-1295.190) -- 0:00:53
220000 -- [-1292.938] (-1292.624) (-1294.362) (-1291.284) * (-1294.981) (-1291.167) [-1291.611] (-1293.833) -- 0:00:53
Average standard deviation of split frequencies: 0.017593
220500 -- (-1293.336) (-1293.093) (-1296.334) [-1291.283] * (-1296.467) (-1293.936) [-1292.845] (-1294.116) -- 0:00:53
221000 -- [-1293.356] (-1292.662) (-1294.929) (-1292.244) * (-1293.132) (-1296.674) [-1292.904] (-1293.500) -- 0:00:52
221500 -- (-1295.575) (-1294.244) (-1293.922) [-1291.702] * [-1292.267] (-1292.900) (-1295.477) (-1295.130) -- 0:00:52
222000 -- (-1292.875) (-1297.460) [-1295.815] (-1291.832) * [-1294.666] (-1294.989) (-1293.704) (-1295.039) -- 0:00:52
222500 -- (-1294.203) (-1296.813) (-1294.644) [-1291.195] * (-1294.272) (-1293.708) [-1291.730] (-1295.805) -- 0:00:52
223000 -- (-1293.652) (-1298.529) [-1292.404] (-1291.280) * (-1294.535) (-1294.913) [-1291.248] (-1295.885) -- 0:00:52
223500 -- (-1293.523) (-1297.423) (-1294.133) [-1291.598] * (-1294.437) [-1294.174] (-1292.124) (-1292.509) -- 0:00:52
224000 -- [-1292.536] (-1294.898) (-1294.451) (-1295.321) * (-1295.823) (-1292.875) [-1291.932] (-1293.594) -- 0:00:51
224500 -- (-1293.208) (-1295.140) [-1293.934] (-1291.577) * (-1296.167) (-1293.319) (-1292.579) [-1295.787] -- 0:00:51
225000 -- (-1294.365) (-1295.361) (-1294.185) [-1291.445] * (-1296.021) [-1294.776] (-1294.436) (-1291.674) -- 0:00:51
Average standard deviation of split frequencies: 0.015992
225500 -- (-1293.209) [-1295.290] (-1292.376) (-1292.690) * (-1296.167) (-1293.861) (-1292.642) [-1293.458] -- 0:00:54
226000 -- (-1294.305) [-1291.801] (-1292.177) (-1292.959) * (-1293.328) (-1293.236) (-1291.442) [-1296.437] -- 0:00:54
226500 -- [-1292.270] (-1294.865) (-1295.715) (-1295.145) * [-1293.540] (-1292.256) (-1294.943) (-1296.262) -- 0:00:54
227000 -- (-1293.481) [-1291.450] (-1294.596) (-1293.683) * [-1292.576] (-1294.139) (-1294.871) (-1293.935) -- 0:00:54
227500 -- (-1293.897) (-1295.000) [-1293.963] (-1292.809) * [-1293.953] (-1294.497) (-1294.105) (-1293.350) -- 0:00:54
228000 -- (-1292.540) (-1296.902) [-1292.309] (-1293.401) * (-1295.037) (-1295.009) [-1293.775] (-1293.693) -- 0:00:54
228500 -- (-1293.426) (-1293.240) (-1296.943) [-1292.441] * [-1295.286] (-1291.835) (-1293.957) (-1295.402) -- 0:00:54
229000 -- (-1295.060) (-1292.593) [-1292.123] (-1293.660) * (-1292.398) [-1292.926] (-1292.440) (-1291.638) -- 0:00:53
229500 -- (-1293.794) [-1293.166] (-1293.232) (-1295.473) * [-1294.173] (-1292.389) (-1292.835) (-1291.662) -- 0:00:53
230000 -- (-1293.713) (-1293.396) [-1291.903] (-1296.931) * (-1293.336) [-1296.064] (-1292.415) (-1292.362) -- 0:00:53
Average standard deviation of split frequencies: 0.014873
230500 -- (-1294.652) (-1293.209) [-1292.437] (-1294.971) * [-1295.264] (-1296.805) (-1293.474) (-1293.131) -- 0:00:53
231000 -- [-1294.966] (-1294.422) (-1298.056) (-1293.518) * [-1294.107] (-1291.611) (-1292.352) (-1294.773) -- 0:00:53
231500 -- (-1299.739) [-1295.945] (-1293.146) (-1296.914) * (-1292.607) (-1291.531) (-1291.897) [-1301.035] -- 0:00:53
232000 -- (-1293.745) (-1293.287) (-1293.329) [-1291.925] * (-1296.027) [-1293.327] (-1292.759) (-1294.941) -- 0:00:52
232500 -- (-1292.809) (-1293.287) [-1293.961] (-1292.182) * [-1292.257] (-1294.027) (-1300.863) (-1293.693) -- 0:00:52
233000 -- (-1294.421) (-1293.230) [-1292.895] (-1293.646) * (-1291.550) [-1295.128] (-1294.381) (-1294.681) -- 0:00:52
233500 -- [-1294.939] (-1291.562) (-1294.566) (-1293.992) * (-1295.070) (-1292.734) (-1291.642) [-1296.417] -- 0:00:52
234000 -- (-1297.550) [-1292.045] (-1294.689) (-1292.747) * (-1294.296) (-1292.841) (-1291.547) [-1294.476] -- 0:00:52
234500 -- (-1293.556) (-1291.998) (-1299.633) [-1296.971] * [-1294.891] (-1293.142) (-1292.856) (-1293.568) -- 0:00:52
235000 -- (-1291.683) [-1291.814] (-1293.161) (-1293.958) * (-1295.747) (-1292.195) (-1296.783) [-1293.336] -- 0:00:52
Average standard deviation of split frequencies: 0.013871
235500 -- [-1294.015] (-1291.878) (-1295.197) (-1294.938) * (-1295.340) [-1294.657] (-1294.688) (-1293.364) -- 0:00:51
236000 -- [-1293.129] (-1292.596) (-1293.407) (-1294.965) * (-1292.748) (-1293.788) (-1294.533) [-1292.677] -- 0:00:51
236500 -- [-1293.063] (-1295.681) (-1293.382) (-1296.508) * (-1292.660) (-1295.261) [-1295.536] (-1291.876) -- 0:00:51
237000 -- [-1292.536] (-1295.787) (-1295.118) (-1294.553) * [-1291.720] (-1295.304) (-1295.004) (-1291.461) -- 0:00:51
237500 -- [-1293.258] (-1294.994) (-1293.476) (-1294.930) * [-1292.008] (-1293.084) (-1294.239) (-1291.771) -- 0:00:51
238000 -- [-1296.188] (-1292.488) (-1296.657) (-1294.291) * (-1291.905) (-1294.157) (-1297.535) [-1291.475] -- 0:00:51
238500 -- (-1296.117) [-1291.698] (-1294.683) (-1293.832) * [-1291.849] (-1294.480) (-1295.721) (-1295.882) -- 0:00:51
239000 -- (-1297.275) (-1291.986) (-1295.619) [-1293.979] * (-1292.054) (-1296.419) (-1295.627) [-1295.533] -- 0:00:50
239500 -- [-1296.721] (-1293.760) (-1294.312) (-1293.346) * [-1292.021] (-1297.660) (-1295.349) (-1291.992) -- 0:00:53
240000 -- (-1292.827) (-1292.519) (-1292.417) [-1291.591] * (-1294.207) (-1298.091) (-1293.754) [-1291.684] -- 0:00:53
Average standard deviation of split frequencies: 0.013929
240500 -- (-1292.555) (-1296.311) (-1294.124) [-1291.600] * [-1292.666] (-1292.908) (-1296.486) (-1295.806) -- 0:00:53
241000 -- (-1295.832) [-1295.668] (-1297.936) (-1292.041) * [-1293.985] (-1291.256) (-1302.990) (-1295.497) -- 0:00:53
241500 -- (-1295.577) (-1294.811) [-1295.401] (-1295.134) * (-1292.373) (-1294.527) (-1301.974) [-1296.292] -- 0:00:53
242000 -- [-1294.942] (-1295.678) (-1292.937) (-1295.773) * (-1293.446) [-1296.543] (-1293.733) (-1296.064) -- 0:00:53
242500 -- (-1293.245) (-1293.943) [-1292.517] (-1292.522) * (-1296.699) (-1297.176) [-1292.050] (-1297.553) -- 0:00:53
243000 -- [-1293.001] (-1295.205) (-1292.785) (-1293.098) * (-1296.374) (-1295.700) [-1293.693] (-1292.822) -- 0:00:52
243500 -- [-1294.886] (-1295.704) (-1294.413) (-1293.138) * (-1293.338) [-1294.329] (-1296.182) (-1292.046) -- 0:00:52
244000 -- (-1293.603) (-1294.664) [-1292.203] (-1292.983) * (-1294.590) [-1292.495] (-1296.358) (-1293.008) -- 0:00:52
244500 -- (-1293.292) (-1293.356) [-1292.883] (-1292.666) * (-1292.724) (-1293.526) [-1293.656] (-1292.250) -- 0:00:52
245000 -- (-1293.611) [-1293.423] (-1293.854) (-1294.154) * (-1292.468) (-1293.855) [-1293.816] (-1291.846) -- 0:00:52
Average standard deviation of split frequencies: 0.013918
245500 -- (-1294.999) [-1292.849] (-1296.706) (-1292.915) * [-1292.446] (-1298.604) (-1292.081) (-1292.135) -- 0:00:52
246000 -- [-1293.431] (-1293.781) (-1295.397) (-1296.811) * (-1295.398) [-1293.514] (-1294.716) (-1292.134) -- 0:00:52
246500 -- (-1293.526) [-1295.498] (-1298.514) (-1294.280) * (-1297.345) (-1294.190) (-1291.988) [-1292.438] -- 0:00:51
247000 -- (-1292.918) (-1296.088) [-1295.418] (-1292.249) * (-1294.767) [-1292.189] (-1293.368) (-1295.354) -- 0:00:51
247500 -- (-1293.505) [-1295.408] (-1295.084) (-1292.304) * [-1291.920] (-1293.645) (-1291.766) (-1293.116) -- 0:00:51
248000 -- [-1291.831] (-1297.189) (-1294.591) (-1292.592) * (-1292.148) (-1296.702) [-1291.712] (-1293.361) -- 0:00:51
248500 -- (-1292.453) (-1295.585) (-1292.994) [-1297.055] * (-1299.114) [-1294.059] (-1291.608) (-1292.367) -- 0:00:51
249000 -- (-1294.080) [-1293.827] (-1293.586) (-1293.302) * (-1294.996) (-1293.896) [-1293.393] (-1292.782) -- 0:00:51
249500 -- (-1293.267) [-1294.019] (-1295.003) (-1294.572) * [-1292.755] (-1295.162) (-1293.850) (-1291.497) -- 0:00:51
250000 -- (-1299.190) (-1292.216) (-1297.370) [-1295.039] * (-1294.655) (-1294.580) [-1293.623] (-1291.289) -- 0:00:51
Average standard deviation of split frequencies: 0.013916
250500 -- (-1298.450) [-1294.321] (-1293.611) (-1293.750) * (-1293.340) (-1294.353) (-1294.551) [-1292.910] -- 0:00:50
251000 -- (-1296.045) (-1294.504) (-1296.078) [-1292.127] * (-1292.799) (-1292.894) (-1295.777) [-1294.005] -- 0:00:50
251500 -- (-1296.046) [-1291.851] (-1294.442) (-1297.162) * (-1294.435) (-1293.269) [-1295.775] (-1291.117) -- 0:00:50
252000 -- [-1294.958] (-1292.998) (-1298.184) (-1301.053) * (-1293.636) (-1292.929) (-1292.375) [-1298.081] -- 0:00:50
252500 -- (-1297.386) (-1291.747) [-1293.639] (-1296.541) * (-1291.516) (-1292.960) [-1294.198] (-1292.422) -- 0:00:50
253000 -- [-1295.654] (-1291.930) (-1296.084) (-1292.277) * (-1291.862) (-1292.323) [-1294.300] (-1294.255) -- 0:00:50
253500 -- (-1292.594) (-1291.709) (-1293.954) [-1293.170] * (-1293.346) [-1293.096] (-1293.476) (-1292.940) -- 0:00:53
254000 -- (-1297.781) [-1291.985] (-1294.188) (-1297.593) * (-1296.430) [-1292.595] (-1293.387) (-1294.008) -- 0:00:52
254500 -- [-1296.629] (-1291.836) (-1293.832) (-1291.983) * (-1292.803) (-1292.598) (-1294.266) [-1293.216] -- 0:00:52
255000 -- (-1294.034) (-1291.835) [-1291.446] (-1292.668) * [-1291.823] (-1291.190) (-1291.878) (-1292.419) -- 0:00:52
Average standard deviation of split frequencies: 0.013719
255500 -- [-1295.707] (-1295.122) (-1291.374) (-1293.754) * [-1292.770] (-1293.396) (-1295.976) (-1292.556) -- 0:00:52
256000 -- (-1299.459) (-1295.227) [-1293.058] (-1296.070) * (-1292.374) (-1292.848) [-1294.135] (-1294.812) -- 0:00:52
256500 -- (-1295.765) (-1295.773) (-1293.269) [-1294.559] * (-1292.163) (-1292.025) (-1296.284) [-1292.279] -- 0:00:52
257000 -- (-1295.499) (-1293.600) [-1292.499] (-1296.244) * (-1292.146) (-1296.150) [-1292.214] (-1291.892) -- 0:00:52
257500 -- [-1292.206] (-1294.068) (-1292.353) (-1296.800) * (-1292.494) (-1298.922) (-1296.316) [-1292.616] -- 0:00:51
258000 -- (-1293.017) (-1294.523) [-1291.764] (-1293.260) * [-1292.835] (-1292.453) (-1293.898) (-1295.592) -- 0:00:51
258500 -- [-1294.181] (-1292.801) (-1291.843) (-1297.047) * (-1294.709) (-1294.265) (-1292.150) [-1295.051] -- 0:00:51
259000 -- (-1297.121) (-1295.322) [-1294.683] (-1299.652) * (-1294.569) [-1291.960] (-1295.273) (-1296.041) -- 0:00:51
259500 -- (-1292.683) [-1293.722] (-1294.767) (-1292.628) * (-1298.624) (-1296.580) [-1293.412] (-1295.328) -- 0:00:51
260000 -- (-1292.333) [-1292.015] (-1292.264) (-1295.080) * (-1293.934) (-1294.392) (-1292.048) [-1293.990] -- 0:00:51
Average standard deviation of split frequencies: 0.014267
260500 -- (-1292.975) (-1295.191) [-1292.384] (-1295.513) * [-1292.399] (-1293.792) (-1292.026) (-1293.915) -- 0:00:51
261000 -- (-1292.517) [-1293.646] (-1298.013) (-1293.850) * (-1294.026) (-1293.837) (-1292.035) [-1294.137] -- 0:00:50
261500 -- (-1295.557) (-1293.110) (-1296.238) [-1292.043] * (-1293.109) (-1295.993) [-1292.078] (-1291.379) -- 0:00:50
262000 -- (-1297.214) (-1291.963) [-1293.013] (-1296.383) * (-1292.910) (-1296.167) (-1296.661) [-1291.629] -- 0:00:50
262500 -- (-1293.772) [-1292.340] (-1291.933) (-1294.285) * [-1292.236] (-1294.887) (-1292.632) (-1291.249) -- 0:00:50
263000 -- (-1301.842) (-1293.534) (-1292.305) [-1293.317] * (-1293.533) (-1295.460) (-1296.380) [-1292.377] -- 0:00:50
263500 -- (-1302.158) (-1291.858) (-1292.165) [-1291.975] * (-1292.234) (-1296.051) [-1294.206] (-1292.345) -- 0:00:50
264000 -- [-1293.287] (-1292.392) (-1293.534) (-1291.230) * [-1292.042] (-1293.560) (-1295.355) (-1293.831) -- 0:00:50
264500 -- [-1293.760] (-1292.758) (-1296.342) (-1291.521) * (-1292.374) (-1294.467) [-1293.474] (-1293.121) -- 0:00:50
265000 -- (-1296.749) (-1293.108) (-1292.437) [-1292.706] * (-1294.624) (-1292.541) [-1291.559] (-1292.213) -- 0:00:49
Average standard deviation of split frequencies: 0.014737
265500 -- (-1295.408) (-1292.857) [-1291.204] (-1294.005) * (-1296.849) (-1292.199) [-1292.397] (-1291.709) -- 0:00:49
266000 -- (-1297.073) [-1291.877] (-1293.916) (-1295.779) * (-1295.971) [-1292.050] (-1292.583) (-1291.761) -- 0:00:49
266500 -- (-1296.640) [-1295.685] (-1293.799) (-1294.704) * (-1293.558) [-1293.761] (-1295.883) (-1294.104) -- 0:00:49
267000 -- (-1292.631) (-1292.296) [-1295.968] (-1293.495) * (-1292.671) [-1293.121] (-1294.309) (-1291.545) -- 0:00:49
267500 -- (-1291.736) (-1291.901) [-1293.932] (-1293.030) * (-1293.446) (-1292.670) [-1294.360] (-1292.974) -- 0:00:49
268000 -- (-1293.493) (-1293.425) [-1292.805] (-1296.097) * [-1299.751] (-1295.002) (-1296.577) (-1293.297) -- 0:00:51
268500 -- [-1294.058] (-1293.269) (-1293.653) (-1295.438) * [-1302.469] (-1292.692) (-1298.496) (-1291.664) -- 0:00:51
269000 -- (-1292.088) [-1293.957] (-1294.464) (-1292.842) * (-1300.141) (-1294.920) [-1295.427] (-1294.106) -- 0:00:51
269500 -- (-1291.528) (-1293.831) (-1296.940) [-1294.191] * (-1292.995) (-1291.992) (-1293.139) [-1292.208] -- 0:00:51
270000 -- (-1292.594) (-1297.303) [-1294.522] (-1293.409) * (-1294.182) (-1296.247) (-1292.788) [-1293.364] -- 0:00:51
Average standard deviation of split frequencies: 0.016041
270500 -- [-1291.969] (-1294.257) (-1292.285) (-1294.165) * (-1298.662) [-1297.101] (-1294.527) (-1292.888) -- 0:00:51
271000 -- (-1291.528) (-1294.743) (-1293.077) [-1293.516] * (-1293.628) (-1293.927) [-1294.081] (-1291.801) -- 0:00:51
271500 -- (-1293.458) [-1295.070] (-1291.275) (-1292.574) * (-1293.951) (-1294.474) [-1294.583] (-1292.196) -- 0:00:50
272000 -- (-1293.386) (-1295.094) (-1291.388) [-1292.871] * (-1294.333) [-1292.392] (-1293.012) (-1297.462) -- 0:00:50
272500 -- (-1294.575) (-1296.950) (-1291.815) [-1295.903] * (-1294.683) (-1291.793) (-1294.850) [-1293.337] -- 0:00:50
273000 -- (-1293.436) (-1292.221) [-1291.613] (-1293.961) * [-1293.497] (-1292.336) (-1291.898) (-1295.419) -- 0:00:50
273500 -- (-1293.291) (-1292.460) (-1291.875) [-1294.025] * (-1291.327) (-1292.470) [-1292.190] (-1293.216) -- 0:00:50
274000 -- [-1294.939] (-1294.437) (-1292.919) (-1293.173) * [-1291.398] (-1293.465) (-1292.240) (-1292.425) -- 0:00:50
274500 -- [-1295.485] (-1296.344) (-1292.747) (-1293.970) * [-1292.174] (-1295.603) (-1291.601) (-1296.068) -- 0:00:50
275000 -- (-1294.078) (-1295.410) (-1292.471) [-1293.479] * [-1292.602] (-1294.701) (-1291.710) (-1295.356) -- 0:00:50
Average standard deviation of split frequencies: 0.015911
275500 -- [-1294.337] (-1294.158) (-1292.116) (-1294.663) * (-1291.692) (-1293.385) (-1291.364) [-1293.813] -- 0:00:49
276000 -- [-1293.630] (-1294.552) (-1296.541) (-1294.393) * (-1292.022) [-1293.512] (-1292.127) (-1294.968) -- 0:00:49
276500 -- (-1292.540) (-1292.502) (-1292.398) [-1294.037] * [-1293.743] (-1294.647) (-1292.049) (-1297.182) -- 0:00:49
277000 -- [-1292.061] (-1293.989) (-1293.361) (-1294.651) * [-1294.880] (-1293.173) (-1294.951) (-1293.385) -- 0:00:49
277500 -- (-1293.413) (-1294.210) [-1292.175] (-1294.601) * (-1294.046) (-1292.961) [-1294.795] (-1293.428) -- 0:00:49
278000 -- (-1293.178) (-1296.431) (-1292.959) [-1292.794] * (-1292.847) (-1293.026) (-1295.069) [-1292.716] -- 0:00:49
278500 -- [-1292.302] (-1293.926) (-1293.381) (-1294.899) * (-1292.278) [-1291.719] (-1299.506) (-1293.485) -- 0:00:49
279000 -- (-1291.183) (-1294.652) [-1293.003] (-1292.148) * [-1291.713] (-1292.699) (-1294.284) (-1294.130) -- 0:00:49
279500 -- (-1292.469) [-1293.611] (-1294.800) (-1292.756) * (-1293.638) [-1297.849] (-1293.566) (-1293.718) -- 0:00:48
280000 -- [-1293.631] (-1292.716) (-1294.847) (-1294.204) * [-1292.775] (-1292.714) (-1295.416) (-1293.102) -- 0:00:48
Average standard deviation of split frequencies: 0.015470
280500 -- [-1292.891] (-1292.213) (-1294.735) (-1292.958) * (-1292.428) (-1293.492) [-1295.240] (-1297.518) -- 0:00:48
281000 -- (-1295.594) (-1292.788) (-1296.139) [-1297.413] * (-1291.914) (-1294.064) [-1295.383] (-1293.303) -- 0:00:48
281500 -- (-1295.604) [-1291.940] (-1296.451) (-1292.642) * (-1293.197) (-1293.101) [-1294.816] (-1292.430) -- 0:00:48
282000 -- [-1291.616] (-1294.343) (-1294.206) (-1292.726) * (-1292.277) (-1293.625) [-1292.273] (-1292.560) -- 0:00:48
282500 -- (-1300.964) [-1293.465] (-1294.553) (-1292.961) * (-1295.133) (-1293.512) (-1292.217) [-1296.400] -- 0:00:50
283000 -- (-1293.541) (-1292.781) (-1294.285) [-1292.443] * (-1293.803) (-1294.222) (-1293.814) [-1298.354] -- 0:00:50
283500 -- [-1293.541] (-1294.412) (-1294.100) (-1293.644) * (-1295.344) [-1291.810] (-1298.294) (-1292.342) -- 0:00:50
284000 -- [-1294.008] (-1292.561) (-1293.093) (-1293.983) * (-1292.708) [-1291.576] (-1294.964) (-1292.556) -- 0:00:50
284500 -- (-1291.819) [-1292.575] (-1295.724) (-1292.182) * (-1293.653) (-1292.369) [-1292.921] (-1291.839) -- 0:00:50
285000 -- (-1293.427) (-1295.353) [-1294.190] (-1291.423) * (-1292.936) (-1295.091) [-1292.955] (-1291.986) -- 0:00:50
Average standard deviation of split frequencies: 0.014574
285500 -- (-1295.180) (-1294.007) (-1292.609) [-1292.357] * (-1292.941) [-1294.293] (-1292.696) (-1292.795) -- 0:00:50
286000 -- [-1296.396] (-1294.956) (-1296.570) (-1292.487) * [-1292.148] (-1292.495) (-1294.852) (-1293.500) -- 0:00:49
286500 -- (-1296.012) [-1291.881] (-1294.370) (-1292.505) * [-1291.854] (-1293.267) (-1294.681) (-1294.838) -- 0:00:49
287000 -- [-1292.028] (-1291.798) (-1297.743) (-1292.411) * (-1291.865) (-1294.114) (-1292.818) [-1294.117] -- 0:00:49
287500 -- (-1291.351) (-1291.904) [-1292.599] (-1294.590) * (-1296.224) (-1292.081) [-1292.617] (-1292.853) -- 0:00:49
288000 -- [-1291.631] (-1295.013) (-1295.693) (-1294.617) * (-1298.144) (-1293.664) (-1294.031) [-1292.048] -- 0:00:49
288500 -- (-1292.358) (-1292.501) (-1293.372) [-1293.655] * (-1291.433) [-1293.720] (-1294.504) (-1295.785) -- 0:00:49
289000 -- (-1295.826) (-1293.120) [-1294.484] (-1295.273) * (-1293.314) (-1295.910) (-1293.358) [-1294.875] -- 0:00:49
289500 -- (-1293.499) (-1292.327) [-1295.210] (-1296.514) * [-1293.982] (-1296.130) (-1295.615) (-1294.518) -- 0:00:49
290000 -- (-1294.698) (-1291.317) [-1295.021] (-1293.875) * (-1291.756) [-1295.122] (-1292.478) (-1294.805) -- 0:00:48
Average standard deviation of split frequencies: 0.013487
290500 -- (-1293.266) [-1293.277] (-1296.876) (-1292.734) * [-1291.992] (-1292.278) (-1294.048) (-1294.821) -- 0:00:48
291000 -- (-1293.504) [-1293.105] (-1293.784) (-1294.963) * (-1292.502) [-1293.109] (-1294.212) (-1293.055) -- 0:00:48
291500 -- [-1291.657] (-1304.842) (-1295.669) (-1294.755) * (-1291.515) (-1293.025) [-1294.126] (-1293.340) -- 0:00:48
292000 -- (-1292.562) (-1293.264) (-1295.101) [-1293.567] * (-1291.584) [-1293.348] (-1295.620) (-1294.337) -- 0:00:48
292500 -- (-1293.672) (-1291.769) (-1294.538) [-1294.785] * [-1292.662] (-1297.358) (-1293.137) (-1293.899) -- 0:00:48
293000 -- [-1296.992] (-1292.337) (-1293.446) (-1295.131) * (-1295.997) [-1293.125] (-1293.868) (-1300.392) -- 0:00:48
293500 -- (-1295.514) [-1292.103] (-1294.111) (-1295.178) * (-1295.968) (-1296.409) (-1295.286) [-1292.542] -- 0:00:48
294000 -- (-1299.109) (-1293.308) (-1294.119) [-1294.547] * (-1306.465) (-1294.635) (-1294.148) [-1291.734] -- 0:00:48
294500 -- [-1295.451] (-1293.379) (-1292.007) (-1292.412) * [-1297.561] (-1295.504) (-1296.317) (-1291.864) -- 0:00:47
295000 -- (-1292.883) (-1293.394) [-1291.954] (-1291.753) * [-1296.101] (-1295.384) (-1296.571) (-1292.974) -- 0:00:47
Average standard deviation of split frequencies: 0.014068
295500 -- (-1292.666) [-1294.168] (-1291.954) (-1293.308) * [-1292.636] (-1294.803) (-1295.100) (-1291.764) -- 0:00:47
296000 -- (-1296.599) (-1293.819) (-1293.265) [-1292.312] * (-1292.277) (-1295.685) [-1294.955] (-1292.942) -- 0:00:47
296500 -- (-1295.095) (-1295.334) (-1296.657) [-1292.999] * (-1295.331) [-1292.566] (-1294.318) (-1292.665) -- 0:00:47
297000 -- (-1295.864) [-1294.380] (-1294.012) (-1292.984) * (-1293.430) [-1292.540] (-1293.487) (-1292.519) -- 0:00:47
297500 -- (-1295.964) [-1293.762] (-1294.870) (-1292.611) * [-1294.549] (-1294.565) (-1294.052) (-1293.440) -- 0:00:49
298000 -- [-1292.817] (-1292.531) (-1292.182) (-1293.562) * [-1291.806] (-1293.221) (-1292.372) (-1294.867) -- 0:00:49
298500 -- (-1291.463) (-1296.446) [-1292.380] (-1293.033) * [-1291.598] (-1294.731) (-1292.688) (-1293.913) -- 0:00:49
299000 -- (-1292.193) [-1292.821] (-1295.016) (-1295.776) * (-1293.338) (-1293.588) [-1296.318] (-1293.824) -- 0:00:49
299500 -- (-1295.419) (-1294.802) [-1294.062] (-1293.115) * (-1295.483) [-1292.480] (-1294.870) (-1293.645) -- 0:00:49
300000 -- (-1293.319) [-1292.948] (-1293.982) (-1292.652) * (-1295.451) [-1293.365] (-1295.011) (-1296.152) -- 0:00:48
Average standard deviation of split frequencies: 0.013414
300500 -- (-1292.553) [-1292.852] (-1294.297) (-1291.789) * (-1296.715) (-1293.464) (-1296.652) [-1295.139] -- 0:00:48
301000 -- (-1294.514) [-1293.040] (-1294.266) (-1299.427) * (-1291.535) (-1292.212) [-1294.202] (-1294.112) -- 0:00:48
301500 -- [-1294.570] (-1293.111) (-1294.709) (-1294.765) * (-1293.244) [-1292.692] (-1292.968) (-1295.655) -- 0:00:48
302000 -- (-1297.683) (-1294.978) (-1293.900) [-1293.920] * [-1292.448] (-1293.751) (-1293.299) (-1291.436) -- 0:00:48
302500 -- [-1291.772] (-1295.718) (-1296.937) (-1294.403) * (-1297.234) [-1293.285] (-1293.279) (-1291.394) -- 0:00:48
303000 -- (-1294.848) (-1295.794) [-1296.369] (-1294.087) * (-1291.836) [-1294.495] (-1293.128) (-1291.390) -- 0:00:48
303500 -- (-1293.180) (-1296.271) [-1295.646] (-1292.606) * [-1292.596] (-1296.202) (-1292.391) (-1294.982) -- 0:00:48
304000 -- [-1294.279] (-1292.429) (-1294.421) (-1294.158) * (-1293.754) (-1297.969) (-1292.579) [-1294.614] -- 0:00:48
304500 -- (-1295.746) [-1293.880] (-1297.734) (-1292.513) * (-1292.268) [-1297.026] (-1293.891) (-1296.850) -- 0:00:47
305000 -- (-1291.572) [-1296.484] (-1296.347) (-1295.770) * (-1292.870) (-1293.358) (-1293.969) [-1294.776] -- 0:00:47
Average standard deviation of split frequencies: 0.012581
305500 -- [-1291.342] (-1296.722) (-1295.521) (-1295.628) * (-1294.068) (-1293.841) [-1293.475] (-1298.777) -- 0:00:47
306000 -- [-1291.240] (-1300.390) (-1291.469) (-1295.880) * (-1293.479) (-1293.584) [-1294.460] (-1293.183) -- 0:00:47
306500 -- (-1292.532) [-1292.602] (-1292.569) (-1298.535) * (-1297.705) [-1293.700] (-1296.897) (-1293.183) -- 0:00:47
307000 -- (-1294.837) (-1294.178) [-1291.896] (-1296.105) * (-1298.262) (-1291.660) [-1291.756] (-1292.699) -- 0:00:47
307500 -- (-1292.683) (-1309.023) [-1291.436] (-1292.981) * (-1293.984) (-1293.071) [-1292.782] (-1292.692) -- 0:00:47
308000 -- [-1292.755] (-1298.371) (-1292.381) (-1292.397) * [-1292.262] (-1294.982) (-1294.073) (-1292.171) -- 0:00:47
308500 -- (-1293.863) [-1293.619] (-1294.234) (-1292.864) * (-1292.209) (-1293.176) [-1295.082] (-1291.944) -- 0:00:47
309000 -- (-1299.793) (-1291.711) [-1294.594] (-1294.825) * (-1293.794) [-1293.581] (-1292.722) (-1293.798) -- 0:00:46
309500 -- (-1295.654) [-1293.377] (-1294.965) (-1296.570) * (-1292.297) [-1293.491] (-1292.645) (-1296.009) -- 0:00:46
310000 -- [-1294.791] (-1293.504) (-1295.393) (-1293.097) * (-1292.775) [-1294.528] (-1293.470) (-1294.975) -- 0:00:46
Average standard deviation of split frequencies: 0.014136
310500 -- (-1292.212) [-1295.003] (-1293.762) (-1291.662) * (-1292.681) (-1293.095) [-1294.289] (-1294.369) -- 0:00:46
311000 -- [-1291.684] (-1292.402) (-1292.265) (-1294.485) * (-1291.624) [-1293.888] (-1293.560) (-1291.440) -- 0:00:46
311500 -- [-1296.721] (-1292.864) (-1292.141) (-1294.350) * (-1294.202) (-1293.475) (-1293.816) [-1292.028] -- 0:00:46
312000 -- (-1296.759) (-1293.434) [-1291.760] (-1294.770) * (-1294.134) (-1298.584) (-1294.269) [-1293.330] -- 0:00:46
312500 -- (-1292.778) [-1296.922] (-1292.988) (-1291.624) * (-1294.408) [-1293.567] (-1297.609) (-1292.597) -- 0:00:46
313000 -- [-1292.776] (-1293.784) (-1293.340) (-1292.023) * (-1294.794) (-1292.520) (-1296.001) [-1294.429] -- 0:00:48
313500 -- (-1291.949) (-1294.646) (-1293.066) [-1293.264] * [-1295.152] (-1293.482) (-1292.759) (-1298.540) -- 0:00:48
314000 -- [-1292.613] (-1294.625) (-1293.167) (-1295.452) * (-1295.418) [-1293.361] (-1291.664) (-1298.082) -- 0:00:48
314500 -- [-1291.718] (-1292.974) (-1293.580) (-1295.232) * (-1295.249) [-1293.368] (-1292.573) (-1293.473) -- 0:00:47
315000 -- [-1292.394] (-1291.945) (-1294.656) (-1295.946) * (-1294.043) (-1291.633) (-1293.759) [-1293.663] -- 0:00:47
Average standard deviation of split frequencies: 0.014368
315500 -- (-1292.442) [-1292.385] (-1293.478) (-1295.394) * [-1295.582] (-1292.164) (-1292.808) (-1294.688) -- 0:00:47
316000 -- [-1291.716] (-1296.529) (-1291.874) (-1294.003) * [-1291.530] (-1292.167) (-1293.283) (-1294.988) -- 0:00:47
316500 -- [-1292.767] (-1293.597) (-1291.685) (-1292.052) * (-1293.237) (-1292.501) [-1291.728] (-1294.703) -- 0:00:47
317000 -- (-1293.888) (-1293.304) [-1291.878] (-1294.341) * (-1292.930) (-1293.106) (-1294.403) [-1292.113] -- 0:00:47
317500 -- (-1294.729) (-1291.889) [-1292.287] (-1291.863) * [-1293.158] (-1292.096) (-1292.030) (-1292.257) -- 0:00:47
318000 -- (-1295.235) (-1293.108) (-1293.341) [-1291.845] * (-1291.819) (-1291.510) (-1293.188) [-1292.026] -- 0:00:47
318500 -- (-1294.051) (-1294.253) (-1293.070) [-1291.755] * (-1293.228) [-1294.316] (-1292.648) (-1296.904) -- 0:00:47
319000 -- (-1299.935) [-1293.632] (-1292.620) (-1291.794) * (-1291.231) (-1293.156) [-1293.902] (-1291.601) -- 0:00:46
319500 -- (-1295.622) (-1294.310) [-1292.494] (-1291.538) * (-1293.855) [-1293.101] (-1294.029) (-1291.799) -- 0:00:46
320000 -- (-1295.254) [-1294.051] (-1292.370) (-1292.844) * (-1292.520) (-1295.760) (-1292.372) [-1292.740] -- 0:00:46
Average standard deviation of split frequencies: 0.014374
320500 -- (-1293.744) (-1296.021) [-1295.466] (-1291.682) * (-1293.861) [-1296.763] (-1291.409) (-1293.307) -- 0:00:46
321000 -- (-1298.117) [-1294.016] (-1297.650) (-1292.282) * (-1294.935) (-1296.147) (-1294.120) [-1291.696] -- 0:00:46
321500 -- (-1299.340) (-1293.215) (-1292.899) [-1293.091] * [-1294.650] (-1291.517) (-1293.522) (-1294.105) -- 0:00:46
322000 -- (-1298.413) [-1293.446] (-1294.483) (-1293.685) * (-1293.781) [-1291.181] (-1292.485) (-1295.669) -- 0:00:46
322500 -- (-1293.497) [-1291.733] (-1296.168) (-1294.111) * (-1293.344) (-1291.694) [-1294.489] (-1294.403) -- 0:00:46
323000 -- (-1292.563) (-1293.570) [-1295.871] (-1293.893) * [-1292.223] (-1292.207) (-1293.243) (-1293.849) -- 0:00:46
323500 -- (-1295.173) (-1293.570) [-1294.007] (-1292.780) * (-1292.526) (-1292.607) (-1292.492) [-1293.884] -- 0:00:46
324000 -- (-1293.416) [-1292.338] (-1292.749) (-1298.571) * [-1292.109] (-1292.182) (-1293.929) (-1293.014) -- 0:00:45
324500 -- (-1294.868) [-1293.474] (-1292.034) (-1295.725) * (-1293.880) [-1293.583] (-1295.270) (-1293.990) -- 0:00:45
325000 -- (-1294.570) [-1292.110] (-1296.061) (-1298.466) * [-1293.656] (-1293.652) (-1293.397) (-1296.604) -- 0:00:45
Average standard deviation of split frequencies: 0.013014
325500 -- (-1293.904) (-1292.961) (-1295.719) [-1292.887] * (-1292.718) [-1292.465] (-1295.044) (-1294.258) -- 0:00:45
326000 -- (-1295.812) (-1291.472) (-1292.858) [-1292.289] * (-1293.426) (-1292.876) (-1296.650) [-1292.886] -- 0:00:45
326500 -- (-1295.855) [-1291.650] (-1292.476) (-1292.949) * (-1292.976) (-1292.619) (-1293.567) [-1292.037] -- 0:00:45
327000 -- (-1295.210) [-1293.170] (-1292.370) (-1294.105) * (-1291.822) [-1293.673] (-1292.737) (-1293.787) -- 0:00:45
327500 -- (-1298.519) [-1293.211] (-1294.879) (-1295.392) * (-1293.955) [-1292.884] (-1292.815) (-1296.306) -- 0:00:47
328000 -- (-1299.209) (-1296.322) (-1293.935) [-1292.442] * (-1292.773) (-1293.675) [-1295.892] (-1298.316) -- 0:00:47
328500 -- [-1295.950] (-1294.942) (-1294.095) (-1293.481) * [-1293.946] (-1295.154) (-1296.071) (-1295.328) -- 0:00:47
329000 -- (-1293.920) (-1293.849) (-1296.625) [-1295.775] * [-1293.032] (-1292.777) (-1292.726) (-1296.045) -- 0:00:46
329500 -- (-1293.789) (-1293.540) (-1294.660) [-1293.622] * [-1292.826] (-1303.038) (-1293.466) (-1294.874) -- 0:00:46
330000 -- (-1295.228) (-1296.008) [-1295.435] (-1293.356) * (-1296.168) (-1294.458) (-1297.060) [-1293.329] -- 0:00:46
Average standard deviation of split frequencies: 0.012327
330500 -- (-1292.927) (-1293.633) [-1294.887] (-1291.842) * [-1292.146] (-1293.558) (-1295.636) (-1301.189) -- 0:00:46
331000 -- (-1292.453) [-1292.987] (-1296.350) (-1293.721) * (-1293.667) (-1292.928) (-1298.172) [-1295.976] -- 0:00:46
331500 -- (-1295.096) (-1293.679) [-1294.963] (-1293.967) * (-1293.524) (-1294.022) [-1296.428] (-1292.168) -- 0:00:46
332000 -- (-1294.785) [-1292.636] (-1295.726) (-1293.031) * (-1292.464) (-1295.958) [-1296.510] (-1292.017) -- 0:00:46
332500 -- [-1294.622] (-1293.422) (-1296.094) (-1292.274) * (-1293.431) [-1293.461] (-1293.613) (-1292.335) -- 0:00:46
333000 -- (-1297.393) [-1292.622] (-1292.508) (-1294.087) * (-1292.861) (-1291.331) (-1294.156) [-1295.103] -- 0:00:46
333500 -- (-1304.947) (-1292.849) [-1292.647] (-1295.395) * (-1294.369) [-1292.751] (-1293.967) (-1294.618) -- 0:00:45
334000 -- [-1301.077] (-1291.759) (-1294.706) (-1294.910) * (-1293.308) [-1297.512] (-1292.530) (-1295.243) -- 0:00:45
334500 -- (-1295.219) (-1292.950) (-1294.346) [-1295.161] * [-1291.556] (-1293.896) (-1294.050) (-1294.057) -- 0:00:45
335000 -- (-1294.252) (-1292.656) [-1292.382] (-1297.134) * [-1292.282] (-1292.567) (-1292.649) (-1300.652) -- 0:00:45
Average standard deviation of split frequencies: 0.013070
335500 -- [-1291.743] (-1293.034) (-1291.467) (-1295.899) * (-1293.168) [-1293.484] (-1297.417) (-1297.242) -- 0:00:45
336000 -- (-1293.035) (-1291.640) (-1294.758) [-1293.661] * [-1291.771] (-1292.844) (-1293.512) (-1298.465) -- 0:00:45
336500 -- (-1296.827) (-1294.529) (-1294.483) [-1295.359] * (-1298.725) (-1292.322) (-1294.588) [-1294.773] -- 0:00:45
337000 -- [-1292.023] (-1292.408) (-1292.670) (-1294.393) * (-1296.722) (-1292.122) (-1294.855) [-1293.407] -- 0:00:45
337500 -- (-1293.223) [-1293.255] (-1292.565) (-1294.150) * (-1294.344) [-1292.558] (-1293.364) (-1293.401) -- 0:00:45
338000 -- (-1292.862) (-1292.398) (-1295.513) [-1292.681] * (-1296.958) [-1292.727] (-1302.506) (-1292.197) -- 0:00:45
338500 -- [-1292.858] (-1293.753) (-1291.533) (-1293.361) * [-1293.550] (-1295.292) (-1293.125) (-1292.124) -- 0:00:44
339000 -- (-1292.410) [-1293.672] (-1295.385) (-1296.545) * [-1295.966] (-1292.685) (-1293.463) (-1294.734) -- 0:00:44
339500 -- (-1292.394) (-1291.455) (-1296.210) [-1296.582] * (-1293.789) (-1292.534) (-1298.767) [-1294.765] -- 0:00:44
340000 -- (-1295.827) (-1291.472) (-1293.323) [-1293.488] * (-1297.941) [-1292.618] (-1296.198) (-1292.928) -- 0:00:46
Average standard deviation of split frequencies: 0.013182
340500 -- (-1292.634) (-1291.599) (-1294.131) [-1291.999] * (-1296.480) [-1293.000] (-1296.545) (-1292.644) -- 0:00:46
341000 -- (-1292.480) [-1292.071] (-1294.826) (-1295.801) * (-1291.989) (-1293.000) [-1294.824] (-1292.448) -- 0:00:46
341500 -- (-1292.683) (-1292.295) (-1292.907) [-1292.059] * (-1292.290) [-1294.326] (-1293.607) (-1294.995) -- 0:00:46
342000 -- [-1296.341] (-1291.635) (-1292.941) (-1292.288) * (-1292.544) (-1295.725) [-1293.535] (-1297.269) -- 0:00:46
342500 -- [-1293.058] (-1291.157) (-1292.764) (-1292.123) * (-1293.758) (-1293.966) (-1293.247) [-1295.330] -- 0:00:46
343000 -- (-1294.136) (-1293.019) (-1293.011) [-1292.827] * [-1292.370] (-1297.622) (-1292.521) (-1294.097) -- 0:00:45
343500 -- [-1295.765] (-1293.792) (-1295.132) (-1295.799) * (-1292.356) (-1294.807) (-1294.470) [-1294.252] -- 0:00:45
344000 -- [-1293.518] (-1293.310) (-1292.876) (-1296.136) * [-1292.033] (-1292.381) (-1294.735) (-1294.700) -- 0:00:45
344500 -- (-1294.100) (-1295.423) [-1294.003] (-1293.304) * (-1292.840) (-1296.252) (-1297.247) [-1293.925] -- 0:00:45
345000 -- [-1295.090] (-1295.167) (-1292.386) (-1292.259) * (-1291.872) [-1291.955] (-1293.304) (-1292.342) -- 0:00:45
Average standard deviation of split frequencies: 0.012867
345500 -- (-1295.250) (-1291.864) [-1297.912] (-1291.715) * (-1291.849) [-1293.579] (-1295.036) (-1293.091) -- 0:00:45
346000 -- [-1295.021] (-1294.005) (-1300.018) (-1291.670) * (-1293.063) (-1292.861) (-1296.570) [-1293.537] -- 0:00:45
346500 -- (-1298.601) (-1294.499) (-1303.803) [-1291.805] * (-1291.484) (-1292.861) (-1293.799) [-1293.619] -- 0:00:45
347000 -- [-1299.639] (-1295.052) (-1297.338) (-1294.074) * (-1291.494) [-1293.001] (-1293.799) (-1291.743) -- 0:00:45
347500 -- (-1295.476) (-1293.463) [-1292.956] (-1291.649) * (-1293.036) [-1294.416] (-1292.241) (-1291.714) -- 0:00:45
348000 -- (-1300.180) (-1294.530) (-1293.868) [-1291.646] * (-1295.136) (-1294.603) [-1294.644] (-1296.357) -- 0:00:44
348500 -- (-1293.914) [-1292.263] (-1294.195) (-1292.937) * (-1295.807) (-1293.780) (-1294.786) [-1293.985] -- 0:00:44
349000 -- (-1293.631) [-1292.549] (-1293.016) (-1295.178) * (-1294.650) (-1293.076) [-1294.418] (-1295.528) -- 0:00:44
349500 -- (-1293.601) [-1293.082] (-1293.052) (-1293.230) * (-1293.277) [-1292.677] (-1295.187) (-1293.969) -- 0:00:44
350000 -- [-1291.632] (-1292.732) (-1296.340) (-1294.284) * (-1293.221) [-1291.832] (-1295.193) (-1294.352) -- 0:00:44
Average standard deviation of split frequencies: 0.012494
350500 -- (-1291.505) (-1292.999) [-1292.472] (-1291.925) * [-1292.770] (-1293.700) (-1293.740) (-1292.950) -- 0:00:44
351000 -- (-1291.850) (-1292.278) (-1293.448) [-1294.723] * (-1292.824) (-1291.824) (-1294.709) [-1294.225] -- 0:00:44
351500 -- [-1293.228] (-1296.658) (-1295.421) (-1294.169) * [-1292.081] (-1292.348) (-1292.611) (-1292.345) -- 0:00:44
352000 -- (-1293.560) [-1292.471] (-1295.121) (-1296.460) * (-1292.083) (-1294.430) (-1292.716) [-1292.305] -- 0:00:44
352500 -- (-1295.325) (-1295.607) (-1294.986) [-1292.852] * (-1297.095) (-1296.371) (-1292.988) [-1292.897] -- 0:00:44
353000 -- (-1294.572) (-1292.170) [-1299.202] (-1306.381) * (-1297.341) (-1292.263) [-1292.768] (-1292.897) -- 0:00:45
353500 -- (-1294.449) [-1291.853] (-1292.155) (-1294.242) * (-1298.907) (-1291.602) [-1292.397] (-1292.970) -- 0:00:45
354000 -- (-1294.056) [-1291.488] (-1292.498) (-1294.371) * (-1297.218) [-1292.340] (-1292.423) (-1292.039) -- 0:00:45
354500 -- (-1291.912) [-1291.939] (-1294.049) (-1292.451) * (-1295.099) (-1292.804) (-1293.555) [-1291.828] -- 0:00:45
355000 -- (-1291.605) (-1291.635) [-1297.542] (-1294.205) * (-1292.132) (-1291.911) [-1293.311] (-1293.699) -- 0:00:45
Average standard deviation of split frequencies: 0.011762
355500 -- (-1294.781) [-1291.829] (-1293.861) (-1294.876) * (-1291.989) (-1291.864) [-1292.307] (-1292.071) -- 0:00:45
356000 -- (-1297.332) (-1292.536) [-1294.346] (-1294.682) * (-1295.965) [-1291.901] (-1292.324) (-1293.954) -- 0:00:45
356500 -- (-1294.916) (-1292.322) (-1291.512) [-1295.873] * (-1295.357) (-1292.502) (-1295.823) [-1294.937] -- 0:00:45
357000 -- (-1294.436) (-1292.390) [-1292.383] (-1294.994) * (-1292.249) [-1293.552] (-1292.804) (-1291.353) -- 0:00:45
357500 -- (-1297.857) (-1295.546) [-1294.025] (-1295.124) * (-1293.080) [-1293.362] (-1293.776) (-1293.271) -- 0:00:44
358000 -- (-1294.919) [-1292.284] (-1295.399) (-1292.222) * [-1292.561] (-1292.559) (-1292.449) (-1298.453) -- 0:00:44
358500 -- (-1292.899) (-1292.448) (-1292.741) [-1292.090] * [-1291.778] (-1292.965) (-1292.833) (-1297.644) -- 0:00:44
359000 -- [-1292.156] (-1293.686) (-1295.093) (-1292.931) * [-1293.753] (-1294.426) (-1293.181) (-1292.668) -- 0:00:44
359500 -- [-1293.122] (-1294.770) (-1294.635) (-1293.370) * (-1292.651) [-1295.990] (-1293.863) (-1293.708) -- 0:00:44
360000 -- (-1292.442) (-1296.462) (-1291.780) [-1291.869] * (-1293.103) [-1294.617] (-1294.023) (-1297.678) -- 0:00:44
Average standard deviation of split frequencies: 0.011273
360500 -- (-1292.271) (-1292.078) (-1292.590) [-1292.544] * (-1294.270) (-1295.635) (-1294.387) [-1295.954] -- 0:00:44
361000 -- (-1294.188) [-1292.140] (-1291.341) (-1292.625) * (-1293.033) [-1291.414] (-1291.475) (-1294.554) -- 0:00:44
361500 -- (-1292.416) (-1291.890) (-1292.297) [-1292.799] * [-1292.432] (-1293.415) (-1292.474) (-1294.855) -- 0:00:44
362000 -- (-1292.416) (-1292.331) (-1294.720) [-1292.801] * (-1293.725) (-1292.722) [-1294.962] (-1297.098) -- 0:00:44
362500 -- (-1294.291) [-1292.680] (-1294.951) (-1293.329) * [-1291.588] (-1292.052) (-1291.781) (-1300.631) -- 0:00:43
363000 -- [-1292.209] (-1295.764) (-1293.369) (-1293.920) * (-1294.323) [-1294.431] (-1292.053) (-1298.307) -- 0:00:43
363500 -- (-1292.204) (-1298.518) [-1293.252] (-1295.662) * [-1293.661] (-1293.993) (-1298.712) (-1292.029) -- 0:00:43
364000 -- (-1296.900) [-1294.114] (-1293.124) (-1294.725) * (-1293.437) (-1293.085) (-1297.078) [-1291.637] -- 0:00:43
364500 -- (-1294.819) (-1292.287) [-1292.101] (-1293.343) * [-1293.768] (-1296.019) (-1295.258) (-1291.572) -- 0:00:43
365000 -- [-1293.521] (-1293.638) (-1294.746) (-1294.067) * (-1293.879) [-1294.657] (-1292.626) (-1292.942) -- 0:00:43
Average standard deviation of split frequencies: 0.010455
365500 -- [-1292.151] (-1293.600) (-1297.086) (-1295.496) * [-1292.533] (-1295.738) (-1292.626) (-1292.306) -- 0:00:43
366000 -- (-1293.653) [-1292.692] (-1292.680) (-1292.274) * [-1294.775] (-1291.813) (-1296.127) (-1291.568) -- 0:00:43
366500 -- [-1293.636] (-1296.850) (-1297.172) (-1293.234) * (-1292.459) [-1291.594] (-1297.851) (-1291.932) -- 0:00:43
367000 -- (-1294.262) (-1294.475) (-1292.931) [-1293.477] * (-1292.599) (-1292.769) [-1299.221] (-1292.621) -- 0:00:43
367500 -- (-1297.837) (-1295.111) [-1292.374] (-1296.160) * [-1292.614] (-1297.517) (-1292.881) (-1292.559) -- 0:00:44
368000 -- (-1295.325) (-1293.241) (-1294.223) [-1292.849] * (-1293.675) (-1297.963) (-1295.003) [-1293.422] -- 0:00:44
368500 -- [-1293.523] (-1293.759) (-1293.063) (-1293.376) * (-1294.366) [-1294.994] (-1293.132) (-1293.386) -- 0:00:44
369000 -- (-1299.968) [-1293.131] (-1294.938) (-1292.587) * (-1294.023) (-1295.350) (-1293.155) [-1291.859] -- 0:00:44
369500 -- (-1294.049) (-1292.419) (-1293.673) [-1291.909] * [-1291.592] (-1295.337) (-1294.862) (-1292.872) -- 0:00:44
370000 -- (-1292.589) (-1296.373) (-1292.476) [-1294.513] * (-1293.127) [-1295.215] (-1293.117) (-1291.603) -- 0:00:44
Average standard deviation of split frequencies: 0.010623
370500 -- (-1291.885) (-1295.535) [-1293.976] (-1296.989) * (-1292.446) (-1294.285) (-1293.773) [-1291.645] -- 0:00:44
371000 -- (-1292.532) [-1294.106] (-1292.572) (-1293.909) * (-1295.650) (-1295.617) (-1293.678) [-1291.615] -- 0:00:44
371500 -- (-1296.960) [-1292.946] (-1302.413) (-1295.413) * (-1293.863) [-1292.266] (-1295.469) (-1294.365) -- 0:00:43
372000 -- (-1296.959) [-1292.509] (-1293.425) (-1295.440) * (-1293.084) (-1292.212) [-1295.156] (-1291.934) -- 0:00:43
372500 -- (-1297.965) (-1295.422) [-1297.639] (-1298.589) * (-1292.769) (-1291.892) (-1292.686) [-1294.293] -- 0:00:43
373000 -- (-1295.600) (-1293.245) (-1303.655) [-1294.082] * [-1294.335] (-1292.937) (-1292.994) (-1293.004) -- 0:00:43
373500 -- (-1293.978) [-1293.240] (-1293.996) (-1294.502) * (-1291.929) (-1292.169) (-1291.990) [-1292.176] -- 0:00:43
374000 -- (-1292.968) (-1294.271) [-1299.690] (-1292.868) * (-1292.607) (-1296.180) (-1295.253) [-1292.118] -- 0:00:43
374500 -- [-1295.027] (-1292.730) (-1296.626) (-1293.660) * (-1292.990) (-1297.558) [-1293.204] (-1291.377) -- 0:00:43
375000 -- (-1294.492) (-1292.831) (-1296.128) [-1293.659] * (-1295.131) (-1294.454) [-1292.883] (-1292.549) -- 0:00:43
Average standard deviation of split frequencies: 0.010472
375500 -- (-1292.248) [-1291.615] (-1293.531) (-1293.000) * (-1295.568) (-1294.943) (-1292.805) [-1295.099] -- 0:00:43
376000 -- (-1291.779) [-1293.704] (-1291.697) (-1293.919) * (-1293.553) [-1293.130] (-1292.192) (-1294.351) -- 0:00:43
376500 -- (-1292.258) [-1294.701] (-1295.427) (-1295.050) * [-1293.323] (-1298.816) (-1293.167) (-1294.772) -- 0:00:43
377000 -- (-1294.650) (-1294.966) [-1295.015] (-1295.523) * [-1294.484] (-1294.694) (-1293.653) (-1295.978) -- 0:00:42
377500 -- (-1294.932) (-1291.793) [-1295.819] (-1293.818) * (-1293.826) (-1293.354) [-1293.046] (-1294.844) -- 0:00:42
378000 -- (-1295.056) (-1292.514) [-1293.258] (-1292.974) * (-1292.439) [-1293.343] (-1294.116) (-1294.526) -- 0:00:42
378500 -- [-1293.135] (-1292.332) (-1292.317) (-1294.543) * [-1292.271] (-1294.661) (-1294.088) (-1292.947) -- 0:00:42
379000 -- (-1294.751) (-1292.010) [-1292.173] (-1292.048) * (-1292.530) [-1292.579] (-1292.664) (-1293.010) -- 0:00:42
379500 -- (-1295.178) [-1291.889] (-1292.347) (-1292.183) * (-1294.210) [-1292.381] (-1292.760) (-1292.636) -- 0:00:42
380000 -- (-1292.633) [-1292.920] (-1293.805) (-1292.631) * (-1294.368) (-1292.398) [-1295.768] (-1293.736) -- 0:00:42
Average standard deviation of split frequencies: 0.010563
380500 -- (-1293.255) (-1292.452) (-1292.008) [-1293.057] * (-1295.225) [-1294.475] (-1295.582) (-1293.210) -- 0:00:42
381000 -- (-1292.782) (-1295.896) [-1291.460] (-1294.224) * (-1298.633) [-1295.819] (-1295.272) (-1293.978) -- 0:00:42
381500 -- (-1293.881) (-1293.552) (-1291.767) [-1293.689] * (-1293.971) [-1293.179] (-1297.582) (-1297.196) -- 0:00:42
382000 -- (-1292.492) (-1293.042) (-1294.443) [-1293.437] * (-1294.773) [-1293.901] (-1294.675) (-1300.954) -- 0:00:43
382500 -- [-1291.871] (-1292.011) (-1293.937) (-1291.574) * (-1293.535) [-1295.179] (-1295.394) (-1292.375) -- 0:00:43
383000 -- [-1292.398] (-1293.552) (-1291.204) (-1291.674) * [-1292.126] (-1291.891) (-1292.836) (-1294.744) -- 0:00:43
383500 -- (-1291.631) (-1294.320) [-1292.097] (-1292.751) * [-1294.073] (-1294.619) (-1292.085) (-1296.140) -- 0:00:43
384000 -- [-1294.374] (-1292.615) (-1298.681) (-1293.927) * [-1294.541] (-1294.744) (-1293.135) (-1294.620) -- 0:00:43
384500 -- (-1292.622) (-1292.029) (-1294.086) [-1293.076] * (-1293.582) (-1295.550) [-1292.546] (-1293.015) -- 0:00:43
385000 -- (-1295.525) [-1293.257] (-1294.656) (-1294.235) * [-1293.596] (-1294.017) (-1292.969) (-1292.385) -- 0:00:43
Average standard deviation of split frequencies: 0.010991
385500 -- (-1294.144) (-1292.809) (-1293.190) [-1293.744] * (-1292.723) [-1292.146] (-1295.308) (-1294.165) -- 0:00:43
386000 -- (-1296.149) (-1295.236) [-1294.805] (-1296.922) * (-1292.273) (-1292.216) [-1293.693] (-1292.116) -- 0:00:42
386500 -- (-1292.586) (-1295.024) [-1292.199] (-1295.094) * (-1291.582) (-1292.509) [-1294.743] (-1291.398) -- 0:00:42
387000 -- [-1291.987] (-1294.140) (-1291.694) (-1294.078) * (-1291.803) (-1291.847) (-1296.915) [-1292.861] -- 0:00:42
387500 -- [-1293.838] (-1292.047) (-1294.571) (-1296.139) * [-1292.735] (-1293.089) (-1293.188) (-1292.457) -- 0:00:42
388000 -- (-1293.321) (-1295.939) [-1292.369] (-1292.869) * (-1294.557) (-1293.162) [-1291.637] (-1294.161) -- 0:00:42
388500 -- (-1293.008) (-1295.939) (-1292.592) [-1293.811] * (-1291.858) (-1293.540) (-1292.216) [-1295.499] -- 0:00:42
389000 -- (-1292.431) (-1297.950) (-1294.632) [-1293.478] * (-1291.952) (-1294.470) (-1291.550) [-1293.667] -- 0:00:42
389500 -- (-1292.754) (-1293.403) (-1295.653) [-1292.751] * (-1293.126) [-1293.074] (-1295.786) (-1295.295) -- 0:00:42
390000 -- [-1292.173] (-1300.263) (-1291.917) (-1297.622) * (-1294.645) (-1291.724) [-1292.198] (-1295.006) -- 0:00:42
Average standard deviation of split frequencies: 0.011144
390500 -- (-1291.714) (-1295.262) (-1298.213) [-1293.902] * (-1295.692) (-1292.521) (-1300.215) [-1292.910] -- 0:00:42
391000 -- (-1292.998) (-1293.698) (-1292.235) [-1293.217] * (-1293.040) [-1291.952] (-1301.859) (-1292.954) -- 0:00:42
391500 -- (-1296.497) (-1293.437) (-1298.646) [-1294.513] * (-1292.042) (-1294.060) [-1296.469] (-1294.927) -- 0:00:41
392000 -- [-1297.070] (-1294.279) (-1299.829) (-1294.099) * (-1291.915) [-1294.884] (-1294.761) (-1292.540) -- 0:00:41
392500 -- [-1294.169] (-1296.276) (-1294.010) (-1291.731) * [-1292.021] (-1294.925) (-1292.970) (-1296.519) -- 0:00:41
393000 -- (-1293.515) [-1294.602] (-1292.647) (-1292.371) * (-1295.112) (-1292.616) (-1292.222) [-1292.331] -- 0:00:41
393500 -- (-1293.370) (-1296.267) (-1292.485) [-1291.762] * (-1295.298) (-1294.199) [-1292.986] (-1295.284) -- 0:00:41
394000 -- [-1292.385] (-1294.037) (-1291.380) (-1294.269) * (-1294.268) (-1293.143) [-1293.081] (-1295.751) -- 0:00:41
394500 -- (-1292.636) [-1292.276] (-1291.082) (-1297.615) * (-1293.490) (-1293.549) [-1293.296] (-1297.017) -- 0:00:41
395000 -- [-1292.431] (-1292.846) (-1296.394) (-1292.465) * (-1292.095) (-1292.600) [-1293.325] (-1297.648) -- 0:00:41
Average standard deviation of split frequencies: 0.011830
395500 -- (-1293.646) [-1291.813] (-1291.709) (-1293.193) * (-1292.360) [-1293.441] (-1291.980) (-1292.831) -- 0:00:41
396000 -- (-1295.860) [-1291.810] (-1292.236) (-1292.780) * [-1293.454] (-1295.434) (-1294.269) (-1293.336) -- 0:00:41
396500 -- (-1295.028) (-1293.108) [-1293.640] (-1292.419) * (-1297.823) [-1295.258] (-1293.641) (-1293.174) -- 0:00:41
397000 -- (-1293.578) (-1293.058) (-1293.310) [-1291.942] * (-1295.187) [-1295.284] (-1294.629) (-1294.920) -- 0:00:41
397500 -- (-1291.881) (-1292.893) [-1292.442] (-1294.369) * [-1294.520] (-1291.974) (-1293.571) (-1298.786) -- 0:00:40
398000 -- [-1292.416] (-1293.390) (-1292.399) (-1298.658) * (-1294.055) (-1295.042) (-1293.753) [-1296.575] -- 0:00:42
398500 -- (-1291.619) (-1292.459) (-1291.880) [-1294.016] * (-1294.895) (-1295.468) (-1293.691) [-1292.876] -- 0:00:42
399000 -- (-1292.040) (-1296.398) (-1291.397) [-1293.951] * (-1291.811) (-1293.310) (-1300.976) [-1291.282] -- 0:00:42
399500 -- [-1291.476] (-1292.508) (-1294.500) (-1291.556) * (-1291.900) (-1293.482) (-1294.412) [-1292.582] -- 0:00:42
400000 -- (-1292.953) (-1292.986) (-1293.408) [-1293.063] * (-1292.594) (-1293.706) [-1291.709] (-1294.837) -- 0:00:41
Average standard deviation of split frequencies: 0.011839
400500 -- (-1295.028) (-1292.283) (-1296.009) [-1293.862] * (-1293.875) (-1296.978) [-1291.153] (-1297.641) -- 0:00:41
401000 -- (-1292.914) [-1293.117] (-1295.144) (-1293.584) * [-1291.982] (-1295.890) (-1291.178) (-1291.353) -- 0:00:41
401500 -- (-1293.405) [-1292.492] (-1293.505) (-1294.746) * (-1291.929) (-1294.963) (-1294.102) [-1292.363] -- 0:00:41
402000 -- (-1293.419) [-1292.140] (-1294.237) (-1293.190) * [-1293.128] (-1292.532) (-1294.571) (-1292.952) -- 0:00:41
402500 -- (-1292.556) (-1297.463) [-1294.933] (-1294.383) * [-1293.987] (-1293.525) (-1291.100) (-1296.788) -- 0:00:41
403000 -- [-1292.253] (-1293.047) (-1292.920) (-1291.487) * (-1293.095) (-1293.611) [-1291.675] (-1297.699) -- 0:00:41
403500 -- (-1293.193) [-1293.151] (-1294.981) (-1293.090) * (-1293.347) (-1291.756) (-1291.905) [-1292.911] -- 0:00:41
404000 -- (-1295.531) [-1296.460] (-1293.124) (-1295.382) * (-1295.732) [-1293.059] (-1292.926) (-1293.860) -- 0:00:41
404500 -- [-1293.131] (-1294.002) (-1292.991) (-1296.826) * (-1293.963) (-1295.900) [-1294.582] (-1293.584) -- 0:00:41
405000 -- (-1292.468) (-1295.050) [-1294.839] (-1293.903) * (-1293.630) (-1292.405) [-1292.029] (-1293.689) -- 0:00:41
Average standard deviation of split frequencies: 0.012191
405500 -- (-1292.580) (-1293.926) [-1292.395] (-1292.343) * (-1292.039) (-1292.917) [-1292.097] (-1293.331) -- 0:00:41
406000 -- [-1292.190] (-1297.248) (-1293.779) (-1295.712) * [-1292.048] (-1294.670) (-1292.718) (-1292.260) -- 0:00:40
406500 -- [-1292.708] (-1292.747) (-1297.131) (-1293.896) * [-1292.835] (-1297.387) (-1294.074) (-1296.193) -- 0:00:40
407000 -- (-1293.840) (-1292.096) [-1295.463] (-1293.742) * (-1294.502) (-1292.716) (-1292.087) [-1295.574] -- 0:00:40
407500 -- (-1292.345) (-1293.898) (-1293.945) [-1293.334] * [-1295.168] (-1299.360) (-1292.665) (-1297.174) -- 0:00:40
408000 -- (-1291.871) [-1292.331] (-1293.072) (-1294.252) * (-1292.276) [-1294.206] (-1292.265) (-1298.107) -- 0:00:40
408500 -- (-1292.907) (-1292.294) (-1296.850) [-1293.702] * [-1292.539] (-1293.361) (-1292.289) (-1292.273) -- 0:00:40
409000 -- (-1291.740) (-1292.541) [-1294.128] (-1297.060) * (-1292.428) [-1294.610] (-1291.701) (-1293.373) -- 0:00:40
409500 -- (-1295.743) (-1293.609) [-1292.637] (-1293.677) * (-1293.196) (-1294.060) (-1292.376) [-1292.033] -- 0:00:40
410000 -- (-1295.743) [-1293.204] (-1292.840) (-1293.696) * [-1295.344] (-1294.318) (-1292.820) (-1291.461) -- 0:00:40
Average standard deviation of split frequencies: 0.012087
410500 -- [-1293.338] (-1293.276) (-1295.195) (-1296.834) * (-1294.208) (-1293.821) (-1294.496) [-1291.892] -- 0:00:40
411000 -- (-1298.867) (-1292.905) [-1294.328] (-1300.624) * (-1294.908) [-1294.952] (-1293.944) (-1294.660) -- 0:00:40
411500 -- (-1296.858) [-1291.970] (-1295.302) (-1298.255) * (-1295.610) (-1292.922) (-1296.738) [-1293.844] -- 0:00:40
412000 -- (-1293.677) (-1293.194) [-1297.717] (-1297.976) * (-1293.589) (-1295.727) [-1295.201] (-1300.149) -- 0:00:39
412500 -- [-1296.615] (-1294.686) (-1295.105) (-1292.925) * (-1292.369) [-1293.459] (-1292.317) (-1294.144) -- 0:00:39
413000 -- (-1295.757) (-1296.547) (-1292.770) [-1291.898] * (-1292.428) [-1294.172] (-1292.792) (-1296.336) -- 0:00:39
413500 -- (-1295.902) (-1294.975) (-1292.620) [-1292.005] * (-1291.547) (-1292.563) (-1294.003) [-1291.998] -- 0:00:41
414000 -- (-1293.543) (-1300.037) [-1293.117] (-1291.327) * [-1291.901] (-1296.736) (-1293.911) (-1293.457) -- 0:00:41
414500 -- (-1295.186) [-1294.982] (-1291.698) (-1292.390) * (-1292.327) (-1294.991) (-1293.945) [-1292.902] -- 0:00:40
415000 -- (-1293.338) (-1292.241) (-1292.851) [-1293.602] * (-1293.177) [-1296.032] (-1293.937) (-1296.556) -- 0:00:40
Average standard deviation of split frequencies: 0.011465
415500 -- [-1293.711] (-1291.766) (-1296.204) (-1299.096) * (-1292.979) [-1293.367] (-1292.947) (-1299.095) -- 0:00:40
416000 -- (-1295.858) (-1293.548) [-1294.886] (-1293.054) * (-1293.447) (-1292.433) (-1292.525) [-1293.460] -- 0:00:40
416500 -- [-1294.607] (-1293.238) (-1294.382) (-1293.163) * (-1292.159) (-1293.130) (-1292.552) [-1294.004] -- 0:00:40
417000 -- (-1293.310) (-1292.901) (-1293.476) [-1292.982] * [-1292.002] (-1294.254) (-1294.789) (-1292.032) -- 0:00:40
417500 -- (-1296.008) [-1293.393] (-1293.502) (-1293.715) * (-1292.473) (-1294.365) (-1294.733) [-1293.881] -- 0:00:40
418000 -- [-1294.632] (-1293.602) (-1293.214) (-1294.238) * (-1293.698) (-1294.925) [-1294.841] (-1291.573) -- 0:00:40
418500 -- (-1299.529) (-1293.815) [-1298.971] (-1292.510) * (-1293.029) (-1296.041) (-1296.009) [-1293.292] -- 0:00:40
419000 -- [-1292.725] (-1293.990) (-1296.348) (-1291.829) * (-1292.698) [-1292.732] (-1293.004) (-1293.758) -- 0:00:40
419500 -- (-1294.473) (-1294.992) [-1294.040] (-1291.630) * (-1292.181) [-1292.792] (-1293.571) (-1293.692) -- 0:00:40
420000 -- (-1293.139) (-1300.480) (-1293.567) [-1292.518] * (-1294.819) (-1293.596) (-1294.736) [-1292.910] -- 0:00:40
Average standard deviation of split frequencies: 0.011668
420500 -- (-1293.874) [-1296.630] (-1293.646) (-1294.325) * [-1293.765] (-1294.140) (-1296.700) (-1292.854) -- 0:00:39
421000 -- (-1292.920) (-1293.213) (-1292.487) [-1292.873] * (-1295.083) (-1291.653) [-1295.424] (-1292.744) -- 0:00:39
421500 -- (-1293.005) (-1293.570) [-1293.594] (-1291.684) * (-1294.087) (-1291.742) (-1295.893) [-1292.043] -- 0:00:39
422000 -- (-1293.061) (-1295.386) (-1293.045) [-1292.322] * (-1293.142) [-1294.316] (-1293.952) (-1292.791) -- 0:00:39
422500 -- (-1291.394) [-1294.212] (-1294.765) (-1296.675) * [-1292.671] (-1295.565) (-1297.778) (-1294.163) -- 0:00:39
423000 -- [-1294.866] (-1294.648) (-1292.332) (-1293.355) * [-1292.094] (-1296.188) (-1293.163) (-1295.866) -- 0:00:39
423500 -- [-1294.712] (-1293.875) (-1293.355) (-1292.892) * (-1291.995) (-1294.957) [-1296.104] (-1297.093) -- 0:00:39
424000 -- (-1293.837) [-1292.363] (-1295.639) (-1296.836) * (-1291.946) [-1291.673] (-1295.668) (-1293.284) -- 0:00:39
424500 -- [-1293.246] (-1291.261) (-1294.881) (-1297.661) * (-1294.391) [-1293.395] (-1295.952) (-1294.121) -- 0:00:39
425000 -- (-1291.873) (-1291.521) (-1300.914) [-1292.445] * (-1293.411) [-1293.420] (-1295.064) (-1293.208) -- 0:00:39
Average standard deviation of split frequencies: 0.010545
425500 -- (-1293.446) [-1293.095] (-1295.306) (-1294.596) * (-1295.352) [-1291.603] (-1297.668) (-1291.692) -- 0:00:39
426000 -- (-1293.505) [-1294.074] (-1298.261) (-1291.716) * (-1291.940) (-1291.529) [-1291.953] (-1293.118) -- 0:00:39
426500 -- [-1293.163] (-1293.271) (-1292.381) (-1295.648) * [-1292.892] (-1291.529) (-1293.742) (-1294.516) -- 0:00:38
427000 -- [-1291.573] (-1294.406) (-1293.243) (-1294.170) * [-1294.779] (-1291.914) (-1294.726) (-1297.029) -- 0:00:38
427500 -- (-1295.838) (-1291.260) (-1294.031) [-1292.017] * (-1294.777) (-1291.876) (-1296.999) [-1294.700] -- 0:00:38
428000 -- (-1292.519) (-1293.537) [-1294.185] (-1294.922) * (-1294.689) (-1292.564) [-1293.906] (-1293.807) -- 0:00:38
428500 -- (-1292.258) (-1293.406) (-1298.355) [-1292.068] * (-1294.310) (-1296.245) [-1293.203] (-1293.988) -- 0:00:40
429000 -- (-1292.402) (-1291.903) (-1292.707) [-1293.095] * [-1291.950] (-1292.204) (-1293.199) (-1295.975) -- 0:00:39
429500 -- (-1291.981) (-1291.671) [-1291.385] (-1293.109) * [-1292.394] (-1291.678) (-1294.076) (-1295.172) -- 0:00:39
430000 -- [-1291.714] (-1293.400) (-1304.722) (-1292.831) * [-1293.086] (-1293.215) (-1293.183) (-1298.295) -- 0:00:39
Average standard deviation of split frequencies: 0.010560
430500 -- [-1292.682] (-1294.789) (-1296.279) (-1295.897) * (-1296.177) (-1293.852) [-1292.777] (-1292.007) -- 0:00:39
431000 -- (-1292.001) (-1298.481) [-1293.942] (-1291.729) * (-1296.156) [-1297.138] (-1292.668) (-1292.973) -- 0:00:39
431500 -- (-1295.422) (-1293.888) (-1294.876) [-1292.366] * (-1291.803) [-1292.888] (-1294.147) (-1299.759) -- 0:00:39
432000 -- (-1291.739) [-1292.961] (-1293.486) (-1291.929) * (-1294.763) [-1293.391] (-1296.828) (-1294.898) -- 0:00:39
432500 -- (-1292.680) (-1297.609) [-1292.845] (-1295.234) * (-1293.708) (-1292.946) [-1295.213] (-1295.781) -- 0:00:39
433000 -- (-1292.570) (-1294.176) (-1291.868) [-1294.588] * (-1297.101) (-1293.538) (-1293.909) [-1295.798] -- 0:00:39
433500 -- [-1293.093] (-1294.335) (-1293.161) (-1291.816) * (-1295.094) (-1291.608) [-1294.005] (-1295.105) -- 0:00:39
434000 -- [-1293.578] (-1299.669) (-1297.301) (-1292.760) * (-1294.090) [-1292.133] (-1296.217) (-1293.630) -- 0:00:39
434500 -- (-1291.741) (-1293.674) [-1293.203] (-1294.519) * [-1293.544] (-1292.000) (-1292.814) (-1292.731) -- 0:00:39
435000 -- (-1293.549) (-1292.161) [-1294.474] (-1294.274) * (-1296.592) (-1293.358) [-1292.312] (-1291.525) -- 0:00:38
Average standard deviation of split frequencies: 0.010176
435500 -- (-1293.055) (-1295.556) [-1292.789] (-1293.716) * (-1295.351) [-1293.567] (-1293.958) (-1292.025) -- 0:00:38
436000 -- (-1296.948) (-1294.938) (-1291.967) [-1292.471] * (-1293.592) [-1294.487] (-1293.835) (-1291.767) -- 0:00:38
436500 -- (-1299.114) [-1293.627] (-1291.415) (-1295.609) * [-1294.040] (-1292.901) (-1296.800) (-1294.264) -- 0:00:38
437000 -- (-1299.658) [-1295.166] (-1293.246) (-1292.767) * (-1295.411) [-1292.715] (-1296.719) (-1297.453) -- 0:00:38
437500 -- (-1293.739) (-1295.105) (-1298.008) [-1294.759] * (-1294.262) [-1291.654] (-1292.519) (-1294.249) -- 0:00:38
438000 -- [-1291.611] (-1296.355) (-1293.620) (-1292.848) * (-1294.510) [-1291.654] (-1293.419) (-1294.233) -- 0:00:38
438500 -- (-1295.834) (-1292.902) [-1293.780] (-1294.303) * (-1293.233) (-1292.937) [-1293.498] (-1293.731) -- 0:00:38
439000 -- (-1292.209) [-1291.749] (-1295.073) (-1294.089) * (-1294.306) (-1293.814) [-1295.970] (-1293.399) -- 0:00:38
439500 -- (-1292.522) (-1291.723) [-1297.046] (-1296.189) * (-1292.315) (-1292.389) (-1295.798) [-1291.607] -- 0:00:38
440000 -- [-1294.143] (-1292.560) (-1293.611) (-1293.032) * (-1297.438) [-1294.497] (-1297.176) (-1295.312) -- 0:00:38
Average standard deviation of split frequencies: 0.010509
440500 -- (-1293.270) [-1294.095] (-1293.018) (-1291.917) * (-1293.253) (-1298.179) [-1294.940] (-1303.360) -- 0:00:38
441000 -- (-1295.911) (-1295.906) [-1291.669] (-1292.474) * (-1294.394) (-1296.558) [-1295.783] (-1291.403) -- 0:00:38
441500 -- (-1292.987) (-1297.672) (-1291.729) [-1292.345] * (-1292.553) (-1294.804) (-1294.316) [-1291.855] -- 0:00:37
442000 -- (-1293.510) [-1297.709] (-1291.767) (-1296.522) * (-1292.937) (-1293.455) (-1295.953) [-1295.234] -- 0:00:37
442500 -- (-1293.900) [-1292.231] (-1295.325) (-1293.391) * (-1293.386) (-1295.614) [-1294.771] (-1296.134) -- 0:00:37
443000 -- (-1294.811) [-1292.379] (-1293.760) (-1297.150) * (-1293.310) [-1291.854] (-1293.205) (-1297.747) -- 0:00:37
443500 -- [-1295.245] (-1294.331) (-1294.119) (-1292.844) * (-1293.015) [-1292.126] (-1296.465) (-1296.520) -- 0:00:37
444000 -- (-1291.894) (-1293.778) (-1297.752) [-1292.698] * (-1293.692) [-1292.757] (-1296.310) (-1294.159) -- 0:00:38
444500 -- (-1292.525) (-1293.716) [-1291.977] (-1297.970) * (-1292.815) (-1293.095) [-1292.993] (-1293.073) -- 0:00:38
445000 -- (-1292.265) (-1293.015) [-1291.832] (-1292.620) * [-1293.524] (-1294.975) (-1292.247) (-1293.318) -- 0:00:38
Average standard deviation of split frequencies: 0.011450
445500 -- (-1292.948) (-1293.511) [-1292.256] (-1295.330) * (-1294.093) (-1291.307) [-1291.509] (-1293.101) -- 0:00:38
446000 -- [-1292.176] (-1291.844) (-1291.725) (-1293.004) * (-1293.091) [-1292.096] (-1294.888) (-1292.986) -- 0:00:38
446500 -- (-1297.284) [-1291.697] (-1291.925) (-1293.536) * [-1294.667] (-1299.805) (-1293.869) (-1293.864) -- 0:00:38
447000 -- (-1293.556) [-1293.291] (-1294.214) (-1294.317) * (-1294.858) (-1293.553) [-1291.534] (-1295.705) -- 0:00:38
447500 -- (-1293.686) (-1301.286) (-1299.302) [-1293.138] * (-1292.919) (-1293.206) [-1295.801] (-1296.255) -- 0:00:38
448000 -- (-1294.442) (-1295.777) [-1293.609] (-1291.994) * (-1295.761) (-1294.836) (-1294.905) [-1293.475] -- 0:00:38
448500 -- (-1294.439) (-1293.027) (-1293.266) [-1295.163] * (-1292.009) [-1293.018] (-1292.989) (-1293.276) -- 0:00:38
449000 -- [-1293.533] (-1293.575) (-1292.243) (-1298.052) * (-1293.144) [-1293.602] (-1295.796) (-1293.106) -- 0:00:38
449500 -- (-1294.159) (-1292.668) [-1293.216] (-1293.299) * [-1293.956] (-1292.784) (-1293.379) (-1292.171) -- 0:00:37
450000 -- (-1294.167) (-1292.574) [-1292.828] (-1293.031) * (-1292.198) [-1292.999] (-1293.214) (-1292.679) -- 0:00:37
Average standard deviation of split frequencies: 0.011390
450500 -- [-1292.159] (-1292.447) (-1295.872) (-1293.863) * (-1293.732) (-1293.102) [-1293.468] (-1299.868) -- 0:00:37
451000 -- (-1293.274) (-1294.204) (-1292.585) [-1293.046] * (-1296.219) (-1294.450) [-1292.169] (-1294.834) -- 0:00:37
451500 -- (-1292.896) (-1291.776) [-1293.679] (-1293.822) * (-1295.226) (-1294.651) [-1296.314] (-1293.691) -- 0:00:37
452000 -- (-1291.618) (-1291.888) [-1296.033] (-1294.637) * (-1294.127) (-1292.203) [-1297.275] (-1297.565) -- 0:00:37
452500 -- (-1292.439) (-1292.216) [-1293.809] (-1295.755) * (-1294.184) (-1292.083) [-1294.625] (-1298.086) -- 0:00:37
453000 -- (-1293.246) (-1292.804) [-1292.298] (-1293.816) * (-1293.323) (-1292.079) [-1295.160] (-1292.204) -- 0:00:37
453500 -- (-1292.415) (-1298.073) [-1292.782] (-1293.583) * (-1291.552) (-1295.682) (-1294.928) [-1291.660] -- 0:00:37
454000 -- (-1293.290) (-1296.186) [-1293.802] (-1296.166) * (-1291.778) (-1294.400) (-1294.890) [-1291.884] -- 0:00:37
454500 -- (-1291.587) (-1293.048) (-1294.244) [-1292.857] * (-1292.178) (-1293.638) (-1295.578) [-1292.251] -- 0:00:37
455000 -- (-1292.365) (-1293.406) [-1293.016] (-1293.166) * (-1292.002) (-1293.954) [-1294.699] (-1291.646) -- 0:00:37
Average standard deviation of split frequencies: 0.011250
455500 -- (-1293.186) (-1295.150) [-1292.854] (-1294.020) * [-1292.312] (-1296.010) (-1293.984) (-1291.847) -- 0:00:37
456000 -- (-1293.157) (-1293.878) [-1293.821] (-1292.584) * (-1291.714) [-1297.032] (-1294.537) (-1300.328) -- 0:00:36
456500 -- (-1295.837) [-1292.306] (-1300.143) (-1294.988) * (-1292.114) [-1296.989] (-1293.520) (-1295.765) -- 0:00:36
457000 -- (-1293.352) (-1292.652) [-1293.105] (-1296.029) * (-1294.904) (-1294.679) [-1294.194] (-1294.262) -- 0:00:36
457500 -- (-1295.958) [-1292.496] (-1293.225) (-1299.238) * (-1293.261) (-1296.414) (-1293.988) [-1294.236] -- 0:00:36
458000 -- [-1292.480] (-1293.196) (-1293.075) (-1295.906) * (-1293.117) (-1295.329) (-1294.281) [-1292.375] -- 0:00:36
458500 -- (-1293.696) (-1293.289) [-1292.981] (-1294.683) * (-1292.410) [-1292.923] (-1294.103) (-1293.520) -- 0:00:36
459000 -- (-1296.364) [-1293.120] (-1291.834) (-1292.728) * (-1292.349) (-1292.768) (-1291.630) [-1292.763] -- 0:00:36
459500 -- (-1298.999) [-1293.516] (-1292.514) (-1293.346) * (-1294.973) [-1293.881] (-1293.084) (-1293.423) -- 0:00:36
460000 -- (-1294.135) (-1293.853) (-1292.312) [-1291.770] * (-1294.416) (-1293.262) (-1294.044) [-1293.901] -- 0:00:37
Average standard deviation of split frequencies: 0.010594
460500 -- [-1292.537] (-1294.276) (-1292.842) (-1294.044) * [-1292.802] (-1298.906) (-1292.800) (-1296.112) -- 0:00:37
461000 -- [-1292.332] (-1296.408) (-1291.545) (-1292.085) * (-1293.364) (-1293.780) [-1292.805] (-1292.568) -- 0:00:37
461500 -- (-1292.472) (-1293.407) [-1291.844] (-1293.773) * (-1296.029) (-1292.643) (-1293.418) [-1291.714] -- 0:00:37
462000 -- (-1292.003) [-1293.305] (-1293.751) (-1293.057) * (-1296.485) (-1293.830) [-1295.615] (-1293.640) -- 0:00:37
462500 -- (-1301.300) (-1292.593) [-1294.626] (-1292.509) * (-1297.238) (-1293.982) (-1294.733) [-1291.598] -- 0:00:37
463000 -- (-1299.053) [-1292.295] (-1295.074) (-1295.860) * (-1292.312) [-1293.230] (-1293.806) (-1293.221) -- 0:00:37
463500 -- (-1293.744) [-1292.228] (-1292.169) (-1295.769) * (-1294.959) (-1292.390) (-1292.971) [-1292.799] -- 0:00:37
464000 -- (-1293.610) (-1293.605) [-1295.607] (-1291.809) * (-1293.576) [-1296.136] (-1293.115) (-1293.634) -- 0:00:36
464500 -- [-1294.612] (-1293.268) (-1292.943) (-1291.407) * (-1294.527) (-1294.722) [-1292.980] (-1294.820) -- 0:00:36
465000 -- (-1292.479) [-1292.318] (-1293.695) (-1291.581) * (-1295.955) [-1296.982] (-1297.187) (-1291.977) -- 0:00:36
Average standard deviation of split frequencies: 0.010949
465500 -- (-1293.118) (-1292.261) (-1293.961) [-1291.845] * (-1297.840) (-1294.351) [-1291.788] (-1291.681) -- 0:00:36
466000 -- (-1295.945) (-1297.280) [-1293.369] (-1291.600) * (-1296.126) (-1295.941) [-1293.671] (-1292.557) -- 0:00:36
466500 -- (-1293.917) [-1293.870] (-1295.317) (-1291.683) * (-1294.021) [-1295.890] (-1292.601) (-1293.216) -- 0:00:36
467000 -- (-1291.833) [-1292.649] (-1293.355) (-1293.650) * (-1294.294) (-1292.803) [-1292.683] (-1292.146) -- 0:00:36
467500 -- (-1292.235) (-1292.301) (-1295.544) [-1292.681] * (-1294.100) (-1295.394) (-1292.242) [-1297.941] -- 0:00:36
468000 -- (-1291.511) (-1295.175) (-1293.943) [-1291.229] * (-1292.014) [-1295.146] (-1291.696) (-1294.833) -- 0:00:36
468500 -- [-1292.653] (-1291.882) (-1295.910) (-1291.229) * [-1291.895] (-1294.650) (-1292.347) (-1293.536) -- 0:00:36
469000 -- (-1292.903) (-1294.438) [-1294.542] (-1291.229) * (-1292.568) (-1294.458) [-1291.669] (-1292.631) -- 0:00:36
469500 -- (-1293.905) (-1292.996) (-1292.026) [-1293.349] * [-1293.305] (-1294.421) (-1291.664) (-1292.837) -- 0:00:36
470000 -- [-1291.495] (-1295.640) (-1293.260) (-1292.989) * (-1294.592) (-1296.093) [-1292.498] (-1294.004) -- 0:00:36
Average standard deviation of split frequencies: 0.011135
470500 -- (-1294.928) (-1298.459) (-1293.665) [-1292.626] * [-1291.925] (-1293.622) (-1292.775) (-1294.549) -- 0:00:36
471000 -- (-1295.792) (-1294.250) [-1292.823] (-1292.609) * [-1293.827] (-1293.380) (-1291.895) (-1293.022) -- 0:00:35
471500 -- [-1292.836] (-1293.186) (-1292.175) (-1292.570) * (-1299.050) (-1293.926) (-1295.297) [-1293.955] -- 0:00:35
472000 -- (-1293.521) [-1291.849] (-1299.152) (-1293.510) * (-1299.909) [-1294.610] (-1299.870) (-1292.618) -- 0:00:35
472500 -- (-1292.393) (-1297.086) (-1298.401) [-1296.992] * (-1293.266) (-1295.481) (-1292.748) [-1292.253] -- 0:00:35
473000 -- (-1293.155) (-1295.847) [-1295.168] (-1294.912) * [-1292.708] (-1295.968) (-1293.417) (-1297.140) -- 0:00:35
473500 -- (-1294.677) (-1295.819) (-1293.706) [-1297.092] * (-1292.625) [-1292.824] (-1293.465) (-1292.869) -- 0:00:35
474000 -- (-1297.225) [-1291.819] (-1294.157) (-1294.876) * [-1292.340] (-1295.189) (-1292.247) (-1292.544) -- 0:00:35
474500 -- (-1295.444) (-1293.679) (-1297.843) [-1293.876] * (-1293.366) (-1291.938) [-1292.489] (-1293.295) -- 0:00:35
475000 -- (-1291.936) (-1293.194) (-1292.957) [-1293.958] * (-1294.799) (-1292.778) (-1292.492) [-1293.933] -- 0:00:35
Average standard deviation of split frequencies: 0.010584
475500 -- (-1294.759) (-1294.751) (-1292.649) [-1294.840] * (-1294.618) [-1293.658] (-1292.249) (-1292.671) -- 0:00:36
476000 -- (-1295.251) (-1294.832) [-1297.640] (-1294.030) * (-1295.810) (-1293.374) (-1291.417) [-1292.595] -- 0:00:36
476500 -- (-1292.419) (-1296.397) (-1292.308) [-1293.993] * (-1292.412) [-1292.338] (-1291.994) (-1292.222) -- 0:00:36
477000 -- [-1291.445] (-1292.431) (-1294.487) (-1292.480) * (-1291.270) [-1292.837] (-1291.638) (-1292.583) -- 0:00:36
477500 -- [-1293.514] (-1292.675) (-1293.910) (-1294.853) * (-1297.684) (-1292.023) (-1292.201) [-1293.020] -- 0:00:36
478000 -- (-1293.221) (-1294.848) (-1297.828) [-1292.329] * (-1295.323) [-1293.174] (-1296.768) (-1293.525) -- 0:00:36
478500 -- [-1292.597] (-1296.092) (-1296.746) (-1292.566) * (-1292.654) (-1292.075) (-1294.098) [-1291.705] -- 0:00:35
479000 -- [-1292.402] (-1295.722) (-1292.373) (-1294.412) * [-1294.944] (-1292.489) (-1291.621) (-1292.686) -- 0:00:35
479500 -- (-1296.439) (-1294.983) [-1293.244] (-1296.402) * (-1294.596) [-1294.076] (-1293.157) (-1293.732) -- 0:00:35
480000 -- [-1291.782] (-1296.403) (-1292.777) (-1292.812) * (-1294.208) [-1294.407] (-1293.117) (-1293.732) -- 0:00:35
Average standard deviation of split frequencies: 0.010236
480500 -- (-1296.666) [-1296.080] (-1294.801) (-1293.953) * [-1293.447] (-1294.987) (-1294.855) (-1292.886) -- 0:00:35
481000 -- (-1294.182) (-1301.246) (-1293.893) [-1291.595] * (-1292.819) (-1291.693) (-1294.596) [-1292.722] -- 0:00:35
481500 -- (-1293.894) [-1294.309] (-1293.983) (-1292.058) * (-1297.481) [-1291.918] (-1294.872) (-1296.951) -- 0:00:35
482000 -- (-1294.585) (-1292.760) (-1295.238) [-1293.923] * (-1299.159) (-1291.768) (-1303.567) [-1292.912] -- 0:00:35
482500 -- (-1292.557) (-1292.627) (-1292.205) [-1291.623] * [-1293.118] (-1291.243) (-1298.435) (-1293.028) -- 0:00:35
483000 -- [-1292.958] (-1294.015) (-1293.861) (-1292.320) * (-1292.832) (-1291.322) [-1294.621] (-1291.667) -- 0:00:35
483500 -- (-1293.411) (-1292.149) (-1292.096) [-1292.154] * (-1293.070) (-1291.733) (-1294.546) [-1291.172] -- 0:00:35
484000 -- (-1295.523) (-1296.325) [-1293.180] (-1292.234) * (-1292.228) (-1294.864) (-1295.039) [-1291.417] -- 0:00:35
484500 -- [-1291.580] (-1292.902) (-1291.945) (-1291.869) * (-1292.632) (-1292.633) [-1292.366] (-1291.309) -- 0:00:35
485000 -- (-1292.167) (-1295.089) (-1292.144) [-1291.123] * (-1294.478) (-1292.040) (-1292.196) [-1291.577] -- 0:00:35
Average standard deviation of split frequencies: 0.010670
485500 -- [-1293.086] (-1291.873) (-1292.682) (-1293.945) * (-1292.242) [-1291.840] (-1292.790) (-1291.635) -- 0:00:34
486000 -- (-1294.756) (-1294.317) [-1292.927] (-1292.068) * (-1292.826) (-1291.195) [-1292.752] (-1293.450) -- 0:00:34
486500 -- (-1295.058) [-1294.315] (-1293.071) (-1292.168) * (-1293.540) (-1291.915) [-1291.695] (-1294.064) -- 0:00:34
487000 -- (-1295.107) (-1295.226) [-1292.254] (-1291.560) * (-1292.296) (-1292.251) (-1300.748) [-1293.527] -- 0:00:34
487500 -- (-1295.708) (-1291.956) (-1292.313) [-1292.117] * (-1291.704) (-1291.599) [-1292.814] (-1292.888) -- 0:00:34
488000 -- (-1295.307) (-1291.867) [-1294.828] (-1292.994) * (-1291.736) (-1292.065) (-1294.510) [-1292.419] -- 0:00:34
488500 -- [-1295.396] (-1291.965) (-1293.540) (-1293.660) * (-1294.327) (-1295.258) [-1294.104] (-1294.942) -- 0:00:34
489000 -- (-1292.532) (-1295.740) (-1295.370) [-1295.213] * [-1294.870] (-1293.306) (-1293.878) (-1294.560) -- 0:00:34
489500 -- [-1292.514] (-1295.958) (-1292.899) (-1294.129) * (-1295.458) (-1297.075) (-1295.315) [-1293.476] -- 0:00:34
490000 -- [-1294.296] (-1292.189) (-1295.816) (-1294.346) * (-1292.903) [-1293.082] (-1293.955) (-1296.060) -- 0:00:34
Average standard deviation of split frequencies: 0.010794
490500 -- (-1297.394) [-1298.734] (-1292.400) (-1291.260) * (-1295.949) (-1292.183) (-1296.418) [-1294.351] -- 0:00:34
491000 -- (-1295.057) (-1293.897) [-1291.471] (-1291.266) * (-1294.736) [-1291.639] (-1295.365) (-1294.173) -- 0:00:34
491500 -- (-1294.090) (-1294.277) (-1293.664) [-1292.291] * [-1293.962] (-1295.384) (-1297.546) (-1296.628) -- 0:00:35
492000 -- (-1292.505) [-1295.134] (-1293.699) (-1296.343) * (-1293.754) [-1291.731] (-1295.136) (-1297.899) -- 0:00:35
492500 -- [-1292.191] (-1296.962) (-1294.198) (-1294.419) * [-1291.627] (-1293.739) (-1295.050) (-1295.290) -- 0:00:35
493000 -- (-1292.222) [-1294.859] (-1295.434) (-1294.475) * (-1291.359) (-1294.628) [-1294.367] (-1293.017) -- 0:00:34
493500 -- (-1292.919) (-1294.019) (-1295.576) [-1294.291] * [-1293.601] (-1293.938) (-1293.939) (-1292.634) -- 0:00:34
494000 -- (-1292.626) (-1293.109) (-1294.201) [-1292.075] * (-1294.553) [-1292.371] (-1298.556) (-1292.697) -- 0:00:34
494500 -- [-1292.626] (-1293.091) (-1293.908) (-1291.300) * (-1294.456) [-1293.352] (-1295.563) (-1293.151) -- 0:00:34
495000 -- (-1291.654) (-1295.390) [-1296.460] (-1291.766) * (-1292.625) (-1292.355) [-1293.505] (-1293.299) -- 0:00:34
Average standard deviation of split frequencies: 0.010846
495500 -- (-1294.872) (-1295.774) (-1296.691) [-1292.648] * (-1292.176) (-1300.111) (-1293.896) [-1293.309] -- 0:00:34
496000 -- (-1293.420) (-1294.595) [-1293.434] (-1292.349) * (-1292.657) (-1294.678) (-1292.090) [-1292.939] -- 0:00:34
496500 -- [-1293.730] (-1295.156) (-1294.512) (-1293.504) * (-1292.331) (-1291.403) [-1293.401] (-1293.756) -- 0:00:34
497000 -- [-1293.569] (-1294.381) (-1293.085) (-1294.091) * (-1294.417) (-1291.396) (-1294.698) [-1294.927] -- 0:00:34
497500 -- (-1292.829) (-1294.294) [-1295.154] (-1293.934) * (-1294.598) [-1293.824] (-1295.920) (-1292.949) -- 0:00:34
498000 -- [-1294.154] (-1295.680) (-1293.597) (-1292.052) * [-1294.519] (-1294.010) (-1295.234) (-1294.602) -- 0:00:34
498500 -- (-1294.338) [-1295.925] (-1295.251) (-1293.134) * (-1295.756) (-1294.473) (-1295.059) [-1294.602] -- 0:00:34
499000 -- (-1293.435) (-1294.214) [-1296.692] (-1291.660) * (-1295.358) (-1296.919) (-1291.765) [-1296.703] -- 0:00:34
499500 -- [-1292.532] (-1291.742) (-1292.848) (-1297.920) * (-1293.518) (-1297.956) (-1294.155) [-1296.617] -- 0:00:34
500000 -- (-1292.713) (-1295.519) (-1295.804) [-1292.387] * [-1292.465] (-1294.754) (-1291.564) (-1293.446) -- 0:00:34
Average standard deviation of split frequencies: 0.011354
500500 -- (-1294.492) [-1293.970] (-1294.617) (-1294.361) * (-1293.025) (-1299.870) [-1294.146] (-1293.719) -- 0:00:33
501000 -- (-1294.075) [-1293.061] (-1291.926) (-1297.187) * [-1295.992] (-1300.116) (-1292.457) (-1293.667) -- 0:00:33
501500 -- [-1293.766] (-1292.540) (-1293.353) (-1298.190) * [-1294.006] (-1298.678) (-1294.479) (-1293.420) -- 0:00:33
502000 -- (-1291.907) [-1292.942] (-1293.161) (-1297.918) * (-1295.214) [-1297.426] (-1296.077) (-1294.810) -- 0:00:33
502500 -- [-1292.509] (-1292.200) (-1296.537) (-1295.320) * [-1293.432] (-1297.783) (-1294.525) (-1294.839) -- 0:00:33
503000 -- (-1292.523) (-1292.504) (-1295.354) [-1293.089] * (-1293.632) (-1291.331) [-1293.023] (-1297.151) -- 0:00:33
503500 -- (-1297.552) [-1295.612] (-1292.240) (-1301.105) * [-1292.501] (-1292.062) (-1296.808) (-1293.432) -- 0:00:33
504000 -- (-1294.027) [-1296.782] (-1292.994) (-1298.158) * [-1291.793] (-1291.979) (-1298.016) (-1295.343) -- 0:00:33
504500 -- (-1292.667) [-1291.706] (-1292.337) (-1296.666) * [-1294.057] (-1292.497) (-1297.327) (-1295.219) -- 0:00:33
505000 -- [-1295.005] (-1291.725) (-1293.005) (-1295.252) * [-1294.355] (-1297.219) (-1291.947) (-1293.055) -- 0:00:33
Average standard deviation of split frequencies: 0.011399
505500 -- [-1291.804] (-1294.764) (-1296.053) (-1294.189) * [-1292.169] (-1294.883) (-1292.731) (-1294.819) -- 0:00:33
506000 -- (-1292.459) (-1292.661) (-1294.829) [-1294.311] * [-1292.210] (-1294.934) (-1293.111) (-1295.007) -- 0:00:33
506500 -- (-1293.656) [-1294.689] (-1294.578) (-1297.409) * (-1294.926) (-1301.048) [-1291.764] (-1294.449) -- 0:00:34
507000 -- (-1294.756) [-1294.553] (-1295.156) (-1295.935) * (-1298.966) (-1296.660) (-1293.209) [-1295.160] -- 0:00:34
507500 -- [-1295.859] (-1294.222) (-1294.194) (-1292.834) * (-1294.865) (-1294.302) [-1294.210] (-1295.353) -- 0:00:33
508000 -- [-1291.913] (-1298.960) (-1292.835) (-1293.200) * (-1291.692) (-1292.069) (-1294.438) [-1295.514] -- 0:00:33
508500 -- (-1292.049) (-1293.934) (-1293.517) [-1292.439] * (-1292.033) (-1292.773) (-1296.036) [-1298.168] -- 0:00:33
509000 -- (-1293.188) (-1291.861) [-1292.972] (-1296.127) * (-1293.469) (-1292.998) [-1293.775] (-1294.393) -- 0:00:33
509500 -- (-1293.686) (-1292.923) (-1293.145) [-1292.609] * (-1293.687) [-1291.566] (-1300.436) (-1293.889) -- 0:00:33
510000 -- (-1292.339) (-1291.362) (-1293.424) [-1292.296] * [-1293.347] (-1298.275) (-1292.101) (-1294.136) -- 0:00:33
Average standard deviation of split frequencies: 0.011512
510500 -- (-1293.724) (-1291.424) [-1292.463] (-1291.854) * (-1295.180) (-1293.680) (-1292.395) [-1294.956] -- 0:00:33
511000 -- (-1294.866) (-1292.430) (-1292.968) [-1296.046] * (-1296.161) (-1293.802) (-1293.863) [-1293.191] -- 0:00:33
511500 -- (-1291.995) [-1297.841] (-1291.897) (-1296.313) * (-1291.369) (-1293.807) (-1292.081) [-1292.011] -- 0:00:33
512000 -- (-1294.211) (-1297.827) [-1292.007] (-1293.488) * (-1295.621) (-1292.680) (-1292.205) [-1294.531] -- 0:00:33
512500 -- (-1294.245) (-1295.320) [-1291.342] (-1293.118) * [-1291.477] (-1297.084) (-1292.221) (-1294.111) -- 0:00:33
513000 -- (-1292.461) (-1294.393) (-1293.185) [-1292.811] * (-1291.868) (-1295.975) (-1293.176) [-1292.853] -- 0:00:33
513500 -- (-1295.804) [-1292.906] (-1296.733) (-1294.613) * [-1291.846] (-1295.298) (-1292.600) (-1294.210) -- 0:00:33
514000 -- (-1292.514) [-1292.399] (-1295.756) (-1292.129) * (-1293.233) (-1294.207) (-1292.473) [-1293.969] -- 0:00:33
514500 -- (-1292.282) (-1291.475) (-1294.746) [-1293.520] * (-1296.346) [-1292.780] (-1292.273) (-1295.239) -- 0:00:33
515000 -- [-1293.961] (-1291.838) (-1295.059) (-1293.680) * (-1294.001) [-1294.551] (-1292.266) (-1301.149) -- 0:00:32
Average standard deviation of split frequencies: 0.011232
515500 -- [-1292.229] (-1295.992) (-1292.802) (-1293.877) * (-1297.633) (-1293.515) (-1291.257) [-1294.265] -- 0:00:32
516000 -- [-1292.201] (-1293.214) (-1297.238) (-1292.627) * (-1299.745) (-1293.681) (-1292.794) [-1292.979] -- 0:00:32
516500 -- (-1295.952) [-1296.398] (-1293.709) (-1294.233) * [-1297.372] (-1292.342) (-1294.686) (-1291.795) -- 0:00:32
517000 -- (-1293.277) [-1294.254] (-1294.382) (-1294.198) * (-1294.677) (-1292.149) (-1294.145) [-1294.211] -- 0:00:32
517500 -- [-1292.903] (-1294.403) (-1296.656) (-1298.582) * [-1294.588] (-1298.973) (-1292.491) (-1294.839) -- 0:00:32
518000 -- (-1294.977) [-1293.838] (-1293.288) (-1294.647) * (-1296.951) (-1293.338) (-1294.289) [-1294.999] -- 0:00:32
518500 -- [-1292.316] (-1297.198) (-1294.128) (-1292.637) * [-1295.132] (-1292.875) (-1292.444) (-1294.444) -- 0:00:32
519000 -- (-1294.425) (-1296.182) (-1292.459) [-1294.466] * (-1293.586) [-1292.746] (-1292.509) (-1296.099) -- 0:00:32
519500 -- (-1295.921) [-1293.097] (-1292.635) (-1297.073) * (-1299.211) (-1292.652) (-1292.650) [-1296.379] -- 0:00:32
520000 -- (-1293.458) (-1292.750) (-1296.816) [-1292.989] * (-1294.358) (-1293.498) [-1293.337] (-1292.147) -- 0:00:32
Average standard deviation of split frequencies: 0.011770
520500 -- (-1294.279) (-1292.719) [-1292.899] (-1294.082) * (-1291.803) [-1293.045] (-1295.539) (-1292.038) -- 0:00:32
521000 -- (-1293.934) (-1291.838) (-1296.541) [-1295.416] * (-1295.923) [-1291.852] (-1295.265) (-1294.014) -- 0:00:32
521500 -- (-1294.580) (-1291.782) (-1296.419) [-1293.700] * (-1295.770) [-1294.900] (-1292.075) (-1294.624) -- 0:00:33
522000 -- (-1293.449) (-1292.446) [-1299.947] (-1295.042) * (-1293.888) (-1293.364) (-1292.716) [-1295.410] -- 0:00:32
522500 -- (-1292.929) (-1291.929) [-1293.925] (-1293.235) * (-1292.002) (-1294.535) (-1292.887) [-1295.332] -- 0:00:32
523000 -- (-1291.794) (-1292.750) (-1301.198) [-1292.551] * (-1294.138) [-1292.563] (-1294.262) (-1295.982) -- 0:00:32
523500 -- (-1295.071) (-1299.520) [-1298.390] (-1294.028) * (-1294.287) (-1295.741) (-1295.625) [-1295.820] -- 0:00:32
524000 -- (-1292.446) (-1294.164) [-1294.405] (-1292.619) * (-1292.179) [-1295.182] (-1297.974) (-1295.488) -- 0:00:32
524500 -- [-1293.349] (-1297.538) (-1292.180) (-1300.186) * (-1291.944) (-1293.397) (-1294.002) [-1295.197] -- 0:00:32
525000 -- (-1298.513) (-1295.532) (-1294.624) [-1296.802] * (-1292.733) (-1292.613) [-1292.851] (-1293.567) -- 0:00:32
Average standard deviation of split frequencies: 0.011440
525500 -- (-1293.984) (-1293.746) (-1296.647) [-1295.216] * [-1292.228] (-1298.484) (-1293.140) (-1292.441) -- 0:00:32
526000 -- (-1294.055) [-1296.371] (-1295.636) (-1297.778) * (-1292.746) (-1294.261) (-1292.253) [-1292.456] -- 0:00:32
526500 -- (-1295.129) [-1292.063] (-1295.596) (-1294.447) * (-1291.523) (-1291.472) (-1291.195) [-1292.620] -- 0:00:32
527000 -- (-1295.967) (-1296.025) (-1295.977) [-1296.504] * [-1292.213] (-1293.211) (-1292.659) (-1293.455) -- 0:00:32
527500 -- [-1293.102] (-1295.944) (-1294.109) (-1292.942) * (-1293.170) (-1291.536) [-1292.060] (-1292.349) -- 0:00:32
528000 -- [-1291.510] (-1293.343) (-1293.766) (-1295.727) * (-1293.274) (-1292.182) [-1292.111] (-1294.701) -- 0:00:32
528500 -- (-1291.508) [-1292.696] (-1295.417) (-1293.826) * [-1293.773] (-1293.583) (-1294.062) (-1293.295) -- 0:00:32
529000 -- (-1292.429) (-1291.586) [-1292.002] (-1294.245) * (-1294.306) (-1291.829) [-1292.883] (-1293.147) -- 0:00:32
529500 -- [-1292.904] (-1294.249) (-1295.009) (-1294.248) * (-1293.439) [-1292.552] (-1295.259) (-1293.904) -- 0:00:31
530000 -- (-1294.293) [-1295.252] (-1293.699) (-1296.475) * [-1294.369] (-1292.043) (-1291.956) (-1292.830) -- 0:00:31
Average standard deviation of split frequencies: 0.011809
530500 -- (-1292.931) [-1293.743] (-1292.334) (-1292.447) * (-1291.869) (-1298.468) (-1292.725) [-1294.679] -- 0:00:31
531000 -- (-1296.691) (-1294.419) (-1299.891) [-1292.401] * (-1293.795) [-1297.572] (-1299.423) (-1296.145) -- 0:00:31
531500 -- (-1294.913) (-1296.678) (-1292.590) [-1293.170] * [-1293.794] (-1294.597) (-1297.741) (-1293.764) -- 0:00:31
532000 -- (-1295.480) (-1293.823) (-1292.332) [-1292.194] * (-1292.167) (-1291.549) (-1293.653) [-1295.612] -- 0:00:31
532500 -- [-1294.174] (-1292.702) (-1296.836) (-1293.266) * (-1292.196) (-1292.896) [-1293.228] (-1294.449) -- 0:00:31
533000 -- (-1294.812) (-1291.955) (-1294.281) [-1291.859] * (-1291.422) (-1294.091) [-1297.881] (-1294.196) -- 0:00:31
533500 -- (-1292.020) (-1293.760) [-1292.958] (-1292.562) * (-1292.372) (-1294.223) (-1293.796) [-1296.363] -- 0:00:31
534000 -- (-1291.938) (-1292.752) (-1291.965) [-1292.799] * (-1292.805) (-1293.655) [-1296.570] (-1298.163) -- 0:00:31
534500 -- (-1297.681) [-1291.737] (-1291.335) (-1293.737) * (-1293.273) [-1293.184] (-1297.180) (-1295.655) -- 0:00:31
535000 -- (-1292.327) [-1291.537] (-1292.183) (-1292.301) * (-1292.993) [-1291.731] (-1298.209) (-1293.891) -- 0:00:32
Average standard deviation of split frequencies: 0.011537
535500 -- [-1291.893] (-1295.023) (-1293.185) (-1292.952) * (-1293.455) (-1291.746) (-1296.020) [-1295.085] -- 0:00:32
536000 -- (-1292.812) (-1293.904) (-1292.823) [-1298.087] * (-1292.408) [-1291.608] (-1294.689) (-1295.727) -- 0:00:32
536500 -- (-1293.998) (-1293.176) (-1292.900) [-1292.252] * [-1292.211] (-1293.553) (-1292.054) (-1294.766) -- 0:00:31
537000 -- (-1294.555) (-1295.643) [-1292.900] (-1292.601) * (-1292.841) [-1292.690] (-1293.537) (-1294.409) -- 0:00:31
537500 -- (-1292.083) [-1297.763] (-1293.731) (-1293.906) * [-1292.832] (-1295.316) (-1293.795) (-1292.991) -- 0:00:31
538000 -- [-1292.885] (-1296.279) (-1292.834) (-1295.118) * [-1291.953] (-1294.041) (-1291.713) (-1292.278) -- 0:00:31
538500 -- (-1300.254) (-1292.739) [-1294.846] (-1292.690) * [-1291.778] (-1294.183) (-1293.057) (-1292.463) -- 0:00:31
539000 -- (-1295.131) (-1298.930) (-1292.892) [-1291.356] * (-1292.835) (-1292.636) (-1296.524) [-1291.949] -- 0:00:31
539500 -- [-1292.712] (-1293.515) (-1295.390) (-1292.652) * [-1293.750] (-1292.020) (-1291.743) (-1292.257) -- 0:00:31
540000 -- (-1293.524) (-1291.123) [-1293.804] (-1293.247) * (-1294.374) (-1293.180) [-1292.245] (-1292.344) -- 0:00:31
Average standard deviation of split frequencies: 0.010924
540500 -- (-1294.581) [-1291.469] (-1294.796) (-1292.046) * (-1292.582) (-1293.052) [-1291.684] (-1292.087) -- 0:00:31
541000 -- (-1295.580) (-1291.238) (-1292.352) [-1293.009] * (-1297.337) (-1296.598) (-1291.697) [-1292.827] -- 0:00:31
541500 -- [-1295.747] (-1293.435) (-1294.866) (-1294.633) * (-1296.518) (-1293.587) (-1295.358) [-1292.261] -- 0:00:31
542000 -- (-1293.693) (-1294.238) [-1293.502] (-1294.085) * (-1294.307) [-1294.143] (-1298.324) (-1291.267) -- 0:00:31
542500 -- (-1296.770) (-1296.046) [-1293.453] (-1295.021) * (-1292.559) (-1293.003) [-1292.951] (-1296.572) -- 0:00:31
543000 -- (-1300.488) (-1294.151) [-1294.051] (-1297.870) * (-1300.574) [-1294.330] (-1294.870) (-1293.647) -- 0:00:31
543500 -- (-1293.285) (-1293.747) (-1291.371) [-1292.459] * [-1291.772] (-1293.082) (-1293.725) (-1294.185) -- 0:00:31
544000 -- (-1293.416) [-1292.802] (-1291.254) (-1293.664) * (-1292.891) (-1293.046) [-1293.981] (-1295.305) -- 0:00:31
544500 -- [-1294.620] (-1295.252) (-1295.995) (-1293.200) * [-1291.861] (-1294.686) (-1291.676) (-1292.465) -- 0:00:30
545000 -- (-1294.188) (-1292.241) (-1292.233) [-1293.452] * [-1294.654] (-1293.513) (-1300.065) (-1292.825) -- 0:00:30
Average standard deviation of split frequencies: 0.011173
545500 -- [-1291.744] (-1292.265) (-1295.757) (-1292.359) * (-1298.451) (-1298.855) (-1295.641) [-1294.122] -- 0:00:30
546000 -- (-1291.727) (-1293.598) [-1292.009] (-1292.286) * [-1294.051] (-1293.163) (-1294.599) (-1296.465) -- 0:00:30
546500 -- (-1293.468) (-1291.758) [-1292.629] (-1292.999) * (-1291.800) (-1293.969) (-1294.578) [-1292.742] -- 0:00:30
547000 -- (-1293.183) (-1294.427) [-1293.501] (-1293.154) * (-1292.942) (-1293.855) (-1293.567) [-1291.983] -- 0:00:30
547500 -- (-1296.977) (-1297.815) (-1294.315) [-1292.400] * (-1293.181) (-1294.537) (-1292.353) [-1293.284] -- 0:00:30
548000 -- (-1295.466) (-1292.570) (-1296.664) [-1293.679] * (-1293.420) (-1295.772) (-1293.832) [-1295.040] -- 0:00:30
548500 -- (-1293.145) [-1291.582] (-1296.870) (-1292.468) * (-1294.737) (-1293.829) (-1292.793) [-1294.243] -- 0:00:30
549000 -- (-1296.925) (-1296.358) (-1298.402) [-1292.425] * (-1294.888) (-1295.739) (-1293.776) [-1291.340] -- 0:00:30
549500 -- (-1295.580) [-1294.129] (-1301.653) (-1292.103) * (-1293.415) (-1294.051) [-1295.056] (-1292.554) -- 0:00:30
550000 -- (-1293.509) (-1293.143) [-1295.346] (-1293.325) * [-1292.772] (-1292.067) (-1293.801) (-1297.744) -- 0:00:31
Average standard deviation of split frequencies: 0.010525
550500 -- (-1295.141) (-1295.818) [-1294.325] (-1292.916) * (-1293.179) [-1292.702] (-1293.868) (-1293.865) -- 0:00:31
551000 -- (-1291.735) (-1293.662) (-1294.141) [-1291.920] * (-1291.799) (-1292.187) [-1295.057] (-1291.746) -- 0:00:30
551500 -- (-1291.737) (-1296.161) (-1296.962) [-1292.626] * (-1293.290) (-1293.382) [-1292.395] (-1291.890) -- 0:00:30
552000 -- (-1291.641) [-1296.593] (-1295.228) (-1293.451) * (-1292.988) (-1296.751) (-1292.417) [-1291.775] -- 0:00:30
552500 -- (-1293.636) [-1292.630] (-1291.866) (-1293.047) * [-1293.002] (-1298.088) (-1295.008) (-1293.689) -- 0:00:30
553000 -- [-1295.231] (-1294.001) (-1291.434) (-1293.487) * (-1293.920) (-1291.812) [-1292.999] (-1292.074) -- 0:00:30
553500 -- (-1292.259) (-1293.878) [-1291.430] (-1293.875) * (-1292.329) (-1293.988) [-1295.564] (-1292.838) -- 0:00:30
554000 -- [-1294.849] (-1294.252) (-1293.042) (-1296.272) * (-1292.289) (-1291.391) (-1292.975) [-1294.451] -- 0:00:30
554500 -- (-1295.348) (-1292.142) [-1296.661] (-1291.466) * (-1295.367) (-1291.686) [-1295.180] (-1292.087) -- 0:00:30
555000 -- (-1293.205) (-1293.975) (-1292.884) [-1293.355] * (-1292.243) (-1292.162) (-1293.409) [-1291.982] -- 0:00:30
Average standard deviation of split frequencies: 0.010573
555500 -- (-1292.994) (-1297.988) (-1297.153) [-1293.113] * [-1294.017] (-1292.856) (-1293.997) (-1293.469) -- 0:00:30
556000 -- (-1298.803) (-1297.979) (-1294.522) [-1294.174] * [-1294.967] (-1292.961) (-1292.567) (-1295.992) -- 0:00:30
556500 -- [-1293.398] (-1294.352) (-1298.639) (-1297.649) * [-1298.578] (-1293.937) (-1293.685) (-1295.940) -- 0:00:30
557000 -- (-1293.825) (-1295.721) (-1295.371) [-1295.058] * (-1294.999) [-1296.436] (-1299.432) (-1291.410) -- 0:00:30
557500 -- (-1296.815) (-1296.580) [-1294.543] (-1292.764) * (-1296.951) [-1295.867] (-1295.165) (-1292.238) -- 0:00:30
558000 -- [-1291.941] (-1297.947) (-1298.223) (-1292.338) * (-1296.596) [-1291.651] (-1293.776) (-1295.100) -- 0:00:30
558500 -- (-1291.531) (-1293.040) (-1298.660) [-1293.359] * (-1294.104) (-1296.879) (-1292.452) [-1294.428] -- 0:00:30
559000 -- (-1292.702) (-1294.075) [-1295.214] (-1292.929) * (-1293.197) [-1291.967] (-1292.672) (-1292.825) -- 0:00:29
559500 -- (-1293.406) [-1293.599] (-1293.624) (-1291.635) * (-1292.512) [-1293.710] (-1296.925) (-1291.641) -- 0:00:29
560000 -- (-1296.004) (-1294.519) [-1293.322] (-1291.796) * [-1296.167] (-1295.311) (-1293.071) (-1292.570) -- 0:00:29
Average standard deviation of split frequencies: 0.010386
560500 -- (-1298.288) (-1292.861) [-1292.760] (-1293.090) * (-1293.290) (-1294.944) (-1294.639) [-1294.469] -- 0:00:29
561000 -- [-1293.105] (-1293.173) (-1292.645) (-1292.279) * [-1293.518] (-1293.441) (-1292.396) (-1293.491) -- 0:00:29
561500 -- (-1293.683) [-1297.407] (-1291.775) (-1297.110) * [-1295.000] (-1293.741) (-1292.909) (-1292.433) -- 0:00:29
562000 -- (-1293.926) (-1293.091) [-1291.256] (-1294.030) * (-1291.933) (-1293.329) [-1291.890] (-1292.244) -- 0:00:29
562500 -- (-1292.403) (-1291.650) (-1292.008) [-1293.571] * (-1291.525) (-1293.925) (-1291.928) [-1292.260] -- 0:00:29
563000 -- (-1295.926) [-1293.263] (-1295.000) (-1293.987) * [-1294.708] (-1293.732) (-1293.925) (-1292.856) -- 0:00:29
563500 -- [-1292.405] (-1294.525) (-1291.707) (-1292.574) * [-1295.888] (-1294.064) (-1295.158) (-1293.857) -- 0:00:30
564000 -- (-1292.929) [-1292.351] (-1292.519) (-1294.192) * (-1294.546) (-1294.092) (-1295.262) [-1295.517] -- 0:00:30
564500 -- (-1292.754) (-1292.410) [-1293.753] (-1292.591) * (-1294.784) (-1293.633) (-1296.246) [-1293.499] -- 0:00:30
565000 -- [-1292.167] (-1292.633) (-1293.900) (-1293.134) * (-1298.439) [-1291.890] (-1293.514) (-1292.616) -- 0:00:30
Average standard deviation of split frequencies: 0.010239
565500 -- (-1291.536) (-1295.780) (-1293.811) [-1294.865] * (-1292.394) [-1293.550] (-1291.994) (-1296.020) -- 0:00:29
566000 -- (-1292.398) (-1294.672) [-1295.094] (-1294.679) * (-1291.922) (-1297.625) [-1293.585] (-1292.000) -- 0:00:29
566500 -- [-1291.996] (-1294.677) (-1299.180) (-1294.342) * [-1293.148] (-1292.165) (-1292.496) (-1292.539) -- 0:00:29
567000 -- (-1292.116) (-1293.480) (-1298.143) [-1292.110] * (-1305.100) (-1293.256) [-1292.232] (-1293.404) -- 0:00:29
567500 -- [-1291.463] (-1292.830) (-1291.555) (-1293.954) * (-1300.707) (-1293.257) [-1292.840] (-1293.580) -- 0:00:29
568000 -- (-1298.784) [-1291.934] (-1291.908) (-1292.948) * (-1296.567) (-1296.838) [-1296.351] (-1292.666) -- 0:00:29
568500 -- (-1299.485) [-1295.796] (-1291.915) (-1291.911) * (-1298.066) (-1292.409) (-1295.004) [-1292.438] -- 0:00:29
569000 -- (-1297.830) (-1297.295) [-1293.511] (-1293.938) * (-1296.775) (-1291.780) (-1293.228) [-1293.268] -- 0:00:29
569500 -- (-1292.596) (-1292.186) [-1294.708] (-1292.348) * (-1294.271) [-1294.249] (-1293.159) (-1292.275) -- 0:00:29
570000 -- (-1296.125) (-1298.516) [-1293.366] (-1292.301) * [-1294.920] (-1292.070) (-1294.107) (-1294.401) -- 0:00:29
Average standard deviation of split frequencies: 0.010642
570500 -- (-1294.571) (-1294.525) [-1292.537] (-1296.407) * (-1293.187) (-1292.823) [-1293.818] (-1297.576) -- 0:00:29
571000 -- (-1293.793) (-1292.957) (-1293.900) [-1297.661] * (-1298.648) (-1293.743) (-1292.404) [-1293.341] -- 0:00:29
571500 -- [-1292.001] (-1292.265) (-1294.187) (-1301.767) * [-1296.621] (-1294.791) (-1292.728) (-1292.821) -- 0:00:29
572000 -- (-1294.459) (-1294.864) [-1293.961] (-1299.353) * (-1292.539) (-1294.392) [-1292.618] (-1294.813) -- 0:00:29
572500 -- [-1295.301] (-1295.069) (-1293.792) (-1292.416) * (-1294.935) (-1298.445) [-1291.864] (-1292.059) -- 0:00:29
573000 -- (-1294.035) (-1293.871) (-1293.651) [-1293.702] * (-1296.308) [-1295.924] (-1294.312) (-1294.986) -- 0:00:29
573500 -- (-1294.037) (-1292.410) (-1291.500) [-1293.949] * [-1292.352] (-1297.183) (-1292.658) (-1295.461) -- 0:00:29
574000 -- (-1296.241) [-1294.249] (-1292.163) (-1292.241) * (-1293.247) (-1295.020) [-1294.769] (-1294.082) -- 0:00:28
574500 -- [-1293.767] (-1293.279) (-1297.392) (-1294.340) * [-1293.247] (-1294.936) (-1292.180) (-1294.931) -- 0:00:28
575000 -- (-1294.915) (-1291.612) [-1292.886] (-1294.133) * (-1293.950) (-1292.496) (-1292.582) [-1292.344] -- 0:00:28
Average standard deviation of split frequencies: 0.010281
575500 -- (-1292.594) (-1291.988) [-1293.097] (-1292.301) * (-1292.783) (-1292.898) [-1293.249] (-1292.052) -- 0:00:28
576000 -- (-1294.935) [-1291.535] (-1296.053) (-1296.466) * [-1291.768] (-1297.082) (-1294.621) (-1295.786) -- 0:00:28
576500 -- (-1292.127) (-1294.643) (-1295.425) [-1292.777] * [-1295.739] (-1302.220) (-1295.574) (-1297.475) -- 0:00:28
577000 -- (-1291.592) (-1291.616) (-1292.878) [-1293.466] * (-1295.220) (-1294.370) [-1295.935] (-1293.473) -- 0:00:28
577500 -- (-1291.455) (-1293.387) [-1293.252] (-1292.576) * [-1294.166] (-1296.339) (-1295.238) (-1293.050) -- 0:00:28
578000 -- (-1293.986) [-1295.192] (-1292.018) (-1292.113) * (-1295.323) [-1292.262] (-1292.813) (-1293.901) -- 0:00:29
578500 -- [-1295.174] (-1293.881) (-1292.543) (-1292.159) * (-1294.241) [-1295.484] (-1292.555) (-1292.154) -- 0:00:29
579000 -- (-1293.258) (-1298.083) [-1292.486] (-1292.193) * (-1296.561) (-1293.648) [-1293.869] (-1292.544) -- 0:00:29
579500 -- [-1293.167] (-1292.187) (-1294.849) (-1293.160) * (-1293.387) [-1292.346] (-1293.704) (-1295.995) -- 0:00:29
580000 -- (-1291.729) [-1294.020] (-1292.236) (-1292.503) * (-1292.892) (-1294.197) (-1293.261) [-1293.113] -- 0:00:28
Average standard deviation of split frequencies: 0.009996
580500 -- (-1295.947) [-1293.838] (-1291.646) (-1294.581) * [-1293.669] (-1294.196) (-1292.400) (-1295.686) -- 0:00:28
581000 -- (-1296.958) [-1293.481] (-1293.253) (-1295.265) * (-1299.096) (-1293.069) [-1293.781] (-1293.187) -- 0:00:28
581500 -- (-1297.413) (-1292.692) (-1293.352) [-1293.537] * (-1292.356) (-1294.517) [-1293.353] (-1296.326) -- 0:00:28
582000 -- (-1292.403) (-1294.704) [-1294.427] (-1291.792) * [-1293.320] (-1293.748) (-1292.224) (-1299.808) -- 0:00:28
582500 -- (-1292.194) [-1292.689] (-1293.984) (-1297.601) * (-1294.225) (-1297.534) (-1293.344) [-1298.373] -- 0:00:28
583000 -- [-1295.062] (-1294.644) (-1293.710) (-1296.562) * (-1294.698) [-1295.623] (-1294.289) (-1291.792) -- 0:00:28
583500 -- [-1293.883] (-1301.977) (-1293.810) (-1296.878) * [-1292.838] (-1294.062) (-1293.985) (-1293.106) -- 0:00:28
584000 -- [-1292.392] (-1293.043) (-1293.656) (-1292.957) * [-1293.435] (-1294.943) (-1294.709) (-1297.433) -- 0:00:28
584500 -- (-1294.473) (-1293.408) (-1293.100) [-1293.140] * [-1292.010] (-1293.821) (-1291.967) (-1300.166) -- 0:00:28
585000 -- (-1295.511) (-1294.706) [-1295.473] (-1292.908) * (-1292.758) (-1293.610) (-1291.875) [-1295.121] -- 0:00:28
Average standard deviation of split frequencies: 0.010810
585500 -- (-1294.368) (-1292.975) (-1293.039) [-1291.809] * (-1292.765) (-1293.673) [-1291.615] (-1293.012) -- 0:00:28
586000 -- (-1294.412) [-1291.452] (-1292.393) (-1291.860) * [-1293.756] (-1292.915) (-1291.801) (-1293.012) -- 0:00:28
586500 -- (-1294.549) (-1294.709) [-1297.393] (-1296.169) * (-1291.712) [-1293.214] (-1294.664) (-1294.284) -- 0:00:28
587000 -- (-1294.559) (-1294.711) (-1292.179) [-1294.853] * (-1292.665) [-1292.655] (-1296.189) (-1291.633) -- 0:00:28
587500 -- (-1292.020) [-1292.186] (-1296.275) (-1294.462) * (-1293.025) (-1292.182) [-1294.153] (-1294.947) -- 0:00:28
588000 -- (-1292.062) (-1297.043) (-1295.260) [-1295.555] * (-1291.991) [-1292.000] (-1293.865) (-1293.471) -- 0:00:28
588500 -- (-1291.805) [-1292.489] (-1292.693) (-1294.489) * (-1293.423) [-1294.021] (-1297.491) (-1292.295) -- 0:00:27
589000 -- (-1293.132) (-1293.119) (-1292.826) [-1293.267] * [-1292.161] (-1292.379) (-1292.920) (-1294.715) -- 0:00:27
589500 -- (-1294.963) (-1294.605) [-1296.535] (-1294.731) * [-1294.609] (-1293.987) (-1291.605) (-1294.996) -- 0:00:27
590000 -- (-1295.712) (-1293.303) [-1291.880] (-1292.896) * (-1294.778) (-1292.091) (-1291.258) [-1291.535] -- 0:00:27
Average standard deviation of split frequencies: 0.010874
590500 -- [-1294.481] (-1291.523) (-1291.515) (-1292.964) * [-1294.724] (-1296.548) (-1292.089) (-1292.578) -- 0:00:27
591000 -- (-1292.527) (-1291.681) [-1295.404] (-1292.244) * (-1295.508) (-1293.464) (-1296.372) [-1293.005] -- 0:00:27
591500 -- [-1292.053] (-1297.253) (-1294.009) (-1291.890) * [-1294.161] (-1291.983) (-1294.107) (-1294.457) -- 0:00:27
592000 -- (-1293.703) [-1293.837] (-1296.844) (-1297.285) * [-1292.540] (-1293.426) (-1293.911) (-1293.675) -- 0:00:27
592500 -- (-1293.385) [-1295.052] (-1296.241) (-1293.361) * (-1292.557) (-1292.928) (-1295.584) [-1293.244] -- 0:00:27
593000 -- [-1291.721] (-1291.806) (-1296.077) (-1295.161) * [-1294.516] (-1292.152) (-1292.108) (-1293.117) -- 0:00:28
593500 -- (-1293.073) [-1295.148] (-1292.962) (-1292.434) * (-1294.267) (-1292.469) [-1294.059] (-1292.053) -- 0:00:28
594000 -- [-1294.180] (-1294.149) (-1295.028) (-1294.796) * (-1295.247) (-1295.570) (-1294.176) [-1291.938] -- 0:00:28
594500 -- [-1293.247] (-1297.761) (-1295.028) (-1292.853) * (-1295.217) [-1291.746] (-1293.853) (-1295.534) -- 0:00:27
595000 -- (-1292.199) (-1294.510) [-1292.877] (-1294.203) * [-1296.093] (-1293.117) (-1294.465) (-1294.725) -- 0:00:27
Average standard deviation of split frequencies: 0.010431
595500 -- (-1292.193) (-1293.578) (-1292.345) [-1293.365] * (-1295.194) (-1292.851) [-1293.905] (-1294.300) -- 0:00:27
596000 -- (-1292.198) (-1295.751) [-1293.853] (-1292.727) * (-1291.799) (-1300.813) (-1292.137) [-1293.070] -- 0:00:27
596500 -- (-1292.252) [-1293.090] (-1294.755) (-1293.933) * [-1291.308] (-1299.726) (-1295.233) (-1296.023) -- 0:00:27
597000 -- (-1298.054) [-1293.727] (-1294.009) (-1299.610) * [-1294.243] (-1296.442) (-1296.517) (-1292.286) -- 0:00:27
597500 -- (-1299.535) (-1294.965) [-1295.016] (-1293.602) * (-1291.718) (-1294.208) [-1295.779] (-1296.240) -- 0:00:27
598000 -- [-1294.089] (-1294.297) (-1293.539) (-1294.557) * (-1291.886) (-1296.439) [-1294.277] (-1293.505) -- 0:00:27
598500 -- (-1295.867) (-1293.235) (-1292.845) [-1293.617] * (-1292.462) (-1297.512) [-1296.444] (-1295.993) -- 0:00:27
599000 -- (-1293.992) (-1292.087) [-1296.322] (-1294.516) * [-1296.246] (-1294.827) (-1296.141) (-1292.295) -- 0:00:27
599500 -- [-1292.114] (-1293.897) (-1291.572) (-1294.081) * [-1294.956] (-1296.885) (-1293.522) (-1292.700) -- 0:00:27
600000 -- (-1291.662) [-1295.895] (-1293.174) (-1293.749) * [-1293.352] (-1298.862) (-1294.953) (-1293.248) -- 0:00:27
Average standard deviation of split frequencies: 0.010301
600500 -- [-1293.150] (-1296.661) (-1292.973) (-1291.502) * (-1292.724) [-1296.053] (-1294.051) (-1293.989) -- 0:00:27
601000 -- (-1296.321) (-1293.279) [-1292.931] (-1294.508) * (-1293.392) (-1292.993) [-1291.198] (-1293.272) -- 0:00:27
601500 -- (-1293.597) (-1293.563) [-1298.207] (-1291.528) * (-1292.310) (-1293.093) [-1299.025] (-1295.634) -- 0:00:27
602000 -- (-1292.173) (-1291.725) (-1293.547) [-1292.212] * (-1293.502) (-1292.774) (-1299.589) [-1293.236] -- 0:00:27
602500 -- (-1292.692) (-1293.200) (-1292.030) [-1294.555] * (-1292.436) [-1292.669] (-1292.080) (-1294.313) -- 0:00:27
603000 -- [-1291.694] (-1296.886) (-1292.527) (-1294.263) * (-1293.577) [-1291.810] (-1296.367) (-1294.069) -- 0:00:26
603500 -- [-1292.058] (-1295.129) (-1293.539) (-1293.286) * (-1292.327) (-1293.847) [-1296.513] (-1291.669) -- 0:00:26
604000 -- (-1296.259) [-1294.053] (-1294.589) (-1292.278) * (-1292.031) [-1297.383] (-1295.333) (-1292.270) -- 0:00:26
604500 -- (-1292.580) (-1296.289) (-1292.370) [-1292.129] * (-1292.960) (-1293.458) [-1297.915] (-1292.202) -- 0:00:26
605000 -- (-1295.854) (-1297.335) [-1298.000] (-1294.473) * (-1292.873) [-1295.990] (-1298.750) (-1293.421) -- 0:00:26
Average standard deviation of split frequencies: 0.010799
605500 -- (-1301.353) [-1298.916] (-1294.717) (-1295.939) * (-1293.552) (-1294.810) [-1293.576] (-1291.765) -- 0:00:26
606000 -- (-1308.674) (-1295.499) (-1294.562) [-1292.553] * (-1292.629) (-1293.710) [-1294.041] (-1296.621) -- 0:00:26
606500 -- (-1296.734) [-1294.704] (-1297.157) (-1291.890) * (-1292.342) (-1291.893) (-1295.468) [-1293.355] -- 0:00:27
607000 -- (-1293.209) (-1300.916) [-1292.729] (-1292.115) * [-1293.691] (-1300.714) (-1297.444) (-1296.444) -- 0:00:27
607500 -- (-1294.189) (-1299.385) [-1293.725] (-1291.563) * (-1293.266) (-1293.816) (-1297.435) [-1292.391] -- 0:00:27
608000 -- [-1296.114] (-1293.071) (-1293.563) (-1292.272) * [-1294.229] (-1295.336) (-1296.487) (-1295.320) -- 0:00:27
608500 -- (-1293.575) (-1293.392) [-1291.664] (-1292.356) * [-1296.242] (-1294.686) (-1292.332) (-1295.171) -- 0:00:27
609000 -- [-1294.014] (-1292.352) (-1292.274) (-1293.844) * (-1294.147) (-1292.871) [-1292.749] (-1294.092) -- 0:00:26
609500 -- [-1296.788] (-1294.354) (-1292.863) (-1293.941) * (-1294.142) (-1291.967) [-1292.543] (-1293.893) -- 0:00:26
610000 -- (-1293.176) [-1291.833] (-1292.869) (-1293.089) * [-1294.782] (-1294.326) (-1292.481) (-1293.898) -- 0:00:26
Average standard deviation of split frequencies: 0.010293
610500 -- (-1294.883) [-1292.074] (-1292.609) (-1297.342) * (-1297.241) (-1292.030) [-1294.239] (-1296.148) -- 0:00:26
611000 -- [-1294.067] (-1300.583) (-1293.144) (-1293.539) * [-1296.092] (-1293.879) (-1298.125) (-1297.251) -- 0:00:26
611500 -- (-1294.813) (-1294.698) (-1292.097) [-1292.073] * (-1293.231) (-1294.732) (-1295.029) [-1293.401] -- 0:00:26
612000 -- (-1292.559) (-1293.846) (-1291.310) [-1293.695] * [-1293.711] (-1295.780) (-1295.485) (-1292.403) -- 0:00:26
612500 -- (-1291.832) (-1292.253) (-1291.309) [-1293.709] * [-1292.196] (-1294.287) (-1292.202) (-1294.321) -- 0:00:26
613000 -- (-1291.146) (-1293.198) [-1292.381] (-1292.054) * (-1293.817) (-1296.049) (-1295.734) [-1300.443] -- 0:00:26
613500 -- (-1296.400) (-1293.167) [-1291.788] (-1292.529) * [-1295.868] (-1292.503) (-1297.690) (-1297.547) -- 0:00:26
614000 -- (-1295.232) (-1292.708) [-1293.014] (-1293.113) * (-1295.909) (-1297.009) [-1294.244] (-1293.188) -- 0:00:26
614500 -- (-1293.440) [-1292.838] (-1293.265) (-1294.522) * (-1292.528) [-1295.979] (-1292.692) (-1293.369) -- 0:00:26
615000 -- (-1294.973) [-1294.141] (-1296.844) (-1295.055) * (-1293.320) (-1291.880) [-1291.619] (-1295.551) -- 0:00:26
Average standard deviation of split frequencies: 0.010084
615500 -- (-1300.146) [-1292.690] (-1294.856) (-1293.367) * [-1291.396] (-1292.338) (-1291.558) (-1293.626) -- 0:00:26
616000 -- (-1291.302) (-1294.489) (-1293.764) [-1293.126] * (-1291.198) (-1291.972) [-1291.652] (-1292.406) -- 0:00:26
616500 -- (-1291.291) (-1294.796) [-1297.201] (-1294.267) * (-1292.046) [-1293.473] (-1291.700) (-1292.977) -- 0:00:26
617000 -- (-1295.946) [-1292.911] (-1293.193) (-1294.514) * (-1292.809) (-1293.473) (-1294.129) [-1293.146] -- 0:00:26
617500 -- (-1293.044) (-1292.451) (-1292.725) [-1292.089] * (-1293.984) (-1292.694) (-1297.282) [-1294.287] -- 0:00:26
618000 -- (-1293.775) (-1292.873) (-1292.833) [-1292.946] * (-1292.311) [-1292.711] (-1295.008) (-1293.471) -- 0:00:25
618500 -- (-1294.228) (-1291.818) (-1294.146) [-1292.016] * (-1295.888) [-1293.964] (-1293.603) (-1291.326) -- 0:00:25
619000 -- (-1293.399) (-1293.651) (-1293.073) [-1292.266] * (-1295.119) [-1295.228] (-1291.824) (-1291.955) -- 0:00:25
619500 -- (-1292.935) [-1293.046] (-1300.304) (-1292.713) * (-1292.321) (-1292.757) (-1292.970) [-1291.635] -- 0:00:25
620000 -- [-1292.399] (-1298.314) (-1294.647) (-1293.353) * (-1293.790) [-1293.357] (-1293.597) (-1292.535) -- 0:00:25
Average standard deviation of split frequencies: 0.010589
620500 -- [-1294.636] (-1295.391) (-1293.716) (-1292.869) * (-1293.773) (-1292.038) [-1297.516] (-1292.418) -- 0:00:25
621000 -- (-1294.265) (-1293.435) (-1294.731) [-1294.716] * (-1293.141) [-1293.240] (-1293.421) (-1294.095) -- 0:00:26
621500 -- [-1293.531] (-1294.395) (-1293.097) (-1294.672) * (-1292.645) (-1292.863) [-1292.763] (-1292.374) -- 0:00:26
622000 -- (-1294.542) (-1293.322) [-1292.337] (-1293.008) * (-1293.330) [-1292.934] (-1293.458) (-1292.972) -- 0:00:26
622500 -- (-1294.249) (-1297.361) [-1291.713] (-1297.942) * (-1294.807) [-1293.719] (-1294.475) (-1291.515) -- 0:00:26
623000 -- (-1293.061) (-1294.226) [-1293.301] (-1294.005) * (-1293.838) (-1296.400) (-1295.673) [-1293.016] -- 0:00:26
623500 -- (-1293.740) (-1292.858) (-1293.996) [-1292.544] * (-1294.179) (-1299.528) (-1293.019) [-1294.711] -- 0:00:25
624000 -- [-1291.393] (-1293.546) (-1299.869) (-1292.505) * (-1292.322) (-1294.263) [-1291.702] (-1292.620) -- 0:00:25
624500 -- [-1292.038] (-1293.525) (-1294.523) (-1292.270) * (-1294.737) (-1293.634) (-1293.021) [-1292.459] -- 0:00:25
625000 -- (-1292.914) [-1294.042] (-1299.815) (-1293.045) * (-1295.761) (-1296.071) [-1291.768] (-1291.510) -- 0:00:25
Average standard deviation of split frequencies: 0.010877
625500 -- [-1294.992] (-1294.064) (-1297.465) (-1293.208) * (-1293.780) (-1294.466) (-1293.031) [-1292.582] -- 0:00:25
626000 -- (-1292.458) [-1292.775] (-1295.022) (-1299.822) * (-1292.938) (-1292.893) (-1293.415) [-1293.151] -- 0:00:25
626500 -- (-1295.468) (-1294.192) (-1294.365) [-1294.302] * (-1292.925) (-1291.495) (-1294.348) [-1293.093] -- 0:00:25
627000 -- (-1292.023) (-1294.406) [-1293.622] (-1293.503) * (-1293.054) (-1298.459) (-1296.715) [-1294.020] -- 0:00:25
627500 -- (-1292.887) [-1291.757] (-1292.823) (-1293.307) * (-1295.889) (-1297.287) (-1297.062) [-1292.155] -- 0:00:25
628000 -- (-1292.465) (-1292.448) [-1292.811] (-1294.294) * (-1297.314) (-1294.176) (-1298.674) [-1292.959] -- 0:00:25
628500 -- [-1293.833] (-1292.448) (-1292.245) (-1293.032) * [-1293.459] (-1294.084) (-1293.249) (-1292.805) -- 0:00:25
629000 -- [-1292.138] (-1293.047) (-1293.239) (-1295.010) * [-1291.693] (-1295.554) (-1295.197) (-1293.073) -- 0:00:25
629500 -- (-1292.286) (-1294.095) (-1297.837) [-1292.449] * (-1295.440) [-1291.684] (-1291.898) (-1296.300) -- 0:00:25
630000 -- [-1292.171] (-1292.135) (-1295.195) (-1292.927) * (-1293.478) [-1291.978] (-1292.510) (-1291.611) -- 0:00:25
Average standard deviation of split frequencies: 0.011124
630500 -- (-1293.345) [-1291.769] (-1295.081) (-1295.098) * (-1293.763) (-1291.706) (-1292.982) [-1291.297] -- 0:00:25
631000 -- [-1294.198] (-1298.618) (-1294.244) (-1293.061) * (-1292.552) (-1293.476) (-1293.131) [-1292.134] -- 0:00:25
631500 -- (-1293.887) [-1295.199] (-1291.444) (-1294.345) * (-1300.260) (-1293.348) (-1293.542) [-1292.419] -- 0:00:25
632000 -- (-1292.886) (-1293.988) [-1297.920] (-1292.290) * (-1297.821) [-1292.743] (-1298.458) (-1294.290) -- 0:00:25
632500 -- (-1292.736) (-1293.673) [-1296.984] (-1292.270) * (-1295.832) (-1298.622) (-1294.233) [-1294.327] -- 0:00:24
633000 -- (-1295.295) (-1291.262) (-1292.807) [-1291.290] * (-1299.218) (-1304.247) [-1295.296] (-1293.541) -- 0:00:24
633500 -- (-1299.497) [-1291.382] (-1293.696) (-1292.962) * (-1293.198) (-1292.887) [-1295.303] (-1293.200) -- 0:00:24
634000 -- (-1292.846) (-1291.769) (-1294.439) [-1292.626] * (-1294.720) [-1294.736] (-1295.692) (-1294.360) -- 0:00:24
634500 -- (-1296.468) (-1291.735) (-1298.450) [-1292.692] * (-1294.647) [-1293.906] (-1297.080) (-1297.569) -- 0:00:24
635000 -- [-1292.195] (-1292.017) (-1297.114) (-1291.860) * (-1295.874) (-1296.971) (-1291.714) [-1292.495] -- 0:00:24
Average standard deviation of split frequencies: 0.011641
635500 -- (-1293.015) [-1295.984] (-1293.194) (-1291.901) * (-1292.784) (-1295.295) [-1292.547] (-1294.227) -- 0:00:25
636000 -- (-1293.316) (-1298.578) (-1297.225) [-1293.696] * (-1292.237) (-1293.632) (-1293.668) [-1294.429] -- 0:00:25
636500 -- [-1292.636] (-1301.023) (-1292.851) (-1293.472) * (-1292.829) (-1292.230) [-1292.796] (-1292.159) -- 0:00:25
637000 -- (-1295.270) (-1293.125) (-1292.077) [-1294.032] * (-1296.427) [-1295.741] (-1292.032) (-1293.953) -- 0:00:25
637500 -- (-1291.769) (-1292.168) [-1291.899] (-1294.623) * (-1293.126) (-1293.859) (-1294.539) [-1293.415] -- 0:00:25
638000 -- (-1291.902) (-1292.074) (-1292.388) [-1296.872] * (-1296.008) [-1293.070] (-1293.268) (-1293.156) -- 0:00:24
638500 -- (-1294.522) (-1296.563) (-1296.438) [-1297.682] * (-1292.481) (-1293.327) (-1293.198) [-1294.266] -- 0:00:24
639000 -- [-1295.110] (-1293.102) (-1294.915) (-1299.839) * (-1292.359) (-1294.568) (-1295.077) [-1292.599] -- 0:00:24
639500 -- [-1293.097] (-1295.530) (-1293.651) (-1294.527) * (-1294.420) [-1297.688] (-1293.040) (-1292.392) -- 0:00:24
640000 -- [-1293.600] (-1292.492) (-1293.300) (-1292.622) * (-1294.095) (-1293.308) [-1296.676] (-1294.385) -- 0:00:24
Average standard deviation of split frequencies: 0.011903
640500 -- (-1293.767) (-1293.234) [-1292.898] (-1300.132) * (-1293.125) (-1292.783) [-1292.728] (-1293.074) -- 0:00:24
641000 -- (-1293.717) (-1293.439) (-1292.377) [-1292.530] * (-1292.635) (-1294.050) (-1292.700) [-1291.626] -- 0:00:24
641500 -- [-1292.622] (-1297.433) (-1294.393) (-1292.175) * (-1291.994) (-1293.837) [-1294.653] (-1292.340) -- 0:00:24
642000 -- [-1298.195] (-1295.619) (-1292.346) (-1292.052) * (-1297.587) (-1293.784) (-1293.287) [-1292.381] -- 0:00:24
642500 -- [-1296.962] (-1294.593) (-1293.097) (-1291.880) * (-1292.927) [-1293.593] (-1294.082) (-1293.690) -- 0:00:24
643000 -- (-1294.938) [-1294.015] (-1296.253) (-1293.686) * (-1294.332) (-1299.318) [-1292.128] (-1295.493) -- 0:00:24
643500 -- [-1292.942] (-1294.733) (-1292.072) (-1293.906) * (-1293.879) (-1294.789) (-1291.793) [-1293.660] -- 0:00:24
644000 -- (-1294.010) [-1294.710] (-1292.996) (-1293.349) * (-1293.942) (-1294.754) [-1291.924] (-1295.946) -- 0:00:24
644500 -- [-1292.813] (-1294.235) (-1296.065) (-1294.913) * (-1294.279) (-1294.604) [-1292.705] (-1294.382) -- 0:00:24
645000 -- (-1291.477) [-1292.456] (-1293.321) (-1292.648) * (-1292.822) [-1294.332] (-1291.473) (-1292.744) -- 0:00:24
Average standard deviation of split frequencies: 0.011590
645500 -- (-1291.966) (-1294.074) (-1292.884) [-1293.454] * (-1294.802) (-1300.002) (-1295.898) [-1292.423] -- 0:00:24
646000 -- (-1291.936) (-1297.476) (-1292.992) [-1296.409] * (-1295.233) (-1295.808) (-1297.261) [-1294.117] -- 0:00:24
646500 -- (-1293.653) (-1294.324) [-1295.351] (-1297.875) * [-1292.048] (-1297.190) (-1293.717) (-1294.881) -- 0:00:24
647000 -- (-1293.919) (-1295.122) [-1291.566] (-1296.752) * (-1294.200) (-1293.502) (-1294.689) [-1294.323] -- 0:00:24
647500 -- (-1291.879) (-1291.592) [-1292.273] (-1292.964) * (-1296.568) (-1292.069) (-1292.468) [-1293.458] -- 0:00:23
648000 -- (-1291.877) (-1294.224) (-1292.333) [-1291.852] * [-1291.810] (-1292.182) (-1295.990) (-1294.718) -- 0:00:23
648500 -- (-1292.046) [-1292.672] (-1295.781) (-1292.546) * (-1292.452) (-1293.024) [-1292.481] (-1291.569) -- 0:00:23
649000 -- (-1294.732) (-1293.757) (-1294.577) [-1292.246] * [-1292.581] (-1292.749) (-1292.548) (-1292.562) -- 0:00:23
649500 -- (-1294.725) (-1294.025) [-1293.527] (-1291.783) * (-1297.057) (-1294.057) [-1294.591] (-1294.189) -- 0:00:24
650000 -- (-1293.140) (-1291.949) (-1294.389) [-1292.961] * (-1294.550) (-1296.878) (-1293.278) [-1294.077] -- 0:00:24
Average standard deviation of split frequencies: 0.011081
650500 -- [-1293.487] (-1291.391) (-1295.797) (-1294.616) * (-1293.166) (-1295.887) (-1298.334) [-1293.437] -- 0:00:24
651000 -- (-1294.319) (-1291.618) (-1296.330) [-1294.384] * [-1296.743] (-1295.382) (-1295.693) (-1292.180) -- 0:00:24
651500 -- (-1293.248) (-1292.286) (-1295.392) [-1293.293] * [-1292.685] (-1293.579) (-1292.657) (-1293.023) -- 0:00:24
652000 -- (-1291.974) [-1293.612] (-1294.016) (-1294.564) * (-1292.692) (-1296.451) (-1294.377) [-1294.954] -- 0:00:24
652500 -- (-1292.941) [-1293.033] (-1294.223) (-1291.880) * (-1294.670) (-1293.819) (-1292.258) [-1296.553] -- 0:00:23
653000 -- (-1292.424) (-1292.786) (-1294.120) [-1291.324] * (-1293.332) (-1295.620) [-1292.599] (-1291.407) -- 0:00:23
653500 -- (-1297.181) (-1292.386) (-1298.295) [-1292.848] * (-1297.062) (-1295.383) [-1291.880] (-1291.440) -- 0:00:23
654000 -- (-1297.209) (-1292.369) [-1292.990] (-1293.023) * (-1295.321) (-1295.357) [-1297.087] (-1296.971) -- 0:00:23
654500 -- (-1292.537) [-1293.191] (-1292.897) (-1292.398) * (-1294.255) [-1297.177] (-1297.002) (-1293.836) -- 0:00:23
655000 -- (-1292.269) (-1293.373) [-1292.600] (-1295.397) * (-1291.900) (-1294.372) [-1293.048] (-1291.616) -- 0:00:23
Average standard deviation of split frequencies: 0.011033
655500 -- (-1294.227) (-1291.492) [-1292.520] (-1294.159) * (-1292.364) (-1291.621) [-1293.831] (-1294.664) -- 0:00:23
656000 -- [-1291.776] (-1293.837) (-1292.377) (-1296.374) * (-1292.423) (-1292.770) [-1292.550] (-1293.614) -- 0:00:23
656500 -- (-1291.790) (-1293.837) (-1293.512) [-1293.278] * (-1291.851) (-1293.162) [-1293.718] (-1294.789) -- 0:00:23
657000 -- [-1294.119] (-1293.133) (-1291.749) (-1293.832) * [-1292.241] (-1294.755) (-1294.881) (-1291.505) -- 0:00:23
657500 -- [-1293.536] (-1295.022) (-1295.654) (-1291.654) * (-1296.088) (-1291.812) [-1291.897] (-1291.695) -- 0:00:23
658000 -- (-1294.730) (-1295.286) (-1293.706) [-1292.886] * (-1296.190) (-1292.365) (-1292.354) [-1292.238] -- 0:00:23
658500 -- (-1294.122) (-1291.821) (-1298.916) [-1294.166] * (-1294.101) (-1295.049) [-1291.582] (-1292.809) -- 0:00:23
659000 -- (-1294.681) (-1296.759) [-1293.542] (-1293.143) * [-1293.409] (-1292.865) (-1292.742) (-1292.808) -- 0:00:23
659500 -- (-1296.418) (-1292.249) [-1293.085] (-1291.272) * (-1294.201) (-1293.746) (-1292.523) [-1291.858] -- 0:00:23
660000 -- (-1293.660) (-1294.044) (-1291.518) [-1293.755] * [-1292.012] (-1294.852) (-1297.680) (-1292.424) -- 0:00:23
Average standard deviation of split frequencies: 0.011039
660500 -- (-1294.846) [-1292.991] (-1293.925) (-1291.989) * (-1295.060) [-1294.360] (-1295.241) (-1297.948) -- 0:00:23
661000 -- [-1294.523] (-1293.226) (-1295.086) (-1293.004) * (-1294.146) (-1295.235) (-1296.961) [-1293.609] -- 0:00:23
661500 -- (-1291.406) (-1294.290) (-1291.873) [-1293.692] * [-1295.519] (-1295.901) (-1293.393) (-1293.216) -- 0:00:23
662000 -- (-1292.963) (-1292.275) [-1292.050] (-1293.587) * (-1299.793) (-1292.231) [-1294.247] (-1293.814) -- 0:00:22
662500 -- (-1294.156) [-1292.756] (-1292.056) (-1293.934) * (-1293.664) (-1293.796) (-1293.229) [-1294.259] -- 0:00:22
663000 -- (-1294.358) (-1293.283) (-1295.192) [-1293.505] * (-1294.666) (-1294.061) [-1294.273] (-1297.986) -- 0:00:22
663500 -- [-1291.356] (-1293.637) (-1292.919) (-1292.645) * (-1299.989) (-1294.267) (-1297.073) [-1297.187] -- 0:00:22
664000 -- (-1291.319) (-1294.085) [-1294.103] (-1293.795) * [-1293.508] (-1294.823) (-1294.541) (-1293.427) -- 0:00:23
664500 -- (-1292.523) (-1293.401) [-1294.916] (-1291.824) * (-1294.317) (-1294.775) (-1292.808) [-1292.575] -- 0:00:23
665000 -- (-1298.850) [-1291.570] (-1293.361) (-1291.518) * (-1292.189) (-1292.577) [-1292.221] (-1293.486) -- 0:00:23
Average standard deviation of split frequencies: 0.011450
665500 -- [-1294.085] (-1292.066) (-1300.099) (-1291.938) * [-1292.072] (-1295.775) (-1291.543) (-1295.209) -- 0:00:23
666000 -- (-1291.919) (-1292.879) (-1292.645) [-1292.040] * (-1297.114) [-1295.290] (-1292.604) (-1292.025) -- 0:00:23
666500 -- (-1293.207) [-1292.505] (-1294.135) (-1291.587) * (-1294.077) (-1293.286) (-1293.677) [-1291.993] -- 0:00:23
667000 -- (-1291.899) [-1292.352] (-1292.447) (-1291.586) * (-1292.723) [-1294.062] (-1292.701) (-1293.042) -- 0:00:22
667500 -- (-1297.656) (-1297.297) (-1292.774) [-1293.999] * (-1293.366) (-1292.536) (-1293.747) [-1294.122] -- 0:00:22
668000 -- (-1294.505) (-1293.194) (-1299.731) [-1292.502] * (-1291.919) (-1292.651) (-1292.962) [-1292.141] -- 0:00:22
668500 -- (-1294.545) (-1293.307) (-1292.574) [-1293.187] * [-1292.948] (-1291.843) (-1292.847) (-1292.885) -- 0:00:22
669000 -- (-1293.080) [-1293.988] (-1293.042) (-1293.396) * (-1298.397) (-1292.502) (-1292.215) [-1292.799] -- 0:00:22
669500 -- [-1292.611] (-1295.593) (-1292.334) (-1295.588) * (-1294.024) (-1292.723) [-1292.014] (-1293.421) -- 0:00:22
670000 -- (-1297.449) (-1294.286) [-1295.375] (-1293.235) * [-1291.923] (-1292.577) (-1291.758) (-1294.910) -- 0:00:22
Average standard deviation of split frequencies: 0.011494
670500 -- (-1292.861) [-1294.187] (-1297.178) (-1294.608) * (-1292.410) (-1291.565) (-1293.815) [-1294.901] -- 0:00:22
671000 -- (-1294.015) [-1292.962] (-1295.298) (-1295.572) * (-1292.319) (-1293.324) [-1294.206] (-1295.946) -- 0:00:22
671500 -- (-1295.619) [-1294.181] (-1295.072) (-1291.916) * (-1292.532) [-1294.448] (-1292.830) (-1294.858) -- 0:00:22
672000 -- (-1294.610) [-1294.604] (-1297.036) (-1291.449) * [-1293.324] (-1292.474) (-1293.234) (-1295.556) -- 0:00:22
672500 -- [-1296.540] (-1295.107) (-1294.751) (-1291.860) * (-1296.627) (-1294.061) [-1292.830] (-1293.804) -- 0:00:22
673000 -- [-1293.413] (-1292.872) (-1295.446) (-1295.479) * (-1292.292) (-1292.864) [-1296.774] (-1294.624) -- 0:00:22
673500 -- (-1297.175) (-1293.884) (-1294.321) [-1295.802] * [-1295.846] (-1296.252) (-1294.642) (-1293.889) -- 0:00:22
674000 -- (-1296.679) [-1299.732] (-1294.753) (-1292.868) * (-1293.576) (-1293.326) [-1292.717] (-1296.606) -- 0:00:22
674500 -- (-1293.183) (-1295.468) (-1293.295) [-1292.208] * (-1291.940) [-1292.204] (-1296.865) (-1299.791) -- 0:00:22
675000 -- (-1293.876) [-1293.764] (-1296.690) (-1293.203) * (-1292.775) [-1291.894] (-1296.955) (-1293.013) -- 0:00:22
Average standard deviation of split frequencies: 0.011568
675500 -- (-1293.234) (-1296.864) (-1293.013) [-1293.061] * [-1293.246] (-1291.615) (-1293.107) (-1292.846) -- 0:00:22
676000 -- (-1292.397) (-1292.186) (-1291.288) [-1291.381] * [-1292.963] (-1294.762) (-1293.909) (-1292.780) -- 0:00:22
676500 -- (-1293.295) [-1296.002] (-1295.264) (-1292.232) * [-1292.908] (-1294.459) (-1293.159) (-1291.984) -- 0:00:21
677000 -- (-1292.472) [-1292.800] (-1291.464) (-1294.578) * (-1292.354) (-1295.025) (-1292.692) [-1291.757] -- 0:00:21
677500 -- (-1296.451) [-1292.181] (-1291.914) (-1294.813) * (-1292.198) (-1294.552) [-1294.083] (-1291.698) -- 0:00:21
678000 -- (-1293.370) (-1295.719) [-1293.212] (-1299.045) * (-1291.184) [-1296.203] (-1296.150) (-1291.839) -- 0:00:22
678500 -- (-1294.784) [-1291.632] (-1294.029) (-1296.384) * (-1292.339) (-1293.899) (-1293.197) [-1292.527] -- 0:00:22
679000 -- (-1294.902) [-1291.994] (-1294.676) (-1294.295) * (-1292.280) (-1292.338) (-1295.096) [-1293.143] -- 0:00:22
679500 -- [-1295.288] (-1291.878) (-1292.724) (-1296.982) * (-1291.864) (-1293.140) (-1295.236) [-1292.577] -- 0:00:22
680000 -- (-1293.025) [-1292.613] (-1294.328) (-1294.999) * (-1292.068) [-1293.368] (-1294.253) (-1293.956) -- 0:00:22
Average standard deviation of split frequencies: 0.011774
680500 -- (-1294.961) [-1292.076] (-1295.930) (-1292.612) * [-1292.553] (-1295.642) (-1297.041) (-1292.687) -- 0:00:22
681000 -- (-1296.333) (-1293.821) (-1295.277) [-1294.267] * [-1292.462] (-1292.649) (-1298.043) (-1292.049) -- 0:00:22
681500 -- [-1293.056] (-1292.663) (-1296.613) (-1292.659) * (-1292.919) [-1293.598] (-1294.110) (-1292.987) -- 0:00:21
682000 -- (-1293.149) (-1293.174) (-1294.096) [-1293.558] * (-1294.021) [-1293.756] (-1293.260) (-1294.222) -- 0:00:21
682500 -- (-1295.729) (-1293.534) [-1296.522] (-1292.679) * (-1293.482) (-1292.684) [-1296.219] (-1294.662) -- 0:00:21
683000 -- (-1292.732) [-1294.918] (-1293.842) (-1293.515) * [-1296.275] (-1292.585) (-1292.764) (-1295.918) -- 0:00:21
683500 -- (-1293.946) [-1294.291] (-1296.778) (-1294.604) * (-1294.341) (-1296.233) [-1292.495] (-1293.310) -- 0:00:21
684000 -- (-1297.043) [-1293.780] (-1292.159) (-1295.339) * (-1296.920) [-1293.623] (-1292.738) (-1294.650) -- 0:00:21
684500 -- [-1294.530] (-1293.409) (-1291.503) (-1293.675) * (-1300.785) [-1300.087] (-1293.555) (-1293.209) -- 0:00:21
685000 -- (-1295.008) (-1295.261) [-1292.121] (-1295.986) * (-1295.807) (-1297.169) [-1294.244] (-1293.566) -- 0:00:21
Average standard deviation of split frequencies: 0.012208
685500 -- (-1296.532) [-1294.533] (-1291.259) (-1293.631) * (-1291.774) (-1294.720) [-1292.827] (-1292.948) -- 0:00:21
686000 -- (-1296.020) (-1292.620) [-1291.536] (-1292.460) * (-1292.137) (-1292.544) (-1295.566) [-1292.802] -- 0:00:21
686500 -- (-1295.563) (-1293.503) [-1295.650] (-1295.457) * (-1292.997) (-1292.864) [-1294.632] (-1292.477) -- 0:00:21
687000 -- [-1295.647] (-1294.887) (-1292.627) (-1295.335) * [-1295.018] (-1299.160) (-1297.047) (-1292.342) -- 0:00:21
687500 -- (-1292.732) (-1296.135) (-1292.315) [-1292.822] * (-1298.570) [-1295.283] (-1292.994) (-1295.066) -- 0:00:21
688000 -- [-1293.061] (-1300.181) (-1294.766) (-1299.087) * (-1292.594) (-1291.774) [-1294.773] (-1292.715) -- 0:00:21
688500 -- (-1293.235) (-1299.738) [-1297.119] (-1292.584) * [-1292.100] (-1293.054) (-1293.134) (-1298.796) -- 0:00:21
689000 -- (-1292.223) (-1292.828) (-1295.077) [-1292.458] * (-1294.801) (-1293.778) [-1291.693] (-1297.655) -- 0:00:21
689500 -- (-1292.139) (-1295.109) [-1293.669] (-1291.712) * (-1293.173) (-1292.659) (-1294.915) [-1293.202] -- 0:00:21
690000 -- [-1291.823] (-1294.427) (-1293.845) (-1291.953) * (-1295.022) [-1294.187] (-1295.062) (-1293.663) -- 0:00:21
Average standard deviation of split frequencies: 0.012085
690500 -- (-1291.118) [-1295.108] (-1295.566) (-1292.552) * (-1294.281) (-1293.226) [-1295.626] (-1292.864) -- 0:00:21
691000 -- (-1291.119) [-1293.021] (-1292.219) (-1292.152) * (-1293.335) [-1293.517] (-1291.903) (-1294.869) -- 0:00:21
691500 -- (-1292.510) (-1293.523) [-1292.376] (-1292.607) * [-1291.648] (-1295.573) (-1292.490) (-1296.669) -- 0:00:20
692000 -- (-1297.573) (-1293.841) (-1295.668) [-1292.525] * (-1291.953) [-1292.201] (-1291.590) (-1294.370) -- 0:00:21
692500 -- (-1297.377) (-1292.043) [-1293.378] (-1293.861) * (-1293.135) [-1294.930] (-1293.197) (-1293.026) -- 0:00:21
693000 -- (-1296.456) (-1292.057) [-1292.861] (-1292.925) * (-1292.670) (-1298.226) (-1293.656) [-1294.859] -- 0:00:21
693500 -- [-1292.573] (-1292.706) (-1292.510) (-1294.229) * [-1293.687] (-1297.742) (-1293.032) (-1293.264) -- 0:00:21
694000 -- (-1292.410) (-1295.322) (-1296.654) [-1294.333] * [-1294.593] (-1296.675) (-1293.812) (-1291.980) -- 0:00:21
694500 -- (-1293.517) [-1292.741] (-1294.949) (-1295.406) * (-1293.753) (-1296.663) (-1296.929) [-1292.504] -- 0:00:21
695000 -- (-1293.293) (-1293.556) [-1294.259] (-1291.359) * (-1292.043) (-1292.416) [-1295.386] (-1294.621) -- 0:00:21
Average standard deviation of split frequencies: 0.012271
695500 -- [-1292.844] (-1295.408) (-1294.181) (-1291.571) * (-1291.788) (-1291.886) (-1295.640) [-1292.965] -- 0:00:21
696000 -- (-1291.880) (-1294.767) [-1293.365] (-1294.127) * [-1293.065] (-1291.963) (-1295.955) (-1295.077) -- 0:00:20
696500 -- (-1291.852) (-1294.846) (-1293.476) [-1296.052] * (-1293.811) (-1292.340) [-1293.397] (-1295.085) -- 0:00:20
697000 -- (-1291.319) (-1294.193) [-1292.345] (-1293.647) * [-1294.281] (-1293.231) (-1294.206) (-1294.673) -- 0:00:20
697500 -- (-1291.542) (-1299.657) (-1295.562) [-1291.458] * [-1294.021] (-1297.627) (-1293.956) (-1294.379) -- 0:00:20
698000 -- (-1292.592) (-1294.513) (-1292.218) [-1293.842] * [-1296.454] (-1300.928) (-1291.937) (-1293.066) -- 0:00:20
698500 -- (-1292.680) (-1293.568) [-1292.868] (-1292.553) * (-1293.244) [-1295.006] (-1292.717) (-1293.419) -- 0:00:20
699000 -- [-1293.885] (-1292.400) (-1294.080) (-1294.423) * [-1294.153] (-1293.652) (-1293.486) (-1292.743) -- 0:00:20
699500 -- (-1293.009) (-1292.000) (-1293.376) [-1291.901] * (-1294.180) (-1293.067) [-1293.999] (-1295.129) -- 0:00:20
700000 -- (-1293.851) [-1293.161] (-1291.524) (-1293.195) * [-1292.379] (-1292.824) (-1295.140) (-1297.498) -- 0:00:20
Average standard deviation of split frequencies: 0.011912
700500 -- (-1293.288) (-1292.735) [-1293.198] (-1291.707) * (-1292.932) (-1294.091) [-1291.537] (-1294.802) -- 0:00:20
701000 -- (-1291.769) (-1292.862) [-1294.326] (-1292.234) * (-1293.113) [-1293.025] (-1293.428) (-1295.259) -- 0:00:20
701500 -- (-1291.736) (-1293.392) (-1292.731) [-1294.311] * (-1292.504) [-1291.785] (-1296.223) (-1297.849) -- 0:00:20
702000 -- (-1292.039) [-1294.726] (-1292.550) (-1299.025) * (-1292.182) (-1291.823) (-1293.156) [-1292.653] -- 0:00:20
702500 -- (-1291.932) (-1293.302) [-1292.017] (-1294.446) * [-1295.003] (-1296.401) (-1294.371) (-1294.287) -- 0:00:20
703000 -- (-1291.614) (-1295.492) (-1292.900) [-1291.214] * (-1294.711) (-1293.395) (-1292.374) [-1291.559] -- 0:00:20
703500 -- (-1293.348) (-1292.997) [-1292.773] (-1293.506) * [-1291.783] (-1294.879) (-1294.358) (-1293.328) -- 0:00:20
704000 -- (-1292.843) (-1293.380) (-1297.443) [-1292.106] * (-1293.400) (-1294.076) (-1292.344) [-1293.043] -- 0:00:20
704500 -- (-1296.471) [-1292.701] (-1293.997) (-1292.194) * (-1296.224) (-1293.123) [-1292.516] (-1293.818) -- 0:00:20
705000 -- (-1296.322) (-1293.370) (-1292.730) [-1292.667] * (-1294.075) (-1294.836) [-1294.053] (-1292.229) -- 0:00:20
Average standard deviation of split frequencies: 0.011901
705500 -- (-1291.416) (-1293.146) [-1294.465] (-1295.308) * (-1294.581) [-1292.339] (-1292.504) (-1293.686) -- 0:00:20
706000 -- (-1296.563) (-1294.233) (-1299.174) [-1292.876] * (-1295.420) (-1292.261) [-1291.791] (-1292.161) -- 0:00:20
706500 -- [-1294.959] (-1292.087) (-1297.907) (-1294.728) * (-1296.097) (-1292.607) [-1291.572] (-1295.174) -- 0:00:20
707000 -- (-1294.921) (-1292.742) (-1294.838) [-1291.602] * (-1291.122) [-1295.266] (-1295.466) (-1294.155) -- 0:00:20
707500 -- [-1292.562] (-1295.660) (-1294.846) (-1291.432) * (-1293.389) (-1291.872) (-1294.402) [-1292.104] -- 0:00:20
708000 -- (-1293.561) (-1295.251) (-1291.584) [-1294.449] * [-1295.474] (-1293.978) (-1291.743) (-1293.106) -- 0:00:20
708500 -- [-1292.252] (-1293.597) (-1294.148) (-1292.313) * (-1294.989) [-1291.780] (-1292.405) (-1296.486) -- 0:00:20
709000 -- (-1294.005) (-1291.766) [-1292.714] (-1292.652) * (-1294.855) [-1291.618] (-1293.085) (-1295.092) -- 0:00:20
709500 -- (-1293.083) (-1292.955) (-1296.712) [-1293.266] * [-1294.787] (-1294.013) (-1293.104) (-1291.653) -- 0:00:20
710000 -- [-1293.938] (-1292.958) (-1296.203) (-1296.611) * (-1293.930) (-1295.999) (-1292.864) [-1292.239] -- 0:00:20
Average standard deviation of split frequencies: 0.011667
710500 -- (-1297.284) (-1293.070) [-1293.365] (-1298.500) * (-1293.943) [-1293.359] (-1294.715) (-1292.894) -- 0:00:19
711000 -- [-1293.599] (-1296.753) (-1294.600) (-1291.555) * [-1291.365] (-1295.415) (-1294.286) (-1291.675) -- 0:00:19
711500 -- (-1292.359) (-1293.389) [-1292.476] (-1294.805) * (-1291.597) (-1298.011) [-1293.363] (-1292.125) -- 0:00:19
712000 -- (-1296.237) (-1293.544) [-1292.280] (-1294.729) * (-1292.150) (-1293.305) (-1293.311) [-1291.804] -- 0:00:19
712500 -- (-1298.011) (-1291.940) [-1291.526] (-1296.744) * (-1291.757) (-1292.320) (-1295.536) [-1293.695] -- 0:00:19
713000 -- (-1298.060) [-1291.720] (-1291.358) (-1298.747) * (-1293.407) (-1291.767) [-1293.907] (-1291.266) -- 0:00:19
713500 -- (-1292.794) [-1292.276] (-1295.180) (-1292.568) * (-1294.578) [-1292.203] (-1298.156) (-1291.531) -- 0:00:19
714000 -- [-1295.370] (-1292.787) (-1292.976) (-1292.401) * (-1293.235) [-1292.349] (-1295.235) (-1293.042) -- 0:00:19
714500 -- (-1293.671) (-1292.420) [-1294.551] (-1295.343) * (-1293.270) (-1293.071) [-1292.336] (-1296.243) -- 0:00:19
715000 -- [-1293.522] (-1299.878) (-1296.863) (-1293.890) * (-1293.572) (-1291.555) [-1293.834] (-1295.504) -- 0:00:19
Average standard deviation of split frequencies: 0.011619
715500 -- (-1293.112) (-1302.295) [-1292.363] (-1291.198) * (-1293.227) (-1293.100) [-1293.009] (-1296.134) -- 0:00:19
716000 -- (-1292.298) (-1300.514) (-1293.482) [-1291.537] * (-1292.865) [-1294.214] (-1293.286) (-1293.820) -- 0:00:19
716500 -- (-1295.872) (-1293.784) [-1292.546] (-1292.121) * [-1294.189] (-1295.110) (-1297.353) (-1295.135) -- 0:00:19
717000 -- [-1295.938] (-1301.309) (-1293.544) (-1293.702) * (-1293.088) [-1293.902] (-1297.793) (-1294.542) -- 0:00:19
717500 -- (-1299.163) (-1293.369) (-1293.218) [-1293.950] * [-1292.238] (-1292.081) (-1291.921) (-1298.236) -- 0:00:19
718000 -- [-1293.218] (-1293.305) (-1294.635) (-1294.200) * (-1292.831) (-1292.310) [-1292.449] (-1293.692) -- 0:00:19
718500 -- (-1291.578) [-1295.990] (-1294.302) (-1292.855) * (-1294.241) (-1292.246) [-1292.633] (-1292.988) -- 0:00:19
719000 -- (-1292.241) (-1295.590) (-1294.459) [-1295.036] * (-1292.551) [-1292.858] (-1296.666) (-1292.726) -- 0:00:19
719500 -- (-1291.605) (-1296.544) [-1294.774] (-1294.740) * (-1291.819) (-1295.021) [-1292.989] (-1292.412) -- 0:00:19
720000 -- (-1291.477) [-1294.105] (-1294.713) (-1292.244) * (-1292.307) (-1294.848) (-1293.344) [-1293.450] -- 0:00:19
Average standard deviation of split frequencies: 0.011582
720500 -- (-1291.507) (-1296.546) (-1294.575) [-1292.041] * (-1293.703) [-1292.897] (-1296.934) (-1292.310) -- 0:00:19
721000 -- (-1293.627) (-1293.898) [-1294.790] (-1291.638) * (-1293.060) (-1292.432) (-1296.386) [-1292.955] -- 0:00:19
721500 -- (-1292.000) (-1292.691) (-1294.116) [-1292.017] * [-1293.977] (-1294.630) (-1294.004) (-1292.032) -- 0:00:19
722000 -- (-1292.552) (-1293.705) [-1295.139] (-1294.823) * (-1294.385) (-1297.466) (-1294.310) [-1294.118] -- 0:00:19
722500 -- (-1292.099) (-1292.733) [-1294.729] (-1296.369) * (-1293.226) (-1294.320) [-1293.295] (-1292.282) -- 0:00:19
723000 -- (-1292.766) [-1293.444] (-1293.820) (-1291.438) * (-1294.288) (-1294.313) (-1292.777) [-1292.907] -- 0:00:19
723500 -- (-1292.167) [-1292.120] (-1293.191) (-1291.507) * (-1299.481) (-1293.534) (-1293.132) [-1293.709] -- 0:00:19
724000 -- (-1292.380) (-1293.803) (-1293.635) [-1294.530] * [-1291.629] (-1292.390) (-1294.285) (-1292.140) -- 0:00:19
724500 -- (-1291.406) [-1291.920] (-1292.962) (-1293.744) * (-1291.710) (-1294.035) [-1292.852] (-1295.874) -- 0:00:19
725000 -- (-1293.701) (-1300.345) [-1296.300] (-1293.915) * [-1291.826] (-1295.959) (-1296.965) (-1295.382) -- 0:00:18
Average standard deviation of split frequencies: 0.011038
725500 -- [-1294.351] (-1293.783) (-1293.838) (-1294.929) * (-1292.709) (-1296.318) (-1295.086) [-1294.258] -- 0:00:18
726000 -- [-1293.784] (-1293.516) (-1294.673) (-1296.334) * (-1292.927) (-1296.997) [-1292.436] (-1293.780) -- 0:00:18
726500 -- (-1292.640) (-1298.230) (-1292.005) [-1294.917] * (-1291.362) [-1293.432] (-1292.135) (-1294.622) -- 0:00:18
727000 -- [-1291.820] (-1293.135) (-1293.791) (-1294.664) * (-1295.203) (-1294.665) [-1292.793] (-1294.154) -- 0:00:18
727500 -- [-1297.731] (-1293.328) (-1295.159) (-1295.369) * (-1292.715) (-1293.343) [-1291.283] (-1293.064) -- 0:00:18
728000 -- (-1294.745) (-1293.148) (-1292.103) [-1292.528] * (-1293.854) [-1293.499] (-1291.419) (-1292.832) -- 0:00:18
728500 -- [-1297.511] (-1292.752) (-1293.966) (-1293.345) * (-1293.716) (-1294.526) [-1291.418] (-1295.355) -- 0:00:18
729000 -- (-1295.649) (-1292.150) [-1294.932] (-1295.143) * (-1294.150) (-1296.432) [-1293.986] (-1292.095) -- 0:00:18
729500 -- (-1292.538) (-1292.762) (-1294.204) [-1294.045] * (-1295.311) (-1296.783) (-1293.642) [-1292.138] -- 0:00:18
730000 -- (-1293.454) (-1292.135) (-1292.031) [-1291.673] * [-1293.678] (-1297.772) (-1294.253) (-1292.598) -- 0:00:18
Average standard deviation of split frequencies: 0.011082
730500 -- (-1299.072) [-1292.267] (-1294.068) (-1293.966) * (-1294.556) (-1298.678) (-1292.802) [-1293.952] -- 0:00:18
731000 -- (-1295.695) [-1292.680] (-1295.417) (-1293.889) * (-1296.217) (-1296.251) [-1292.902] (-1292.631) -- 0:00:18
731500 -- (-1293.379) [-1291.758] (-1293.554) (-1291.717) * [-1292.523] (-1297.017) (-1292.898) (-1294.403) -- 0:00:18
732000 -- [-1291.948] (-1293.613) (-1292.997) (-1292.106) * (-1292.441) (-1297.945) [-1292.085] (-1294.073) -- 0:00:18
732500 -- (-1295.796) [-1296.111] (-1297.567) (-1291.988) * [-1292.071] (-1291.383) (-1293.489) (-1291.882) -- 0:00:18
733000 -- [-1293.360] (-1294.671) (-1296.198) (-1296.227) * [-1292.506] (-1291.421) (-1293.912) (-1296.131) -- 0:00:18
733500 -- (-1293.058) (-1297.128) (-1297.167) [-1293.283] * (-1294.510) [-1293.136] (-1296.753) (-1295.949) -- 0:00:18
734000 -- (-1297.897) [-1301.642] (-1293.790) (-1294.178) * (-1292.755) [-1294.575] (-1293.558) (-1293.816) -- 0:00:18
734500 -- (-1296.063) (-1294.807) [-1294.321] (-1294.865) * (-1293.838) (-1297.605) [-1293.999] (-1293.750) -- 0:00:18
735000 -- (-1292.083) (-1291.834) (-1292.273) [-1293.531] * (-1293.224) (-1291.494) [-1292.464] (-1294.158) -- 0:00:18
Average standard deviation of split frequencies: 0.011341
735500 -- [-1292.205] (-1291.623) (-1292.617) (-1295.765) * (-1293.076) (-1293.681) (-1294.840) [-1292.593] -- 0:00:18
736000 -- (-1292.217) [-1292.795] (-1293.007) (-1293.867) * (-1295.648) [-1291.691] (-1294.817) (-1292.948) -- 0:00:18
736500 -- (-1292.788) (-1294.144) [-1292.779] (-1291.633) * [-1294.113] (-1291.728) (-1293.911) (-1291.739) -- 0:00:18
737000 -- (-1293.057) (-1292.194) [-1300.498] (-1294.092) * [-1291.622] (-1294.335) (-1295.070) (-1292.699) -- 0:00:18
737500 -- [-1293.624] (-1292.335) (-1293.399) (-1294.499) * (-1293.644) [-1293.420] (-1292.201) (-1293.794) -- 0:00:18
738000 -- (-1297.365) (-1299.172) [-1292.839] (-1296.678) * (-1292.288) (-1294.513) (-1292.393) [-1294.678] -- 0:00:18
738500 -- [-1299.416] (-1297.430) (-1293.471) (-1293.452) * [-1293.996] (-1291.738) (-1292.726) (-1292.572) -- 0:00:18
739000 -- (-1292.393) [-1295.182] (-1292.334) (-1293.689) * (-1293.659) (-1295.878) [-1294.525] (-1292.929) -- 0:00:18
739500 -- (-1297.243) (-1295.635) (-1292.028) [-1296.775] * (-1295.001) (-1293.077) [-1292.819] (-1293.249) -- 0:00:17
740000 -- (-1301.525) (-1295.203) (-1294.370) [-1292.519] * (-1297.148) [-1292.798] (-1293.677) (-1292.409) -- 0:00:17
Average standard deviation of split frequencies: 0.011307
740500 -- (-1299.133) (-1293.706) (-1291.712) [-1295.725] * (-1295.596) [-1294.057] (-1298.731) (-1294.344) -- 0:00:17
741000 -- (-1294.534) [-1292.889] (-1294.084) (-1292.859) * (-1295.736) [-1293.476] (-1297.739) (-1301.305) -- 0:00:17
741500 -- (-1295.603) [-1292.966] (-1292.713) (-1292.496) * (-1293.917) [-1291.500] (-1297.241) (-1294.111) -- 0:00:17
742000 -- (-1292.883) [-1293.830] (-1293.717) (-1292.676) * (-1292.166) (-1291.625) [-1294.733] (-1294.855) -- 0:00:17
742500 -- (-1291.577) (-1293.477) [-1293.380] (-1291.873) * (-1292.706) (-1296.958) (-1292.116) [-1299.343] -- 0:00:17
743000 -- (-1295.413) (-1292.207) [-1295.260] (-1291.581) * [-1292.105] (-1294.051) (-1293.918) (-1293.495) -- 0:00:17
743500 -- [-1292.459] (-1292.845) (-1294.911) (-1292.175) * [-1292.742] (-1294.020) (-1299.297) (-1293.956) -- 0:00:17
744000 -- [-1294.085] (-1292.581) (-1293.892) (-1303.161) * (-1292.207) (-1292.699) [-1294.831] (-1294.781) -- 0:00:17
744500 -- [-1293.569] (-1297.963) (-1295.820) (-1293.116) * [-1292.598] (-1293.365) (-1295.926) (-1294.275) -- 0:00:17
745000 -- (-1294.476) [-1295.452] (-1292.073) (-1293.542) * [-1291.669] (-1293.066) (-1293.632) (-1295.048) -- 0:00:17
Average standard deviation of split frequencies: 0.011783
745500 -- [-1293.882] (-1295.337) (-1292.593) (-1294.980) * (-1292.312) [-1291.618] (-1293.269) (-1291.186) -- 0:00:17
746000 -- (-1294.621) (-1292.916) (-1296.445) [-1295.529] * [-1298.342] (-1295.454) (-1297.070) (-1291.918) -- 0:00:17
746500 -- [-1296.036] (-1292.976) (-1297.059) (-1293.179) * (-1292.078) (-1293.347) [-1295.537] (-1291.458) -- 0:00:17
747000 -- [-1294.189] (-1294.657) (-1295.564) (-1292.364) * (-1294.047) (-1292.823) [-1293.903] (-1293.098) -- 0:00:17
747500 -- (-1296.733) [-1302.148] (-1293.399) (-1293.141) * (-1292.571) [-1291.708] (-1292.202) (-1293.548) -- 0:00:17
748000 -- (-1298.967) [-1292.193] (-1293.059) (-1291.388) * (-1292.571) (-1291.881) [-1292.006] (-1293.993) -- 0:00:17
748500 -- (-1293.082) (-1292.632) [-1291.577] (-1291.690) * (-1293.998) [-1292.648] (-1292.074) (-1293.753) -- 0:00:17
749000 -- (-1294.546) (-1291.770) [-1294.071] (-1291.164) * (-1294.004) (-1291.874) (-1291.774) [-1293.785] -- 0:00:17
749500 -- [-1293.029] (-1292.603) (-1292.515) (-1291.521) * (-1294.593) [-1291.816] (-1293.250) (-1293.544) -- 0:00:17
750000 -- (-1293.533) [-1291.486] (-1293.396) (-1294.841) * (-1294.474) (-1292.762) [-1295.408] (-1294.960) -- 0:00:17
Average standard deviation of split frequencies: 0.011378
750500 -- [-1294.086] (-1294.200) (-1295.518) (-1294.712) * [-1294.346] (-1292.323) (-1293.904) (-1293.290) -- 0:00:17
751000 -- (-1292.749) (-1293.886) (-1291.732) [-1293.460] * (-1294.056) [-1294.251] (-1294.346) (-1293.181) -- 0:00:17
751500 -- [-1293.307] (-1295.223) (-1292.474) (-1292.210) * [-1291.508] (-1293.282) (-1293.054) (-1292.289) -- 0:00:17
752000 -- (-1294.568) (-1294.791) (-1295.498) [-1293.063] * [-1291.412] (-1297.150) (-1293.924) (-1295.415) -- 0:00:17
752500 -- (-1292.616) (-1291.798) (-1296.236) [-1294.908] * [-1291.358] (-1297.531) (-1292.951) (-1294.800) -- 0:00:17
753000 -- (-1294.757) (-1294.130) (-1293.708) [-1292.033] * (-1293.792) (-1295.676) (-1296.953) [-1294.350] -- 0:00:17
753500 -- (-1296.277) [-1293.451] (-1291.771) (-1292.582) * (-1292.771) [-1292.198] (-1293.506) (-1294.899) -- 0:00:17
754000 -- (-1293.351) (-1294.231) (-1295.056) [-1293.144] * (-1293.555) (-1293.511) [-1292.174] (-1293.907) -- 0:00:16
754500 -- (-1293.287) [-1292.268] (-1292.070) (-1297.057) * (-1293.545) (-1292.099) (-1291.990) [-1293.718] -- 0:00:16
755000 -- (-1292.809) [-1293.287] (-1292.235) (-1294.787) * (-1293.589) [-1297.861] (-1296.055) (-1294.174) -- 0:00:16
Average standard deviation of split frequencies: 0.011261
755500 -- (-1293.549) (-1297.234) [-1299.801] (-1291.725) * (-1295.375) (-1298.569) (-1297.237) [-1293.653] -- 0:00:16
756000 -- [-1293.110] (-1295.225) (-1299.768) (-1292.333) * (-1298.460) [-1296.730] (-1298.152) (-1295.798) -- 0:00:16
756500 -- (-1294.051) (-1291.805) [-1291.787] (-1291.983) * [-1294.673] (-1294.140) (-1295.013) (-1296.763) -- 0:00:16
757000 -- (-1292.432) [-1291.780] (-1300.882) (-1291.820) * (-1294.039) (-1294.888) (-1294.265) [-1293.031] -- 0:00:16
757500 -- [-1291.648] (-1292.008) (-1297.154) (-1294.590) * (-1294.560) (-1294.267) [-1291.117] (-1297.317) -- 0:00:16
758000 -- (-1291.982) [-1293.375] (-1294.207) (-1296.921) * (-1292.986) (-1296.364) [-1291.152] (-1294.290) -- 0:00:16
758500 -- (-1292.457) (-1291.631) [-1293.218] (-1296.279) * (-1294.146) (-1294.358) (-1293.836) [-1293.419] -- 0:00:16
759000 -- [-1291.390] (-1291.864) (-1293.565) (-1292.820) * (-1294.166) (-1296.501) (-1291.830) [-1292.010] -- 0:00:16
759500 -- (-1296.359) (-1292.857) [-1291.498] (-1296.386) * (-1294.025) [-1293.017] (-1291.146) (-1291.957) -- 0:00:16
760000 -- (-1293.472) (-1291.977) (-1292.240) [-1294.828] * [-1293.854] (-1297.371) (-1292.166) (-1292.737) -- 0:00:16
Average standard deviation of split frequencies: 0.010791
760500 -- [-1292.948] (-1293.240) (-1291.539) (-1293.126) * (-1291.682) [-1297.163] (-1294.237) (-1291.641) -- 0:00:16
761000 -- (-1291.596) (-1294.101) (-1293.789) [-1293.083] * [-1291.671] (-1292.847) (-1294.106) (-1292.028) -- 0:00:16
761500 -- (-1291.870) [-1292.952] (-1293.489) (-1293.690) * [-1292.119] (-1296.968) (-1291.679) (-1293.627) -- 0:00:16
762000 -- (-1299.243) [-1291.818] (-1296.543) (-1295.087) * (-1292.776) [-1294.809] (-1291.844) (-1291.623) -- 0:00:16
762500 -- (-1298.657) (-1291.964) (-1293.793) [-1292.246] * (-1293.904) (-1293.114) (-1294.601) [-1291.780] -- 0:00:16
763000 -- (-1295.313) (-1291.985) [-1293.000] (-1293.466) * (-1292.641) (-1293.717) (-1292.014) [-1294.984] -- 0:00:16
763500 -- (-1296.281) [-1291.493] (-1293.964) (-1293.681) * (-1293.701) (-1294.332) [-1291.427] (-1301.010) -- 0:00:16
764000 -- (-1295.618) (-1294.700) [-1292.444] (-1293.800) * (-1293.272) (-1293.253) (-1293.172) [-1293.592] -- 0:00:16
764500 -- (-1294.068) [-1292.279] (-1295.434) (-1293.953) * (-1299.210) [-1293.524] (-1293.136) (-1296.550) -- 0:00:16
765000 -- (-1292.365) (-1294.289) [-1291.507] (-1294.281) * (-1297.728) (-1292.772) (-1296.878) [-1293.000] -- 0:00:16
Average standard deviation of split frequencies: 0.010426
765500 -- (-1295.684) (-1293.380) [-1292.041] (-1292.381) * (-1295.387) (-1297.088) [-1293.443] (-1292.488) -- 0:00:16
766000 -- (-1292.744) (-1292.564) [-1294.581] (-1293.804) * (-1295.880) (-1292.728) [-1295.379] (-1295.016) -- 0:00:16
766500 -- (-1294.995) (-1293.446) [-1292.279] (-1294.784) * (-1297.577) (-1294.817) (-1291.364) [-1292.034] -- 0:00:16
767000 -- (-1292.979) (-1293.311) [-1293.957] (-1295.980) * [-1292.066] (-1294.512) (-1294.678) (-1293.514) -- 0:00:16
767500 -- (-1294.545) (-1292.526) [-1291.516] (-1296.266) * [-1293.442] (-1295.164) (-1296.403) (-1292.640) -- 0:00:16
768000 -- (-1292.010) [-1292.883] (-1293.539) (-1293.000) * (-1292.757) (-1294.001) [-1295.010] (-1291.297) -- 0:00:16
768500 -- [-1295.273] (-1292.430) (-1296.809) (-1294.572) * (-1297.970) (-1295.953) (-1294.295) [-1292.137] -- 0:00:15
769000 -- [-1293.325] (-1291.905) (-1294.800) (-1295.183) * (-1292.948) [-1292.291] (-1295.585) (-1293.935) -- 0:00:15
769500 -- [-1293.261] (-1293.397) (-1293.621) (-1293.638) * (-1293.314) [-1293.454] (-1296.825) (-1292.257) -- 0:00:15
770000 -- (-1293.449) [-1291.458] (-1292.496) (-1293.435) * (-1296.108) [-1293.625] (-1292.575) (-1292.197) -- 0:00:15
Average standard deviation of split frequencies: 0.010183
770500 -- (-1291.941) [-1291.580] (-1292.392) (-1291.788) * (-1295.683) (-1291.964) [-1291.289] (-1293.887) -- 0:00:15
771000 -- [-1292.005] (-1295.007) (-1292.444) (-1294.474) * (-1294.272) (-1294.694) (-1292.940) [-1294.100] -- 0:00:15
771500 -- (-1292.889) [-1294.808] (-1293.679) (-1293.640) * (-1295.032) [-1292.945] (-1293.183) (-1294.152) -- 0:00:15
772000 -- (-1294.148) (-1293.557) [-1292.014] (-1292.737) * [-1295.063] (-1291.881) (-1294.383) (-1293.070) -- 0:00:15
772500 -- (-1293.240) (-1292.419) (-1293.213) [-1292.052] * (-1297.782) [-1292.037] (-1294.225) (-1293.139) -- 0:00:15
773000 -- (-1295.820) (-1296.027) [-1294.043] (-1296.021) * (-1294.157) (-1294.549) [-1292.490] (-1295.361) -- 0:00:15
773500 -- (-1292.542) [-1291.733] (-1293.543) (-1294.861) * (-1293.990) (-1295.412) (-1292.017) [-1294.881] -- 0:00:15
774000 -- (-1295.063) (-1292.872) [-1292.730] (-1293.322) * (-1293.268) [-1294.278] (-1291.855) (-1295.589) -- 0:00:15
774500 -- [-1293.061] (-1297.341) (-1295.433) (-1292.978) * (-1293.492) [-1291.856] (-1292.016) (-1293.094) -- 0:00:15
775000 -- (-1291.987) (-1294.907) (-1294.362) [-1292.582] * (-1293.556) (-1291.574) (-1292.649) [-1291.539] -- 0:00:15
Average standard deviation of split frequencies: 0.010148
775500 -- (-1294.557) (-1294.368) [-1292.942] (-1292.411) * (-1293.892) (-1292.946) (-1297.855) [-1291.796] -- 0:00:15
776000 -- [-1292.008] (-1295.498) (-1292.355) (-1292.691) * (-1292.230) (-1296.281) [-1296.828] (-1293.552) -- 0:00:15
776500 -- [-1292.949] (-1294.816) (-1293.116) (-1292.812) * (-1291.925) [-1292.670] (-1292.915) (-1291.612) -- 0:00:15
777000 -- (-1291.846) (-1294.659) (-1293.606) [-1293.450] * [-1292.084] (-1295.419) (-1292.481) (-1292.709) -- 0:00:15
777500 -- (-1292.808) (-1296.552) [-1292.803] (-1297.615) * (-1291.448) (-1296.473) (-1293.215) [-1292.858] -- 0:00:15
778000 -- (-1292.187) [-1295.338] (-1294.897) (-1294.758) * (-1294.683) [-1295.212] (-1293.130) (-1297.606) -- 0:00:15
778500 -- [-1294.123] (-1294.597) (-1293.143) (-1293.139) * (-1297.003) (-1292.905) (-1292.895) [-1294.746] -- 0:00:15
779000 -- [-1292.717] (-1294.575) (-1299.144) (-1295.251) * (-1292.905) (-1297.712) [-1295.486] (-1291.623) -- 0:00:15
779500 -- (-1292.877) [-1295.209] (-1292.483) (-1297.689) * (-1292.875) (-1292.987) (-1296.448) [-1291.699] -- 0:00:15
780000 -- [-1292.116] (-1295.206) (-1291.639) (-1296.818) * [-1292.722] (-1293.392) (-1299.114) (-1292.085) -- 0:00:15
Average standard deviation of split frequencies: 0.010265
780500 -- [-1292.792] (-1295.876) (-1296.741) (-1292.205) * [-1292.273] (-1292.484) (-1298.950) (-1292.479) -- 0:00:15
781000 -- (-1295.590) [-1296.171] (-1295.828) (-1299.936) * (-1292.861) [-1292.642] (-1294.133) (-1292.910) -- 0:00:15
781500 -- (-1293.239) (-1292.293) [-1296.041] (-1296.816) * (-1292.967) (-1292.763) [-1295.939] (-1293.520) -- 0:00:15
782000 -- (-1294.950) (-1292.717) [-1295.484] (-1296.308) * (-1296.717) (-1292.432) (-1292.400) [-1292.506] -- 0:00:15
782500 -- [-1296.335] (-1296.408) (-1291.940) (-1292.359) * (-1297.235) [-1292.823] (-1293.326) (-1291.555) -- 0:00:15
783000 -- [-1296.566] (-1292.585) (-1292.282) (-1292.438) * (-1293.834) (-1293.228) [-1292.436] (-1295.969) -- 0:00:14
783500 -- (-1294.754) [-1291.597] (-1295.133) (-1293.611) * [-1291.868] (-1291.648) (-1293.551) (-1292.795) -- 0:00:14
784000 -- (-1293.256) [-1293.646] (-1294.599) (-1293.120) * (-1296.288) [-1294.425] (-1296.988) (-1295.557) -- 0:00:14
784500 -- [-1292.111] (-1293.457) (-1297.287) (-1299.092) * (-1297.566) [-1294.703] (-1296.421) (-1295.730) -- 0:00:14
785000 -- [-1293.140] (-1291.829) (-1293.809) (-1291.924) * [-1292.866] (-1293.306) (-1295.520) (-1302.144) -- 0:00:14
Average standard deviation of split frequencies: 0.010362
785500 -- (-1295.563) (-1292.925) (-1297.936) [-1294.204] * (-1296.236) (-1295.089) [-1292.654] (-1293.178) -- 0:00:14
786000 -- [-1293.917] (-1297.010) (-1292.384) (-1297.391) * (-1293.218) [-1294.761] (-1297.791) (-1292.790) -- 0:00:14
786500 -- (-1296.782) (-1293.190) [-1292.818] (-1294.969) * (-1291.481) [-1294.119] (-1292.518) (-1295.044) -- 0:00:14
787000 -- (-1293.150) (-1295.802) [-1295.463] (-1293.254) * (-1292.685) (-1296.554) [-1293.667] (-1297.912) -- 0:00:14
787500 -- (-1297.068) [-1293.684] (-1293.953) (-1293.586) * [-1293.462] (-1293.759) (-1293.251) (-1294.369) -- 0:00:14
788000 -- (-1291.588) (-1292.607) (-1292.833) [-1293.844] * (-1295.277) [-1295.880] (-1293.638) (-1295.179) -- 0:00:14
788500 -- [-1291.107] (-1293.030) (-1291.730) (-1293.227) * (-1293.180) [-1294.336] (-1293.538) (-1294.828) -- 0:00:14
789000 -- (-1291.238) [-1293.644] (-1291.900) (-1295.428) * [-1292.174] (-1293.477) (-1296.056) (-1292.121) -- 0:00:14
789500 -- (-1295.090) [-1296.309] (-1294.186) (-1293.809) * (-1295.843) [-1295.034] (-1291.953) (-1293.029) -- 0:00:14
790000 -- (-1293.973) [-1295.434] (-1294.305) (-1292.619) * (-1292.151) (-1292.009) [-1292.686] (-1291.992) -- 0:00:14
Average standard deviation of split frequencies: 0.010521
790500 -- (-1291.444) (-1291.965) [-1305.500] (-1292.610) * (-1291.846) [-1293.461] (-1292.388) (-1291.510) -- 0:00:14
791000 -- (-1292.865) (-1292.887) [-1292.742] (-1292.587) * [-1291.836] (-1293.068) (-1293.749) (-1291.764) -- 0:00:14
791500 -- (-1291.942) (-1294.703) [-1293.296] (-1291.969) * (-1291.649) [-1291.583] (-1293.170) (-1293.623) -- 0:00:14
792000 -- (-1292.602) [-1295.820] (-1292.067) (-1292.597) * [-1293.559] (-1292.033) (-1295.134) (-1292.505) -- 0:00:14
792500 -- (-1291.640) [-1294.223] (-1295.496) (-1292.208) * (-1293.698) [-1294.204] (-1291.061) (-1293.431) -- 0:00:14
793000 -- (-1301.195) [-1292.144] (-1291.773) (-1294.073) * (-1293.289) (-1294.718) [-1293.063] (-1295.169) -- 0:00:14
793500 -- (-1293.963) (-1292.404) (-1293.982) [-1293.500] * [-1293.652] (-1292.582) (-1293.657) (-1293.483) -- 0:00:14
794000 -- (-1296.414) (-1292.285) [-1291.900] (-1294.878) * (-1294.623) (-1291.629) (-1293.858) [-1291.527] -- 0:00:14
794500 -- (-1293.929) (-1300.221) [-1292.594] (-1296.370) * (-1292.292) [-1292.163] (-1291.997) (-1293.918) -- 0:00:14
795000 -- [-1293.620] (-1293.253) (-1291.949) (-1291.487) * (-1291.805) (-1293.833) (-1295.874) [-1294.076] -- 0:00:14
Average standard deviation of split frequencies: 0.010625
795500 -- [-1292.459] (-1293.202) (-1293.021) (-1294.734) * [-1293.670] (-1293.632) (-1294.470) (-1292.634) -- 0:00:14
796000 -- (-1292.810) (-1293.362) (-1292.339) [-1293.374] * (-1293.499) (-1300.763) [-1295.066] (-1294.005) -- 0:00:14
796500 -- [-1292.002] (-1294.108) (-1291.861) (-1292.690) * (-1295.103) (-1294.630) [-1291.843] (-1295.414) -- 0:00:14
797000 -- (-1293.897) [-1293.453] (-1291.814) (-1293.182) * [-1292.581] (-1293.461) (-1294.014) (-1295.589) -- 0:00:14
797500 -- (-1293.023) (-1292.394) (-1291.831) [-1293.083] * [-1292.941] (-1291.892) (-1292.379) (-1291.925) -- 0:00:13
798000 -- (-1292.045) (-1298.586) [-1293.614] (-1293.158) * (-1296.259) (-1293.108) [-1294.597] (-1292.791) -- 0:00:13
798500 -- (-1292.966) (-1296.243) (-1294.775) [-1292.331] * [-1293.509] (-1291.945) (-1292.553) (-1292.382) -- 0:00:13
799000 -- (-1293.356) (-1295.149) [-1292.246] (-1293.142) * (-1296.830) (-1292.966) [-1291.708] (-1295.360) -- 0:00:13
799500 -- (-1293.537) (-1299.003) (-1295.767) [-1294.079] * (-1292.549) [-1293.198] (-1291.708) (-1294.950) -- 0:00:13
800000 -- [-1292.141] (-1293.421) (-1292.856) (-1292.204) * (-1295.975) [-1293.671] (-1295.002) (-1297.834) -- 0:00:13
Average standard deviation of split frequencies: 0.010286
800500 -- [-1293.440] (-1294.120) (-1294.238) (-1292.071) * (-1294.198) [-1291.994] (-1295.977) (-1292.542) -- 0:00:13
801000 -- [-1294.077] (-1294.082) (-1296.101) (-1292.075) * (-1293.326) (-1295.853) (-1298.882) [-1293.672] -- 0:00:13
801500 -- [-1294.401] (-1293.691) (-1291.270) (-1296.576) * (-1294.253) (-1294.632) [-1293.266] (-1294.712) -- 0:00:13
802000 -- (-1293.823) (-1294.255) [-1294.592] (-1302.425) * (-1294.860) [-1295.709] (-1292.909) (-1294.265) -- 0:00:13
802500 -- (-1297.706) (-1293.651) (-1292.510) [-1300.792] * [-1292.096] (-1294.524) (-1296.481) (-1294.928) -- 0:00:13
803000 -- (-1294.011) [-1295.436] (-1292.083) (-1296.624) * (-1295.367) (-1294.966) (-1291.768) [-1292.500] -- 0:00:13
803500 -- (-1293.638) (-1296.369) [-1291.673] (-1297.721) * [-1291.727] (-1295.163) (-1292.308) (-1292.298) -- 0:00:13
804000 -- (-1297.506) (-1294.573) [-1291.239] (-1295.527) * (-1293.048) (-1295.740) [-1291.574] (-1294.871) -- 0:00:13
804500 -- (-1295.346) (-1297.240) (-1291.716) [-1295.206] * (-1294.016) [-1293.947] (-1294.178) (-1292.486) -- 0:00:13
805000 -- (-1293.901) [-1293.207] (-1295.666) (-1294.921) * (-1294.536) (-1293.212) [-1293.377] (-1294.704) -- 0:00:13
Average standard deviation of split frequencies: 0.010115
805500 -- [-1293.152] (-1294.925) (-1293.434) (-1295.413) * (-1296.154) (-1295.601) [-1295.119] (-1295.117) -- 0:00:13
806000 -- (-1291.867) (-1294.598) (-1296.061) [-1291.698] * (-1294.022) (-1291.694) (-1294.737) [-1296.631] -- 0:00:13
806500 -- (-1292.219) (-1296.311) [-1294.586] (-1292.175) * (-1295.738) (-1293.067) (-1296.201) [-1299.373] -- 0:00:13
807000 -- (-1293.485) [-1293.666] (-1296.046) (-1292.328) * [-1298.089] (-1295.149) (-1294.173) (-1292.463) -- 0:00:13
807500 -- (-1293.488) (-1293.995) (-1291.381) [-1296.627] * (-1292.252) (-1298.510) (-1293.185) [-1291.783] -- 0:00:13
808000 -- (-1291.839) [-1293.484] (-1298.922) (-1296.512) * (-1293.029) (-1294.951) [-1294.739] (-1294.445) -- 0:00:13
808500 -- [-1291.572] (-1294.947) (-1293.434) (-1295.586) * [-1294.177] (-1293.295) (-1294.645) (-1296.210) -- 0:00:13
809000 -- (-1294.179) (-1295.621) (-1291.929) [-1293.795] * (-1292.090) (-1294.214) [-1292.393] (-1294.276) -- 0:00:13
809500 -- (-1294.577) (-1294.014) [-1296.015] (-1294.270) * (-1292.235) (-1292.836) [-1292.910] (-1296.622) -- 0:00:13
810000 -- [-1294.018] (-1294.060) (-1297.326) (-1297.457) * (-1293.880) (-1292.353) (-1292.463) [-1297.258] -- 0:00:13
Average standard deviation of split frequencies: 0.010125
810500 -- (-1293.869) [-1295.102] (-1294.096) (-1295.901) * (-1295.320) (-1293.390) (-1292.152) [-1297.217] -- 0:00:13
811000 -- [-1293.483] (-1292.457) (-1294.347) (-1291.368) * (-1293.740) (-1292.904) (-1292.467) [-1292.252] -- 0:00:13
811500 -- (-1294.016) (-1292.232) (-1292.799) [-1292.873] * [-1297.648] (-1292.808) (-1291.861) (-1292.461) -- 0:00:13
812000 -- (-1294.063) (-1296.310) (-1293.062) [-1294.998] * [-1294.769] (-1295.496) (-1292.424) (-1292.916) -- 0:00:12
812500 -- (-1292.092) (-1293.652) [-1295.341] (-1294.522) * (-1296.380) (-1291.431) (-1292.125) [-1294.204] -- 0:00:12
813000 -- (-1293.948) (-1292.217) [-1292.749] (-1293.016) * [-1295.986] (-1294.228) (-1292.168) (-1291.917) -- 0:00:12
813500 -- (-1294.388) [-1291.267] (-1295.905) (-1293.624) * (-1294.309) (-1295.067) (-1293.763) [-1292.087] -- 0:00:12
814000 -- (-1294.295) (-1292.457) [-1293.622] (-1293.355) * [-1292.486] (-1292.025) (-1293.270) (-1292.640) -- 0:00:12
814500 -- (-1293.285) (-1294.815) (-1295.046) [-1293.278] * (-1292.416) (-1293.859) (-1293.327) [-1293.190] -- 0:00:12
815000 -- [-1292.003] (-1291.450) (-1297.354) (-1292.388) * [-1292.319] (-1293.701) (-1292.495) (-1293.084) -- 0:00:12
Average standard deviation of split frequencies: 0.009889
815500 -- (-1294.842) [-1291.968] (-1296.359) (-1291.200) * (-1297.365) [-1294.679] (-1293.058) (-1292.128) -- 0:00:12
816000 -- (-1293.232) (-1291.494) (-1291.990) [-1294.388] * (-1296.300) (-1296.465) (-1296.143) [-1294.504] -- 0:00:12
816500 -- (-1292.200) [-1293.675] (-1291.551) (-1292.650) * (-1292.214) (-1295.894) (-1293.357) [-1292.631] -- 0:00:12
817000 -- [-1291.721] (-1293.952) (-1293.091) (-1292.430) * (-1291.998) [-1292.951] (-1294.140) (-1295.655) -- 0:00:12
817500 -- (-1294.819) (-1295.176) [-1292.825] (-1293.272) * (-1294.963) [-1292.174] (-1296.170) (-1291.773) -- 0:00:12
818000 -- (-1294.465) (-1294.337) [-1294.934] (-1293.026) * (-1295.093) (-1292.513) (-1292.110) [-1291.626] -- 0:00:12
818500 -- (-1292.170) (-1292.849) [-1294.323] (-1293.575) * (-1291.438) (-1296.180) [-1292.207] (-1291.481) -- 0:00:12
819000 -- (-1292.887) (-1294.786) (-1293.381) [-1296.145] * (-1292.415) (-1293.451) (-1292.829) [-1293.217] -- 0:00:12
819500 -- [-1291.849] (-1292.242) (-1301.091) (-1296.058) * (-1293.681) (-1294.517) [-1297.068] (-1296.874) -- 0:00:12
820000 -- [-1292.261] (-1293.394) (-1295.663) (-1293.730) * (-1295.673) (-1296.250) (-1295.546) [-1295.476] -- 0:00:12
Average standard deviation of split frequencies: 0.009934
820500 -- [-1293.404] (-1294.432) (-1292.683) (-1293.435) * (-1293.067) [-1292.869] (-1294.903) (-1293.289) -- 0:00:12
821000 -- (-1293.262) [-1294.986] (-1292.039) (-1293.356) * (-1291.803) (-1292.815) [-1292.300] (-1292.900) -- 0:00:12
821500 -- (-1294.152) [-1292.036] (-1293.980) (-1294.757) * (-1293.763) (-1292.236) (-1291.963) [-1293.458] -- 0:00:12
822000 -- [-1294.799] (-1294.188) (-1296.053) (-1291.335) * [-1294.282] (-1296.038) (-1292.285) (-1294.992) -- 0:00:12
822500 -- [-1295.445] (-1291.826) (-1294.435) (-1293.741) * (-1296.958) (-1296.796) [-1293.087] (-1293.740) -- 0:00:12
823000 -- [-1298.902] (-1291.793) (-1291.715) (-1291.766) * (-1292.739) [-1297.028] (-1291.977) (-1292.197) -- 0:00:12
823500 -- (-1292.709) (-1291.860) (-1292.343) [-1295.686] * (-1293.599) [-1293.113] (-1291.833) (-1293.225) -- 0:00:12
824000 -- (-1291.479) (-1292.843) [-1292.352] (-1294.135) * (-1291.959) [-1294.166] (-1292.940) (-1294.027) -- 0:00:12
824500 -- (-1293.494) [-1293.318] (-1291.182) (-1296.476) * [-1292.099] (-1294.627) (-1293.047) (-1292.975) -- 0:00:12
825000 -- (-1292.683) (-1293.023) [-1291.668] (-1293.520) * (-1294.248) [-1292.307] (-1293.500) (-1293.345) -- 0:00:12
Average standard deviation of split frequencies: 0.009870
825500 -- (-1293.667) [-1292.039] (-1294.793) (-1295.201) * (-1293.091) (-1293.578) [-1295.422] (-1293.698) -- 0:00:12
826000 -- (-1294.280) [-1292.697] (-1292.799) (-1291.104) * (-1295.337) (-1293.667) (-1293.152) [-1292.011] -- 0:00:12
826500 -- (-1295.303) (-1293.114) [-1292.228] (-1292.948) * [-1293.519] (-1292.648) (-1296.558) (-1293.014) -- 0:00:11
827000 -- (-1293.786) [-1294.362] (-1293.138) (-1292.698) * (-1293.656) (-1292.637) [-1294.741] (-1295.631) -- 0:00:11
827500 -- (-1291.996) (-1297.833) [-1291.539] (-1291.459) * [-1292.965] (-1292.215) (-1291.890) (-1293.533) -- 0:00:11
828000 -- (-1295.140) (-1293.902) (-1296.859) [-1293.768] * (-1292.098) [-1293.969] (-1294.546) (-1293.838) -- 0:00:11
828500 -- (-1293.231) [-1293.656] (-1292.193) (-1293.687) * (-1292.627) [-1294.745] (-1293.183) (-1292.233) -- 0:00:11
829000 -- (-1292.654) (-1295.090) [-1293.463] (-1295.935) * (-1293.050) (-1293.592) (-1293.700) [-1292.980] -- 0:00:11
829500 -- (-1298.786) (-1297.300) [-1294.209] (-1292.733) * (-1294.182) (-1293.244) [-1294.047] (-1293.006) -- 0:00:11
830000 -- [-1294.817] (-1296.983) (-1292.896) (-1292.153) * (-1294.029) (-1291.625) (-1293.213) [-1294.423] -- 0:00:11
Average standard deviation of split frequencies: 0.010048
830500 -- (-1292.511) (-1293.443) (-1295.401) [-1291.985] * [-1295.602] (-1294.900) (-1293.211) (-1294.780) -- 0:00:11
831000 -- (-1292.415) (-1292.580) [-1292.268] (-1291.539) * (-1293.987) (-1295.318) [-1291.729] (-1293.853) -- 0:00:11
831500 -- (-1294.221) (-1293.857) [-1292.082] (-1293.017) * (-1300.374) (-1293.013) [-1292.503] (-1293.048) -- 0:00:11
832000 -- (-1293.950) (-1295.100) (-1296.610) [-1294.560] * (-1295.192) [-1294.222] (-1292.402) (-1293.413) -- 0:00:11
832500 -- (-1292.876) (-1294.878) (-1295.291) [-1292.181] * (-1294.302) (-1292.936) [-1302.278] (-1293.618) -- 0:00:11
833000 -- (-1293.206) (-1292.236) [-1294.853] (-1294.219) * [-1291.911] (-1292.241) (-1302.692) (-1298.488) -- 0:00:11
833500 -- (-1297.608) (-1293.997) (-1293.875) [-1293.874] * [-1293.205] (-1292.312) (-1302.071) (-1294.077) -- 0:00:11
834000 -- (-1294.507) (-1292.226) [-1293.135] (-1295.287) * (-1292.488) (-1292.249) (-1297.984) [-1293.062] -- 0:00:11
834500 -- (-1294.007) [-1293.796] (-1294.452) (-1295.679) * (-1292.689) (-1294.247) (-1293.004) [-1294.000] -- 0:00:11
835000 -- (-1291.800) [-1292.736] (-1293.452) (-1296.686) * (-1292.650) (-1295.710) [-1293.071] (-1292.424) -- 0:00:11
Average standard deviation of split frequencies: 0.009785
835500 -- (-1291.248) (-1294.533) (-1295.265) [-1292.557] * [-1292.675] (-1292.941) (-1293.108) (-1296.917) -- 0:00:11
836000 -- (-1291.252) (-1294.498) [-1295.245] (-1292.921) * (-1295.670) (-1295.731) (-1295.249) [-1296.259] -- 0:00:11
836500 -- (-1294.185) (-1295.308) (-1296.719) [-1292.806] * (-1296.959) (-1294.346) (-1292.281) [-1295.311] -- 0:00:11
837000 -- (-1292.829) [-1293.209] (-1295.160) (-1291.194) * (-1294.288) [-1293.778] (-1293.127) (-1295.924) -- 0:00:11
837500 -- (-1294.999) (-1294.603) (-1291.901) [-1291.616] * (-1291.985) (-1295.515) [-1291.948] (-1296.168) -- 0:00:11
838000 -- [-1292.181] (-1294.434) (-1292.697) (-1293.726) * (-1291.971) [-1293.662] (-1291.660) (-1292.021) -- 0:00:11
838500 -- [-1299.420] (-1296.138) (-1291.262) (-1293.119) * (-1293.289) (-1294.205) (-1293.877) [-1295.844] -- 0:00:11
839000 -- (-1291.829) (-1294.926) (-1292.048) [-1292.339] * (-1293.135) [-1293.913] (-1292.781) (-1293.613) -- 0:00:11
839500 -- (-1292.056) (-1295.838) [-1293.517] (-1291.640) * [-1292.631] (-1298.234) (-1292.711) (-1294.794) -- 0:00:11
840000 -- (-1295.287) [-1293.136] (-1297.466) (-1291.739) * (-1292.737) [-1295.709] (-1292.001) (-1295.295) -- 0:00:11
Average standard deviation of split frequencies: 0.009498
840500 -- (-1292.596) (-1291.991) [-1296.087] (-1293.597) * (-1292.109) [-1293.485] (-1293.487) (-1291.941) -- 0:00:11
841000 -- (-1292.392) (-1295.563) [-1293.917] (-1295.853) * (-1293.515) (-1294.089) (-1295.264) [-1292.209] -- 0:00:10
841500 -- (-1291.650) (-1296.244) [-1293.369] (-1296.274) * (-1300.859) [-1293.338] (-1294.856) (-1292.173) -- 0:00:10
842000 -- (-1291.705) (-1295.010) (-1292.828) [-1294.511] * [-1294.481] (-1295.840) (-1294.538) (-1292.836) -- 0:00:10
842500 -- [-1291.954] (-1291.959) (-1296.036) (-1292.854) * (-1291.353) [-1293.172] (-1296.434) (-1293.329) -- 0:00:10
843000 -- (-1291.321) [-1292.308] (-1296.276) (-1293.450) * (-1291.661) (-1293.035) (-1293.352) [-1292.254] -- 0:00:10
843500 -- (-1292.598) (-1291.775) [-1293.698] (-1291.964) * (-1291.609) [-1292.579] (-1292.748) (-1292.230) -- 0:00:10
844000 -- (-1291.770) (-1292.939) [-1296.892] (-1292.959) * [-1293.168] (-1295.952) (-1292.274) (-1292.111) -- 0:00:10
844500 -- (-1292.696) (-1292.978) (-1296.502) [-1293.498] * [-1292.338] (-1295.782) (-1294.313) (-1293.977) -- 0:00:10
845000 -- (-1292.264) [-1293.028] (-1295.229) (-1296.336) * (-1295.215) (-1294.571) (-1292.648) [-1291.863] -- 0:00:10
Average standard deviation of split frequencies: 0.010128
845500 -- (-1292.121) [-1293.645] (-1296.124) (-1293.798) * [-1294.134] (-1296.961) (-1294.201) (-1291.692) -- 0:00:10
846000 -- [-1291.596] (-1294.240) (-1295.595) (-1293.772) * (-1293.901) [-1294.248] (-1293.046) (-1292.366) -- 0:00:10
846500 -- (-1292.924) [-1293.330] (-1295.407) (-1295.721) * (-1293.372) (-1294.029) [-1292.901] (-1291.898) -- 0:00:10
847000 -- (-1292.787) [-1292.814] (-1294.620) (-1292.088) * [-1291.732] (-1296.957) (-1293.914) (-1292.889) -- 0:00:10
847500 -- (-1292.163) (-1295.418) (-1294.079) [-1291.803] * (-1294.018) (-1298.614) [-1293.520] (-1291.662) -- 0:00:10
848000 -- (-1295.800) [-1291.953] (-1294.489) (-1292.903) * (-1292.953) (-1294.442) [-1295.833] (-1292.043) -- 0:00:10
848500 -- (-1293.146) [-1291.736] (-1295.275) (-1295.808) * (-1294.480) [-1292.403] (-1294.925) (-1293.026) -- 0:00:10
849000 -- (-1293.294) [-1294.031] (-1292.697) (-1291.844) * (-1293.635) (-1292.288) (-1295.651) [-1292.020] -- 0:00:10
849500 -- (-1294.172) [-1298.943] (-1293.286) (-1293.114) * (-1294.554) (-1294.234) (-1292.446) [-1291.530] -- 0:00:10
850000 -- (-1294.266) (-1292.633) (-1293.169) [-1291.282] * (-1297.154) [-1294.967] (-1294.499) (-1291.693) -- 0:00:10
Average standard deviation of split frequencies: 0.009942
850500 -- (-1295.082) [-1292.878] (-1292.881) (-1291.375) * [-1296.414] (-1294.071) (-1292.450) (-1292.002) -- 0:00:10
851000 -- (-1296.759) (-1295.400) (-1293.162) [-1292.786] * (-1297.267) (-1292.976) (-1295.084) [-1297.924] -- 0:00:10
851500 -- (-1295.139) (-1295.482) [-1291.689] (-1291.619) * (-1296.658) [-1291.519] (-1291.323) (-1293.551) -- 0:00:10
852000 -- (-1298.695) (-1296.498) [-1291.732] (-1293.095) * (-1292.031) (-1291.814) (-1292.266) [-1294.571] -- 0:00:10
852500 -- (-1296.698) (-1295.408) (-1292.663) [-1293.103] * (-1296.213) (-1292.724) [-1293.421] (-1291.790) -- 0:00:10
853000 -- (-1295.314) (-1293.994) (-1291.523) [-1296.041] * (-1294.270) [-1292.247] (-1294.221) (-1293.185) -- 0:00:10
853500 -- (-1292.320) (-1292.690) [-1292.904] (-1295.699) * [-1295.200] (-1292.153) (-1295.459) (-1293.489) -- 0:00:10
854000 -- (-1291.214) (-1292.256) (-1293.718) [-1294.843] * (-1300.592) (-1293.584) [-1295.426] (-1292.029) -- 0:00:10
854500 -- (-1293.460) [-1292.474] (-1293.233) (-1294.918) * (-1293.215) (-1291.965) [-1295.649] (-1300.747) -- 0:00:10
855000 -- (-1293.466) [-1292.806] (-1293.362) (-1297.761) * (-1293.109) (-1294.255) [-1292.001] (-1295.309) -- 0:00:10
Average standard deviation of split frequencies: 0.010237
855500 -- [-1291.676] (-1297.576) (-1292.168) (-1293.624) * (-1292.705) [-1292.491] (-1292.358) (-1291.695) -- 0:00:09
856000 -- (-1291.350) (-1296.718) [-1292.532] (-1297.337) * (-1291.921) [-1294.145] (-1292.900) (-1292.562) -- 0:00:09
856500 -- [-1292.357] (-1292.419) (-1292.548) (-1292.727) * (-1292.032) [-1294.156] (-1292.305) (-1293.440) -- 0:00:09
857000 -- (-1292.753) (-1291.941) [-1293.886] (-1294.618) * (-1295.311) (-1293.253) (-1292.039) [-1292.163] -- 0:00:09
857500 -- (-1293.463) [-1292.269] (-1293.442) (-1293.418) * (-1293.601) (-1293.345) [-1292.717] (-1292.948) -- 0:00:09
858000 -- (-1294.050) [-1292.334] (-1293.987) (-1292.827) * (-1295.219) (-1291.288) [-1292.757] (-1292.847) -- 0:00:09
858500 -- (-1291.818) (-1293.459) [-1294.367] (-1302.769) * (-1292.191) (-1295.815) (-1295.042) [-1291.547] -- 0:00:09
859000 -- (-1295.628) (-1292.225) [-1295.540] (-1301.063) * [-1293.647] (-1292.952) (-1291.954) (-1292.995) -- 0:00:09
859500 -- (-1297.105) (-1296.133) (-1295.590) [-1292.366] * (-1293.689) [-1298.051] (-1292.792) (-1293.499) -- 0:00:09
860000 -- (-1292.658) (-1295.357) (-1295.148) [-1292.881] * (-1296.165) [-1298.681] (-1295.195) (-1292.897) -- 0:00:09
Average standard deviation of split frequencies: 0.010374
860500 -- [-1293.155] (-1294.916) (-1292.715) (-1292.383) * (-1292.475) (-1295.323) (-1294.684) [-1293.057] -- 0:00:09
861000 -- (-1293.332) (-1293.326) [-1292.401] (-1291.869) * (-1294.337) [-1293.680] (-1296.498) (-1296.226) -- 0:00:09
861500 -- (-1293.393) (-1294.485) [-1293.476] (-1291.785) * (-1293.231) [-1293.516] (-1294.141) (-1294.810) -- 0:00:09
862000 -- (-1294.973) (-1293.895) (-1297.273) [-1294.221] * (-1295.104) [-1292.160] (-1296.108) (-1292.177) -- 0:00:09
862500 -- (-1294.454) [-1292.168] (-1293.093) (-1293.802) * [-1293.956] (-1294.429) (-1294.174) (-1293.481) -- 0:00:09
863000 -- [-1296.279] (-1293.397) (-1293.570) (-1292.510) * (-1291.647) [-1293.456] (-1291.821) (-1298.555) -- 0:00:09
863500 -- (-1297.542) (-1293.359) (-1293.371) [-1293.457] * (-1291.447) (-1293.259) (-1292.596) [-1294.464] -- 0:00:09
864000 -- [-1294.183] (-1291.516) (-1292.330) (-1292.196) * (-1295.054) (-1292.610) [-1292.265] (-1299.299) -- 0:00:09
864500 -- (-1293.185) (-1292.939) (-1292.081) [-1292.528] * [-1292.379] (-1293.338) (-1294.334) (-1296.335) -- 0:00:09
865000 -- [-1291.451] (-1293.182) (-1292.422) (-1296.208) * (-1292.331) [-1293.061] (-1294.655) (-1295.810) -- 0:00:09
Average standard deviation of split frequencies: 0.010759
865500 -- (-1291.787) (-1293.176) [-1292.413] (-1293.387) * (-1300.180) [-1292.399] (-1294.044) (-1293.277) -- 0:00:09
866000 -- (-1292.323) (-1293.813) (-1292.514) [-1294.322] * (-1293.767) (-1294.703) [-1295.204] (-1293.982) -- 0:00:09
866500 -- (-1292.808) (-1295.910) (-1292.412) [-1292.125] * (-1298.209) (-1293.961) [-1292.353] (-1293.502) -- 0:00:09
867000 -- [-1293.345] (-1292.695) (-1292.129) (-1292.535) * (-1299.260) (-1294.580) (-1292.100) [-1293.463] -- 0:00:09
867500 -- (-1294.131) (-1292.418) (-1296.047) [-1292.086] * (-1295.617) (-1291.958) (-1292.344) [-1293.273] -- 0:00:09
868000 -- (-1292.433) (-1291.756) [-1293.282] (-1292.729) * (-1291.996) (-1294.263) (-1293.752) [-1291.803] -- 0:00:09
868500 -- (-1293.664) (-1292.910) [-1291.619] (-1295.316) * (-1293.690) (-1294.234) [-1295.399] (-1299.522) -- 0:00:09
869000 -- (-1292.160) (-1293.100) [-1293.034] (-1292.792) * (-1293.087) (-1294.582) [-1293.875] (-1297.757) -- 0:00:09
869500 -- [-1294.168] (-1293.775) (-1291.993) (-1292.455) * (-1291.361) [-1292.574] (-1292.524) (-1295.594) -- 0:00:09
870000 -- (-1292.607) (-1296.701) [-1292.590] (-1295.165) * (-1291.476) (-1293.565) (-1293.219) [-1292.685] -- 0:00:08
Average standard deviation of split frequencies: 0.010542
870500 -- (-1295.177) (-1292.149) (-1298.354) [-1295.827] * (-1292.923) (-1293.312) [-1294.231] (-1294.213) -- 0:00:08
871000 -- (-1294.607) (-1299.045) (-1297.560) [-1295.355] * (-1294.122) (-1293.265) [-1295.344] (-1295.564) -- 0:00:08
871500 -- (-1291.415) (-1293.006) (-1292.375) [-1294.362] * (-1297.987) [-1293.876] (-1295.152) (-1294.548) -- 0:00:08
872000 -- (-1292.252) [-1293.322] (-1296.322) (-1292.300) * (-1294.500) (-1294.108) [-1294.114] (-1294.960) -- 0:00:08
872500 -- [-1293.291] (-1294.563) (-1291.892) (-1293.987) * [-1296.346] (-1295.658) (-1295.540) (-1292.639) -- 0:00:08
873000 -- (-1292.584) (-1293.433) [-1294.101] (-1295.007) * (-1291.938) (-1294.723) [-1294.990] (-1292.382) -- 0:00:08
873500 -- (-1294.576) (-1291.640) (-1292.948) [-1295.475] * (-1291.699) (-1296.300) [-1293.158] (-1292.611) -- 0:00:08
874000 -- (-1293.733) [-1293.294] (-1294.409) (-1293.986) * (-1294.905) (-1292.447) [-1294.342] (-1295.082) -- 0:00:08
874500 -- (-1294.401) [-1292.682] (-1294.158) (-1293.917) * (-1297.466) [-1292.178] (-1300.573) (-1295.879) -- 0:00:08
875000 -- (-1300.772) (-1292.366) [-1291.753] (-1295.079) * [-1291.916] (-1292.692) (-1292.206) (-1292.612) -- 0:00:08
Average standard deviation of split frequencies: 0.009750
875500 -- (-1296.936) (-1298.106) [-1292.099] (-1293.256) * (-1292.043) [-1293.561] (-1293.439) (-1295.885) -- 0:00:08
876000 -- (-1295.308) (-1294.880) (-1293.736) [-1292.961] * (-1292.656) [-1292.243] (-1293.897) (-1291.619) -- 0:00:08
876500 -- (-1295.551) (-1296.498) [-1292.499] (-1292.602) * (-1294.119) [-1291.823] (-1293.963) (-1293.494) -- 0:00:08
877000 -- (-1294.112) (-1293.036) [-1293.006] (-1298.515) * (-1294.147) [-1295.297] (-1292.006) (-1296.935) -- 0:00:08
877500 -- (-1295.403) [-1291.687] (-1295.637) (-1292.885) * (-1293.477) (-1295.246) (-1293.192) [-1298.524] -- 0:00:08
878000 -- [-1295.635] (-1292.702) (-1296.175) (-1292.761) * [-1291.681] (-1296.581) (-1294.929) (-1292.805) -- 0:00:08
878500 -- (-1292.474) (-1296.244) [-1293.253] (-1293.288) * (-1292.042) (-1293.606) (-1296.165) [-1295.431] -- 0:00:08
879000 -- (-1293.367) (-1295.410) (-1292.447) [-1293.578] * (-1292.473) [-1291.438] (-1295.062) (-1296.157) -- 0:00:08
879500 -- (-1295.603) [-1294.675] (-1292.458) (-1294.780) * [-1294.728] (-1293.509) (-1294.206) (-1291.977) -- 0:00:08
880000 -- (-1292.674) [-1295.241] (-1292.436) (-1294.384) * (-1294.732) (-1292.425) (-1292.037) [-1293.435] -- 0:00:08
Average standard deviation of split frequencies: 0.009761
880500 -- (-1292.823) (-1292.674) (-1292.076) [-1293.582] * (-1295.340) (-1296.432) (-1293.485) [-1293.715] -- 0:00:08
881000 -- (-1293.277) (-1293.458) (-1298.021) [-1293.981] * (-1292.545) (-1295.189) [-1294.455] (-1292.390) -- 0:00:08
881500 -- (-1296.074) (-1292.412) [-1296.421] (-1291.955) * (-1293.479) (-1293.261) [-1294.096] (-1293.596) -- 0:00:08
882000 -- (-1295.273) [-1292.283] (-1296.394) (-1292.764) * (-1292.903) [-1294.040] (-1293.981) (-1294.102) -- 0:00:08
882500 -- (-1291.944) (-1295.663) [-1295.467] (-1293.809) * (-1292.422) (-1292.641) (-1292.782) [-1293.319] -- 0:00:08
883000 -- (-1293.022) (-1295.261) [-1292.985] (-1295.219) * (-1292.430) [-1292.933] (-1292.942) (-1292.488) -- 0:00:08
883500 -- [-1294.528] (-1292.150) (-1294.521) (-1293.213) * (-1293.112) (-1292.108) [-1293.513] (-1293.540) -- 0:00:08
884000 -- [-1294.743] (-1297.118) (-1295.199) (-1293.986) * (-1294.385) (-1293.977) (-1292.791) [-1293.962] -- 0:00:08
884500 -- (-1293.241) (-1297.686) (-1297.161) [-1292.394] * [-1291.515] (-1293.479) (-1292.928) (-1293.215) -- 0:00:07
885000 -- (-1293.263) (-1292.164) (-1296.352) [-1292.387] * (-1295.339) (-1292.304) [-1294.469] (-1291.723) -- 0:00:07
Average standard deviation of split frequencies: 0.010015
885500 -- (-1292.650) [-1291.764] (-1294.027) (-1292.730) * [-1292.287] (-1293.637) (-1295.220) (-1293.529) -- 0:00:07
886000 -- (-1293.183) (-1291.546) (-1292.614) [-1292.524] * (-1291.860) [-1293.019] (-1295.193) (-1293.654) -- 0:00:07
886500 -- [-1292.337] (-1291.934) (-1292.171) (-1294.176) * (-1292.867) (-1294.047) [-1294.322] (-1294.580) -- 0:00:07
887000 -- [-1293.440] (-1292.246) (-1293.579) (-1294.203) * (-1293.498) (-1296.508) [-1293.867] (-1293.436) -- 0:00:07
887500 -- (-1294.395) [-1292.103] (-1292.975) (-1293.495) * (-1293.485) (-1294.840) (-1294.152) [-1292.337] -- 0:00:07
888000 -- (-1291.950) (-1293.334) (-1293.287) [-1294.119] * [-1292.363] (-1293.075) (-1291.855) (-1292.164) -- 0:00:07
888500 -- [-1291.917] (-1295.736) (-1292.894) (-1293.137) * (-1292.777) (-1291.966) (-1297.051) [-1291.724] -- 0:00:07
889000 -- (-1297.135) [-1293.339] (-1295.463) (-1297.652) * (-1292.279) [-1291.675] (-1296.226) (-1292.875) -- 0:00:07
889500 -- (-1295.186) (-1292.658) [-1292.087] (-1300.063) * [-1293.015] (-1293.719) (-1294.523) (-1293.811) -- 0:00:07
890000 -- [-1293.549] (-1293.909) (-1293.823) (-1298.761) * (-1295.444) (-1293.070) (-1294.688) [-1297.974] -- 0:00:07
Average standard deviation of split frequencies: 0.009932
890500 -- (-1294.170) (-1298.774) [-1292.045] (-1293.536) * (-1293.792) (-1295.884) [-1292.097] (-1291.857) -- 0:00:07
891000 -- (-1299.696) (-1293.857) [-1292.093] (-1292.443) * (-1293.718) (-1292.735) [-1292.245] (-1292.051) -- 0:00:07
891500 -- [-1294.480] (-1294.151) (-1291.170) (-1293.857) * (-1293.119) [-1292.702] (-1296.313) (-1292.926) -- 0:00:07
892000 -- [-1292.558] (-1292.394) (-1291.884) (-1292.957) * (-1293.602) (-1293.640) [-1293.907] (-1293.053) -- 0:00:07
892500 -- (-1298.187) (-1292.911) (-1291.384) [-1293.879] * (-1296.234) (-1295.465) (-1292.417) [-1294.193] -- 0:00:07
893000 -- (-1294.097) [-1292.383] (-1291.384) (-1296.683) * (-1296.174) (-1295.508) [-1293.582] (-1292.609) -- 0:00:07
893500 -- (-1293.654) (-1295.554) (-1291.958) [-1293.798] * (-1297.617) [-1295.513] (-1293.297) (-1293.811) -- 0:00:07
894000 -- (-1293.403) (-1296.980) [-1295.224] (-1292.268) * (-1292.145) (-1297.022) [-1293.111] (-1293.107) -- 0:00:07
894500 -- [-1293.457] (-1292.675) (-1293.565) (-1296.525) * (-1291.363) (-1293.310) (-1292.142) [-1295.315] -- 0:00:07
895000 -- (-1291.764) (-1293.620) (-1291.778) [-1292.418] * (-1293.158) [-1292.562] (-1292.342) (-1297.796) -- 0:00:07
Average standard deviation of split frequencies: 0.010151
895500 -- (-1291.364) (-1292.944) (-1293.107) [-1293.724] * (-1291.782) (-1293.940) (-1292.119) [-1292.662] -- 0:00:07
896000 -- (-1293.206) [-1291.966] (-1291.833) (-1293.804) * (-1292.071) [-1294.637] (-1292.635) (-1296.747) -- 0:00:07
896500 -- (-1293.923) (-1297.377) [-1299.861] (-1293.025) * (-1292.993) (-1293.393) [-1291.948] (-1294.722) -- 0:00:07
897000 -- [-1291.304] (-1297.469) (-1292.693) (-1291.567) * (-1294.845) (-1295.721) [-1294.402] (-1293.527) -- 0:00:07
897500 -- [-1291.603] (-1296.667) (-1294.157) (-1291.302) * (-1293.859) (-1293.594) [-1292.082] (-1294.136) -- 0:00:07
898000 -- [-1292.564] (-1293.054) (-1291.874) (-1292.761) * [-1293.167] (-1294.678) (-1294.151) (-1291.860) -- 0:00:07
898500 -- (-1291.783) [-1294.856] (-1292.492) (-1294.495) * (-1297.057) (-1296.001) [-1294.184] (-1292.793) -- 0:00:07
899000 -- (-1291.615) (-1293.724) [-1292.074] (-1293.215) * (-1295.175) [-1293.046] (-1293.610) (-1294.313) -- 0:00:06
899500 -- (-1295.047) (-1292.961) (-1291.556) [-1291.847] * (-1298.216) (-1295.149) [-1292.438] (-1293.794) -- 0:00:06
900000 -- [-1292.975] (-1292.544) (-1292.102) (-1293.793) * [-1294.974] (-1298.955) (-1291.888) (-1293.395) -- 0:00:06
Average standard deviation of split frequencies: 0.010191
900500 -- [-1291.953] (-1293.477) (-1291.991) (-1293.546) * (-1297.039) (-1296.494) (-1294.528) [-1295.670] -- 0:00:06
901000 -- (-1296.096) (-1292.434) [-1294.552] (-1293.509) * (-1293.189) (-1292.518) (-1292.246) [-1295.679] -- 0:00:06
901500 -- (-1293.096) [-1296.854] (-1292.094) (-1295.108) * (-1292.867) (-1293.459) [-1292.844] (-1292.475) -- 0:00:06
902000 -- (-1294.466) (-1297.285) (-1292.365) [-1291.865] * (-1293.604) (-1292.099) [-1295.639] (-1292.948) -- 0:00:06
902500 -- (-1291.601) (-1299.529) (-1291.884) [-1291.250] * [-1292.601] (-1292.750) (-1294.615) (-1298.204) -- 0:00:06
903000 -- (-1291.648) (-1291.775) [-1293.702] (-1296.695) * [-1293.840] (-1295.692) (-1293.540) (-1304.634) -- 0:00:06
903500 -- (-1292.676) (-1292.919) [-1293.347] (-1297.012) * (-1295.435) (-1293.767) (-1291.669) [-1294.442] -- 0:00:06
904000 -- (-1293.255) (-1292.862) [-1294.361] (-1295.582) * (-1296.554) (-1293.270) [-1294.193] (-1295.718) -- 0:00:06
904500 -- (-1294.354) (-1293.268) (-1294.708) [-1293.847] * (-1295.984) [-1297.388] (-1292.034) (-1291.801) -- 0:00:06
905000 -- (-1293.498) [-1292.768] (-1294.844) (-1297.559) * (-1294.069) [-1292.235] (-1293.624) (-1293.276) -- 0:00:06
Average standard deviation of split frequencies: 0.010314
905500 -- (-1295.181) (-1293.959) [-1292.671] (-1298.713) * (-1293.309) [-1295.563] (-1293.195) (-1292.075) -- 0:00:06
906000 -- (-1291.988) (-1296.129) [-1293.936] (-1291.981) * (-1294.174) [-1291.685] (-1296.515) (-1293.721) -- 0:00:06
906500 -- (-1292.600) (-1292.851) (-1293.906) [-1292.032] * (-1292.446) (-1292.695) [-1293.818] (-1297.560) -- 0:00:06
907000 -- (-1292.898) (-1295.219) (-1292.364) [-1291.922] * [-1292.881] (-1293.784) (-1293.641) (-1293.459) -- 0:00:06
907500 -- (-1291.861) [-1293.292] (-1294.043) (-1292.375) * [-1291.694] (-1295.436) (-1293.201) (-1292.133) -- 0:00:06
908000 -- (-1292.240) (-1292.458) [-1292.706] (-1291.629) * (-1294.270) (-1295.931) [-1293.608] (-1294.552) -- 0:00:06
908500 -- [-1292.092] (-1293.666) (-1294.469) (-1291.529) * (-1294.726) (-1293.528) [-1293.757] (-1294.869) -- 0:00:06
909000 -- [-1291.493] (-1294.729) (-1294.776) (-1294.782) * (-1296.964) [-1297.069] (-1292.746) (-1292.777) -- 0:00:06
909500 -- [-1293.794] (-1294.996) (-1297.158) (-1292.851) * [-1295.383] (-1292.704) (-1296.015) (-1292.141) -- 0:00:06
910000 -- (-1293.873) [-1293.808] (-1293.362) (-1293.685) * (-1294.481) (-1293.284) [-1298.151] (-1292.728) -- 0:00:06
Average standard deviation of split frequencies: 0.009868
910500 -- (-1293.331) [-1292.557] (-1293.398) (-1292.508) * [-1292.659] (-1292.580) (-1295.328) (-1297.010) -- 0:00:06
911000 -- [-1291.628] (-1293.344) (-1293.467) (-1291.682) * (-1296.899) (-1294.868) [-1293.265] (-1292.639) -- 0:00:06
911500 -- (-1291.825) (-1292.970) (-1294.367) [-1291.447] * (-1291.732) [-1292.753] (-1292.938) (-1291.814) -- 0:00:06
912000 -- (-1291.735) (-1291.412) [-1294.380] (-1292.199) * (-1298.702) [-1294.210] (-1293.964) (-1294.466) -- 0:00:06
912500 -- [-1291.661] (-1293.303) (-1292.908) (-1295.777) * (-1293.868) [-1299.582] (-1292.507) (-1293.401) -- 0:00:06
913000 -- (-1292.189) [-1292.232] (-1298.475) (-1295.383) * [-1291.713] (-1295.401) (-1294.171) (-1298.145) -- 0:00:06
913500 -- (-1292.500) (-1292.672) (-1293.743) [-1295.066] * [-1294.032] (-1295.876) (-1294.750) (-1298.819) -- 0:00:05
914000 -- (-1294.910) (-1293.561) [-1292.851] (-1295.270) * (-1295.617) (-1292.499) [-1298.501] (-1296.206) -- 0:00:06
914500 -- (-1294.214) [-1293.023] (-1291.917) (-1295.880) * [-1292.293] (-1293.490) (-1294.608) (-1291.936) -- 0:00:05
915000 -- (-1294.542) [-1291.757] (-1293.411) (-1293.315) * [-1292.749] (-1296.132) (-1291.918) (-1294.619) -- 0:00:05
Average standard deviation of split frequencies: 0.010232
915500 -- (-1292.325) (-1292.276) (-1296.737) [-1292.313] * (-1295.396) [-1291.960] (-1294.915) (-1295.265) -- 0:00:05
916000 -- (-1293.347) [-1293.174] (-1296.492) (-1292.198) * (-1294.463) (-1294.934) (-1292.478) [-1292.450] -- 0:00:05
916500 -- [-1293.751] (-1293.602) (-1293.998) (-1292.048) * (-1299.931) [-1292.324] (-1292.376) (-1294.576) -- 0:00:05
917000 -- (-1294.220) (-1296.566) (-1294.843) [-1293.910] * (-1294.689) (-1295.513) [-1292.976] (-1293.295) -- 0:00:05
917500 -- (-1295.895) (-1292.575) [-1294.869] (-1294.138) * (-1293.936) (-1294.040) [-1295.860] (-1295.016) -- 0:00:05
918000 -- (-1294.292) (-1292.747) (-1292.497) [-1293.030] * (-1291.554) (-1294.294) [-1293.636] (-1292.787) -- 0:00:05
918500 -- (-1293.660) (-1291.484) [-1294.744] (-1294.682) * (-1293.212) (-1296.185) (-1293.620) [-1291.627] -- 0:00:05
919000 -- [-1293.402] (-1296.498) (-1295.480) (-1294.279) * (-1293.714) (-1292.143) (-1292.092) [-1291.766] -- 0:00:05
919500 -- (-1298.649) (-1293.159) (-1295.374) [-1293.762] * [-1291.809] (-1294.130) (-1292.602) (-1292.245) -- 0:00:05
920000 -- (-1296.863) (-1295.979) (-1292.781) [-1292.901] * [-1291.579] (-1292.491) (-1292.735) (-1293.623) -- 0:00:05
Average standard deviation of split frequencies: 0.010813
920500 -- [-1294.289] (-1294.174) (-1293.235) (-1294.336) * (-1292.663) [-1291.699] (-1294.812) (-1294.065) -- 0:00:05
921000 -- [-1291.372] (-1294.157) (-1293.837) (-1294.503) * (-1293.592) (-1293.229) (-1293.929) [-1292.828] -- 0:00:05
921500 -- [-1293.534] (-1291.640) (-1293.506) (-1292.867) * (-1292.001) [-1293.427] (-1292.211) (-1291.967) -- 0:00:05
922000 -- (-1294.526) [-1291.495] (-1294.447) (-1292.916) * [-1295.809] (-1293.676) (-1294.632) (-1297.137) -- 0:00:05
922500 -- (-1293.188) (-1294.279) [-1296.007] (-1295.363) * (-1293.331) (-1295.622) (-1294.330) [-1295.213] -- 0:00:05
923000 -- (-1291.982) (-1295.386) (-1295.790) [-1293.887] * (-1294.261) (-1292.876) [-1293.470] (-1291.684) -- 0:00:05
923500 -- (-1292.359) [-1295.505] (-1296.777) (-1292.621) * (-1291.818) [-1292.467] (-1292.718) (-1296.363) -- 0:00:05
924000 -- (-1299.507) (-1294.790) (-1297.964) [-1294.858] * (-1293.033) [-1291.852] (-1297.326) (-1296.904) -- 0:00:05
924500 -- (-1297.624) (-1295.830) (-1293.405) [-1294.208] * [-1296.071] (-1296.497) (-1293.702) (-1297.208) -- 0:00:05
925000 -- (-1293.231) [-1293.555] (-1292.711) (-1293.610) * (-1293.983) [-1296.826] (-1294.866) (-1293.554) -- 0:00:05
Average standard deviation of split frequencies: 0.010870
925500 -- (-1293.645) [-1296.224] (-1295.019) (-1297.646) * (-1294.533) (-1293.207) [-1293.173] (-1293.485) -- 0:00:05
926000 -- (-1297.776) [-1292.979] (-1294.924) (-1295.336) * (-1293.815) [-1295.673] (-1291.458) (-1295.886) -- 0:00:05
926500 -- (-1293.603) (-1293.366) [-1294.931] (-1292.669) * [-1293.819] (-1295.578) (-1294.058) (-1295.557) -- 0:00:05
927000 -- (-1292.453) [-1292.111] (-1293.708) (-1298.148) * (-1293.822) (-1296.817) [-1295.425] (-1295.319) -- 0:00:05
927500 -- (-1297.584) [-1293.854] (-1294.226) (-1294.296) * (-1297.732) (-1293.826) [-1292.127] (-1293.697) -- 0:00:05
928000 -- (-1293.293) [-1292.800] (-1294.064) (-1291.644) * [-1291.945] (-1292.429) (-1291.144) (-1294.439) -- 0:00:05
928500 -- [-1293.805] (-1295.567) (-1292.527) (-1292.217) * [-1294.492] (-1297.620) (-1294.536) (-1295.689) -- 0:00:05
929000 -- (-1291.437) (-1293.527) (-1293.287) [-1296.153] * (-1292.853) [-1293.581] (-1292.538) (-1294.909) -- 0:00:04
929500 -- (-1291.931) (-1292.597) (-1295.241) [-1295.019] * (-1296.465) (-1294.589) [-1292.566] (-1298.608) -- 0:00:04
930000 -- [-1294.338] (-1294.744) (-1293.131) (-1295.129) * (-1293.619) (-1294.133) (-1295.969) [-1298.165] -- 0:00:04
Average standard deviation of split frequencies: 0.010905
930500 -- (-1299.962) [-1294.659] (-1295.485) (-1294.064) * (-1292.392) [-1294.903] (-1296.495) (-1293.932) -- 0:00:04
931000 -- (-1293.640) [-1293.395] (-1293.398) (-1292.603) * (-1292.351) (-1293.066) (-1292.944) [-1292.439] -- 0:00:04
931500 -- (-1295.594) [-1292.951] (-1295.373) (-1292.217) * [-1291.268] (-1291.886) (-1295.659) (-1293.505) -- 0:00:04
932000 -- (-1291.635) [-1292.084] (-1292.766) (-1293.044) * (-1292.469) (-1294.563) (-1293.529) [-1293.905] -- 0:00:04
932500 -- (-1291.478) (-1293.662) (-1292.951) [-1293.420] * (-1293.607) (-1295.031) [-1291.327] (-1295.358) -- 0:00:04
933000 -- (-1291.826) (-1296.985) (-1292.124) [-1293.061] * (-1293.414) (-1291.816) (-1292.433) [-1294.924] -- 0:00:04
933500 -- [-1291.778] (-1292.244) (-1291.555) (-1296.597) * (-1297.455) (-1292.787) (-1292.652) [-1292.663] -- 0:00:04
934000 -- (-1292.310) (-1292.155) [-1291.457] (-1293.135) * (-1292.610) (-1292.575) [-1292.655] (-1293.332) -- 0:00:04
934500 -- (-1291.840) [-1292.883] (-1296.863) (-1291.625) * (-1292.751) [-1292.384] (-1293.970) (-1296.253) -- 0:00:04
935000 -- [-1291.991] (-1294.992) (-1293.092) (-1293.322) * (-1293.607) (-1295.444) (-1293.891) [-1291.997] -- 0:00:04
Average standard deviation of split frequencies: 0.010754
935500 -- (-1292.715) (-1293.237) (-1292.355) [-1291.178] * (-1295.781) [-1295.223] (-1291.344) (-1293.469) -- 0:00:04
936000 -- (-1291.194) (-1293.187) [-1291.903] (-1293.031) * [-1293.493] (-1292.757) (-1293.728) (-1299.095) -- 0:00:04
936500 -- (-1292.023) [-1292.468] (-1294.044) (-1292.553) * (-1293.513) (-1292.001) [-1293.628] (-1300.296) -- 0:00:04
937000 -- [-1292.629] (-1291.373) (-1294.839) (-1294.506) * [-1292.280] (-1295.389) (-1293.230) (-1298.325) -- 0:00:04
937500 -- (-1292.976) [-1292.490] (-1292.987) (-1293.563) * (-1295.658) (-1297.728) (-1293.858) [-1294.754] -- 0:00:04
938000 -- (-1292.897) (-1294.013) [-1291.835] (-1293.877) * (-1294.344) (-1296.093) (-1300.871) [-1294.690] -- 0:00:04
938500 -- [-1293.349] (-1298.666) (-1297.014) (-1293.948) * (-1294.042) (-1297.437) [-1292.158] (-1295.807) -- 0:00:04
939000 -- (-1292.413) [-1293.904] (-1295.137) (-1292.113) * [-1293.131] (-1292.668) (-1294.529) (-1293.496) -- 0:00:04
939500 -- (-1292.356) (-1292.423) (-1293.016) [-1291.680] * (-1293.567) (-1293.625) (-1292.006) [-1292.594] -- 0:00:04
940000 -- (-1292.390) [-1293.210] (-1295.175) (-1293.038) * (-1291.869) (-1293.260) [-1294.775] (-1299.073) -- 0:00:04
Average standard deviation of split frequencies: 0.010305
940500 -- (-1292.286) (-1291.855) [-1291.871] (-1297.569) * [-1292.409] (-1291.807) (-1293.066) (-1293.156) -- 0:00:04
941000 -- (-1292.217) (-1291.845) [-1293.249] (-1295.017) * (-1292.438) (-1291.901) (-1292.847) [-1292.284] -- 0:00:04
941500 -- (-1292.053) (-1293.052) (-1292.811) [-1294.603] * (-1292.386) [-1292.412] (-1292.298) (-1293.786) -- 0:00:04
942000 -- (-1293.062) (-1294.208) (-1293.470) [-1293.516] * (-1291.363) [-1293.970] (-1296.420) (-1293.203) -- 0:00:04
942500 -- (-1293.241) (-1294.899) (-1293.987) [-1293.121] * (-1292.500) [-1292.742] (-1294.549) (-1296.537) -- 0:00:03
943000 -- [-1293.818] (-1292.115) (-1295.038) (-1293.964) * (-1295.824) (-1294.421) [-1293.712] (-1294.331) -- 0:00:03
943500 -- (-1294.595) [-1293.296] (-1295.910) (-1293.162) * (-1297.280) [-1292.636] (-1295.410) (-1293.756) -- 0:00:03
944000 -- (-1295.861) (-1294.833) [-1293.700] (-1295.156) * (-1294.183) [-1292.914] (-1292.750) (-1295.145) -- 0:00:03
944500 -- (-1294.222) (-1292.209) (-1291.935) [-1295.540] * [-1293.965] (-1292.850) (-1291.887) (-1291.818) -- 0:00:03
945000 -- (-1293.123) [-1292.418] (-1296.037) (-1293.615) * (-1295.018) [-1295.331] (-1291.794) (-1293.872) -- 0:00:03
Average standard deviation of split frequencies: 0.010215
945500 -- (-1297.294) (-1293.014) (-1295.926) [-1293.185] * [-1297.400] (-1292.640) (-1292.760) (-1294.196) -- 0:00:03
946000 -- (-1292.696) [-1295.410] (-1293.396) (-1294.486) * (-1292.234) (-1293.097) (-1294.373) [-1293.104] -- 0:00:03
946500 -- [-1297.344] (-1298.924) (-1292.658) (-1293.789) * [-1292.454] (-1296.256) (-1296.743) (-1293.127) -- 0:00:03
947000 -- (-1292.306) (-1296.479) (-1294.776) [-1292.421] * [-1292.754] (-1293.657) (-1294.766) (-1298.495) -- 0:00:03
947500 -- (-1292.422) (-1293.688) (-1294.764) [-1291.474] * [-1295.513] (-1293.318) (-1294.588) (-1294.405) -- 0:00:03
948000 -- (-1292.554) (-1293.178) (-1304.247) [-1291.632] * (-1294.620) [-1292.392] (-1292.284) (-1291.901) -- 0:00:03
948500 -- [-1291.623] (-1295.558) (-1294.325) (-1294.877) * (-1295.877) (-1292.365) (-1292.284) [-1293.373] -- 0:00:03
949000 -- (-1296.485) (-1297.422) (-1296.366) [-1291.423] * [-1297.049] (-1294.331) (-1292.346) (-1293.289) -- 0:00:03
949500 -- (-1292.772) (-1295.261) (-1295.939) [-1292.364] * (-1292.813) (-1294.213) (-1293.848) [-1293.266] -- 0:00:03
950000 -- [-1295.413] (-1298.858) (-1292.729) (-1292.692) * (-1291.255) (-1294.205) [-1292.281] (-1291.356) -- 0:00:03
Average standard deviation of split frequencies: 0.010165
950500 -- (-1292.605) (-1293.191) (-1291.913) [-1291.522] * [-1293.075] (-1295.611) (-1296.077) (-1294.538) -- 0:00:03
951000 -- (-1292.439) (-1292.273) (-1292.825) [-1292.822] * (-1292.923) (-1295.650) (-1293.646) [-1292.122] -- 0:00:03
951500 -- [-1296.946] (-1294.068) (-1291.957) (-1297.161) * (-1292.382) (-1298.674) (-1294.069) [-1293.876] -- 0:00:03
952000 -- (-1298.491) (-1296.522) [-1291.978] (-1296.426) * (-1296.372) (-1294.460) (-1292.784) [-1295.946] -- 0:00:03
952500 -- (-1294.081) [-1295.681] (-1295.261) (-1292.607) * (-1297.503) [-1293.306] (-1292.259) (-1291.725) -- 0:00:03
953000 -- (-1293.903) [-1293.322] (-1292.118) (-1292.242) * [-1294.742] (-1293.693) (-1292.680) (-1292.310) -- 0:00:03
953500 -- (-1292.551) (-1293.945) (-1291.948) [-1292.396] * (-1292.510) (-1294.595) [-1293.622] (-1293.734) -- 0:00:03
954000 -- [-1293.525] (-1293.035) (-1291.992) (-1296.258) * [-1292.809] (-1294.417) (-1298.467) (-1295.635) -- 0:00:03
954500 -- (-1294.672) (-1295.106) [-1294.921] (-1293.751) * [-1293.337] (-1299.260) (-1293.388) (-1294.427) -- 0:00:03
955000 -- [-1296.324] (-1293.061) (-1293.677) (-1294.927) * (-1291.498) (-1294.939) (-1294.234) [-1291.531] -- 0:00:03
Average standard deviation of split frequencies: 0.010170
955500 -- [-1294.841] (-1294.554) (-1293.406) (-1296.205) * (-1293.476) (-1295.263) (-1294.075) [-1291.725] -- 0:00:03
956000 -- (-1296.438) [-1291.798] (-1295.663) (-1292.601) * (-1292.340) (-1294.456) [-1296.003] (-1291.876) -- 0:00:03
956500 -- [-1293.038] (-1292.461) (-1292.475) (-1293.116) * (-1292.476) (-1296.804) (-1295.722) [-1293.598] -- 0:00:03
957000 -- (-1295.430) [-1292.379] (-1291.487) (-1294.208) * (-1294.613) [-1292.249] (-1296.547) (-1296.194) -- 0:00:02
957500 -- [-1292.060] (-1291.700) (-1292.216) (-1295.091) * (-1293.935) [-1294.956] (-1298.321) (-1292.235) -- 0:00:02
958000 -- (-1292.358) (-1294.966) (-1292.125) [-1292.908] * [-1293.716] (-1295.094) (-1296.638) (-1292.783) -- 0:00:02
958500 -- (-1292.877) [-1291.880] (-1292.861) (-1296.542) * [-1293.737] (-1292.758) (-1298.808) (-1294.237) -- 0:00:02
959000 -- (-1294.618) (-1293.622) [-1292.824] (-1295.443) * (-1291.976) [-1294.917] (-1294.458) (-1293.425) -- 0:00:02
959500 -- (-1295.666) (-1295.415) (-1299.404) [-1292.433] * (-1292.990) (-1295.185) (-1291.805) [-1293.453] -- 0:00:02
960000 -- [-1297.011] (-1292.911) (-1298.667) (-1294.250) * (-1295.863) (-1294.354) [-1293.838] (-1292.954) -- 0:00:02
Average standard deviation of split frequencies: 0.010489
960500 -- (-1292.837) (-1292.454) (-1292.187) [-1293.931] * (-1294.733) [-1295.365] (-1293.324) (-1292.785) -- 0:00:02
961000 -- (-1292.740) [-1292.183] (-1294.261) (-1292.739) * (-1294.354) [-1293.490] (-1293.350) (-1294.604) -- 0:00:02
961500 -- [-1292.695] (-1292.117) (-1292.275) (-1295.161) * (-1293.323) [-1291.755] (-1292.197) (-1292.830) -- 0:00:02
962000 -- (-1292.983) (-1301.126) (-1293.978) [-1294.405] * (-1292.740) [-1292.236] (-1292.534) (-1297.925) -- 0:00:02
962500 -- (-1293.488) [-1292.821] (-1291.790) (-1294.444) * (-1292.835) [-1292.287] (-1294.048) (-1294.256) -- 0:00:02
963000 -- (-1292.721) (-1292.548) (-1292.493) [-1292.866] * [-1293.165] (-1295.337) (-1293.968) (-1291.663) -- 0:00:02
963500 -- (-1293.735) [-1292.520] (-1292.366) (-1293.251) * [-1294.725] (-1293.519) (-1294.469) (-1292.667) -- 0:00:02
964000 -- (-1292.402) [-1295.213] (-1292.934) (-1297.576) * [-1294.852] (-1295.179) (-1292.608) (-1294.990) -- 0:00:02
964500 -- [-1291.859] (-1295.462) (-1293.333) (-1295.223) * (-1293.699) (-1295.170) [-1292.317] (-1293.015) -- 0:00:02
965000 -- [-1291.368] (-1293.978) (-1293.194) (-1292.140) * (-1294.532) (-1293.621) [-1292.590] (-1294.421) -- 0:00:02
Average standard deviation of split frequencies: 0.010908
965500 -- (-1292.898) (-1293.091) (-1296.774) [-1295.377] * (-1294.451) [-1294.521] (-1292.363) (-1294.587) -- 0:00:02
966000 -- (-1294.272) (-1294.058) [-1293.063] (-1292.716) * (-1300.503) [-1295.300] (-1292.929) (-1292.504) -- 0:00:02
966500 -- [-1295.816] (-1294.012) (-1292.432) (-1295.891) * (-1298.468) (-1292.759) (-1292.752) [-1292.097] -- 0:00:02
967000 -- (-1293.125) (-1294.790) (-1293.810) [-1293.744] * (-1293.846) [-1292.635] (-1291.766) (-1291.549) -- 0:00:02
967500 -- (-1295.936) (-1295.175) (-1297.396) [-1293.091] * (-1293.235) (-1292.382) (-1292.447) [-1291.221] -- 0:00:02
968000 -- (-1292.876) (-1294.429) [-1296.775] (-1292.259) * (-1293.112) (-1292.302) [-1294.386] (-1291.373) -- 0:00:02
968500 -- [-1298.889] (-1291.694) (-1295.185) (-1296.807) * (-1295.820) [-1292.401] (-1293.060) (-1293.192) -- 0:00:02
969000 -- (-1295.944) [-1292.464] (-1294.020) (-1292.665) * (-1292.247) (-1293.819) (-1293.394) [-1292.629] -- 0:00:02
969500 -- (-1292.667) [-1293.161] (-1295.614) (-1292.929) * (-1292.902) [-1292.510] (-1293.387) (-1292.488) -- 0:00:02
970000 -- [-1292.799] (-1294.366) (-1293.669) (-1293.814) * (-1296.659) [-1293.881] (-1293.983) (-1294.393) -- 0:00:02
Average standard deviation of split frequencies: 0.010741
970500 -- (-1292.635) (-1298.188) [-1292.657] (-1294.986) * (-1294.439) [-1296.423] (-1292.146) (-1292.632) -- 0:00:02
971000 -- (-1296.493) (-1291.664) [-1292.739] (-1295.047) * (-1293.466) (-1295.499) [-1291.723] (-1297.505) -- 0:00:02
971500 -- (-1292.170) (-1292.231) (-1292.545) [-1293.597] * [-1293.406] (-1301.804) (-1293.290) (-1291.761) -- 0:00:01
972000 -- [-1292.804] (-1293.958) (-1291.331) (-1295.563) * (-1295.477) (-1293.242) (-1293.053) [-1294.260] -- 0:00:01
972500 -- (-1293.977) (-1292.402) [-1292.643] (-1298.036) * (-1293.093) (-1292.493) (-1296.065) [-1294.057] -- 0:00:01
973000 -- (-1294.520) [-1292.234] (-1292.336) (-1291.344) * (-1296.295) [-1294.649] (-1292.478) (-1299.165) -- 0:00:01
973500 -- (-1294.519) (-1295.481) [-1292.448] (-1296.054) * (-1295.224) (-1296.365) (-1293.414) [-1295.813] -- 0:00:01
974000 -- (-1295.063) (-1294.578) (-1294.365) [-1292.764] * (-1292.020) (-1292.670) [-1291.791] (-1293.908) -- 0:00:01
974500 -- [-1291.388] (-1293.582) (-1294.964) (-1293.050) * (-1291.968) (-1292.885) (-1292.146) [-1294.598] -- 0:00:01
975000 -- (-1295.472) [-1292.838] (-1295.903) (-1294.924) * (-1291.940) (-1294.590) [-1292.633] (-1297.472) -- 0:00:01
Average standard deviation of split frequencies: 0.010342
975500 -- (-1295.005) (-1294.884) [-1292.806] (-1291.677) * (-1294.550) [-1293.872] (-1295.596) (-1292.731) -- 0:00:01
976000 -- (-1293.940) (-1292.997) [-1298.333] (-1296.942) * (-1291.683) (-1294.244) (-1293.569) [-1293.374] -- 0:00:01
976500 -- (-1292.433) (-1293.628) (-1292.694) [-1293.354] * [-1291.465] (-1293.219) (-1296.096) (-1295.809) -- 0:00:01
977000 -- [-1291.829] (-1293.714) (-1295.204) (-1292.153) * (-1292.708) (-1293.644) (-1296.335) [-1291.770] -- 0:00:01
977500 -- (-1292.028) (-1296.510) [-1292.253] (-1292.618) * [-1293.030] (-1293.758) (-1295.233) (-1296.236) -- 0:00:01
978000 -- (-1295.858) [-1293.442] (-1292.495) (-1291.756) * (-1294.265) [-1293.131] (-1292.909) (-1293.658) -- 0:00:01
978500 -- [-1296.529] (-1296.103) (-1292.011) (-1292.215) * (-1292.990) (-1291.590) [-1293.154] (-1292.142) -- 0:00:01
979000 -- (-1292.524) (-1291.865) [-1293.527] (-1293.467) * (-1292.988) (-1293.373) (-1292.673) [-1292.390] -- 0:00:01
979500 -- (-1295.557) (-1292.798) (-1291.770) [-1293.196] * (-1291.638) (-1292.610) (-1295.520) [-1292.909] -- 0:00:01
980000 -- (-1292.709) (-1292.898) (-1292.208) [-1292.424] * [-1294.892] (-1292.461) (-1295.226) (-1293.129) -- 0:00:01
Average standard deviation of split frequencies: 0.009974
980500 -- (-1292.484) (-1296.325) [-1291.745] (-1293.905) * (-1294.713) [-1292.180] (-1291.989) (-1291.926) -- 0:00:01
981000 -- [-1293.162] (-1293.445) (-1292.264) (-1295.657) * (-1294.321) [-1292.680] (-1294.315) (-1295.210) -- 0:00:01
981500 -- (-1293.485) [-1293.953] (-1292.399) (-1292.653) * (-1296.470) (-1293.672) (-1291.769) [-1293.487] -- 0:00:01
982000 -- [-1291.637] (-1292.439) (-1292.256) (-1292.555) * (-1296.525) [-1294.989] (-1296.142) (-1294.058) -- 0:00:01
982500 -- (-1295.702) (-1294.481) [-1291.555] (-1292.935) * (-1294.832) (-1297.015) [-1293.677] (-1294.082) -- 0:00:01
983000 -- (-1297.749) (-1296.540) (-1291.932) [-1292.293] * [-1296.653] (-1293.159) (-1291.586) (-1297.081) -- 0:00:01
983500 -- (-1292.844) (-1295.071) [-1292.993] (-1296.068) * (-1296.631) (-1291.653) (-1293.492) [-1292.357] -- 0:00:01
984000 -- (-1294.138) [-1295.263] (-1292.918) (-1296.571) * (-1293.185) (-1293.644) (-1292.108) [-1292.159] -- 0:00:01
984500 -- (-1292.902) (-1294.500) (-1293.162) [-1292.819] * (-1292.880) (-1291.855) (-1293.116) [-1294.635] -- 0:00:01
985000 -- [-1294.303] (-1293.439) (-1291.733) (-1293.452) * (-1293.876) (-1291.899) [-1291.777] (-1292.338) -- 0:00:01
Average standard deviation of split frequencies: 0.009891
985500 -- (-1294.301) [-1294.052] (-1293.570) (-1292.029) * (-1293.576) (-1293.142) [-1295.776] (-1294.316) -- 0:00:01
986000 -- (-1295.333) [-1294.858] (-1294.180) (-1293.967) * (-1292.798) (-1293.258) [-1296.239] (-1296.081) -- 0:00:00
986500 -- (-1294.187) [-1293.009] (-1291.880) (-1291.773) * [-1295.756] (-1295.566) (-1294.073) (-1296.574) -- 0:00:00
987000 -- (-1294.564) (-1294.262) (-1294.563) [-1292.564] * (-1294.620) (-1295.692) (-1293.793) [-1295.342] -- 0:00:00
987500 -- (-1292.111) [-1294.269] (-1292.888) (-1297.564) * [-1292.190] (-1293.397) (-1293.735) (-1295.493) -- 0:00:00
988000 -- (-1294.094) (-1293.002) (-1291.891) [-1294.491] * [-1294.509] (-1294.043) (-1293.996) (-1295.124) -- 0:00:00
988500 -- (-1293.147) [-1292.650] (-1293.062) (-1293.590) * (-1296.278) [-1292.465] (-1293.672) (-1292.480) -- 0:00:00
989000 -- (-1292.810) (-1291.558) (-1296.625) [-1295.004] * (-1296.035) (-1300.833) [-1293.160] (-1292.392) -- 0:00:00
989500 -- [-1292.715] (-1294.164) (-1293.365) (-1293.004) * (-1293.067) [-1293.997] (-1294.285) (-1293.664) -- 0:00:00
990000 -- (-1292.123) (-1294.373) [-1293.248] (-1291.959) * [-1292.208] (-1292.672) (-1294.029) (-1293.205) -- 0:00:00
Average standard deviation of split frequencies: 0.009725
990500 -- (-1294.582) [-1291.813] (-1294.619) (-1291.961) * (-1294.803) (-1296.195) (-1293.954) [-1293.028] -- 0:00:00
991000 -- (-1292.451) (-1292.602) (-1291.382) [-1292.601] * (-1294.632) (-1292.800) [-1292.110] (-1292.311) -- 0:00:00
991500 -- [-1292.938] (-1292.844) (-1297.449) (-1296.923) * [-1291.919] (-1291.679) (-1293.822) (-1298.072) -- 0:00:00
992000 -- (-1292.359) (-1294.255) [-1294.325] (-1292.847) * (-1295.116) (-1292.278) (-1293.032) [-1292.277] -- 0:00:00
992500 -- (-1291.593) (-1294.655) (-1297.536) [-1294.045] * (-1296.453) (-1292.444) [-1293.294] (-1291.464) -- 0:00:00
993000 -- (-1293.147) [-1292.540] (-1296.523) (-1293.708) * (-1294.711) (-1292.077) (-1292.480) [-1292.540] -- 0:00:00
993500 -- [-1292.165] (-1297.316) (-1293.516) (-1292.988) * (-1296.569) [-1294.338] (-1293.955) (-1293.958) -- 0:00:00
994000 -- (-1292.788) (-1296.322) (-1295.112) [-1293.157] * [-1292.827] (-1293.111) (-1294.092) (-1295.713) -- 0:00:00
994500 -- (-1291.812) (-1296.745) (-1295.019) [-1292.116] * (-1292.497) (-1293.624) [-1292.837] (-1293.532) -- 0:00:00
995000 -- (-1291.522) (-1291.622) [-1291.502] (-1295.513) * [-1294.840] (-1293.667) (-1296.162) (-1293.912) -- 0:00:00
Average standard deviation of split frequencies: 0.009673
995500 -- (-1292.290) (-1291.842) [-1293.729] (-1298.229) * (-1292.746) [-1294.166] (-1292.838) (-1292.490) -- 0:00:00
996000 -- (-1292.723) (-1293.433) (-1293.378) [-1293.175] * (-1291.974) (-1294.303) [-1293.787] (-1292.614) -- 0:00:00
996500 -- (-1291.674) [-1292.557] (-1294.177) (-1294.872) * [-1294.504] (-1298.505) (-1293.008) (-1292.538) -- 0:00:00
997000 -- [-1291.942] (-1294.701) (-1293.893) (-1293.143) * (-1293.380) (-1292.063) (-1293.121) [-1293.882] -- 0:00:00
997500 -- [-1292.800] (-1295.954) (-1294.880) (-1291.796) * (-1291.799) (-1292.223) (-1292.167) [-1293.150] -- 0:00:00
998000 -- (-1292.012) (-1294.673) (-1292.531) [-1292.245] * (-1292.141) (-1292.185) (-1294.722) [-1293.767] -- 0:00:00
998500 -- (-1294.241) (-1294.630) [-1294.652] (-1292.660) * (-1291.520) [-1295.468] (-1293.160) (-1293.098) -- 0:00:00
999000 -- (-1295.476) (-1294.866) [-1291.405] (-1292.559) * [-1291.774] (-1295.075) (-1297.523) (-1294.249) -- 0:00:00
999500 -- (-1292.567) (-1295.365) [-1291.830] (-1292.847) * (-1293.760) (-1292.101) (-1293.616) [-1293.128] -- 0:00:00
1000000 -- [-1292.636] (-1293.706) (-1294.816) (-1295.969) * (-1295.288) (-1292.995) (-1298.462) [-1292.031] -- 0:00:00
Average standard deviation of split frequencies: 0.009628
Analysis completed in 1 mins 9 seconds
Analysis used 68.44 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1291.04
Likelihood of best state for "cold" chain of run 2 was -1291.04
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 66 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
26.0 % ( 21 %) Dirichlet(Pi{all})
27.8 % ( 15 %) Slider(Pi{all})
79.0 % ( 48 %) Multiplier(Alpha{1,2})
77.2 % ( 45 %) Multiplier(Alpha{3})
17.3 % ( 27 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 92 %) ParsSPR(Tau{all},V{all})
28.1 % ( 26 %) Multiplier(V{all})
97.4 % ( 92 %) Nodeslider(V{all})
30.4 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.6 % ( 63 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.3 % ( 30 %) Dirichlet(Pi{all})
28.0 % ( 22 %) Slider(Pi{all})
79.3 % ( 59 %) Multiplier(Alpha{1,2})
77.8 % ( 54 %) Multiplier(Alpha{3})
18.0 % ( 29 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.2 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 89 %) ParsSPR(Tau{all},V{all})
28.0 % ( 28 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.5 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166571 0.82 0.66
3 | 166304 166023 0.84
4 | 167493 167008 166601
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166610 0.82 0.66
3 | 166034 166714 0.83
4 | 166874 167230 166538
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/12res/thiL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/12res/thiL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/12res/thiL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1292.70
| 2 1 |
| 2 2 |
| 1 1 1 1 1|
| 1 2 11 1 1 2 2 12 1 1 1 |
| 1 1 2 1 1 2 2 12 1 2|
|2 2 2 2 * 1 2 1 2 12 11 |
|1 21 2 2 2 1 1 2 1 * 22 |
| 1 1 12 1 11 21 1 2 2 1 22 2 1 2 |
| 2 2 22 21 2 2 2 21 1 2 |
| 2 11 2 21 12 * 22 11 |
| 1 2 1 1 |
| 1 2 1 2 2 |
| 2 |
| 1 2 |
| 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1294.50
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/12res/thiL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/thiL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/thiL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1292.73 -1298.33
2 -1292.79 -1296.31
--------------------------------------
TOTAL -1292.76 -1297.76
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/thiL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/thiL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/thiL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893902 0.089871 0.343587 1.486341 0.857205 1381.02 1441.01 1.000
r(A<->C){all} 0.166836 0.020826 0.000057 0.465333 0.124995 155.00 210.10 1.007
r(A<->G){all} 0.160106 0.019029 0.000039 0.440035 0.123580 158.44 168.67 1.000
r(A<->T){all} 0.158395 0.017831 0.000137 0.425575 0.125404 237.19 250.74 1.005
r(C<->G){all} 0.183040 0.023455 0.000011 0.489679 0.144029 106.89 212.42 1.002
r(C<->T){all} 0.163335 0.018351 0.000078 0.434159 0.130601 232.14 286.75 1.001
r(G<->T){all} 0.168287 0.020353 0.000158 0.452317 0.130394 147.47 324.09 1.003
pi(A){all} 0.142822 0.000127 0.121843 0.165540 0.142256 1337.20 1406.01 1.000
pi(C){all} 0.265615 0.000190 0.239602 0.292828 0.265364 1074.20 1135.99 1.000
pi(G){all} 0.382730 0.000235 0.353511 0.412230 0.382694 1086.42 1233.25 1.000
pi(T){all} 0.208832 0.000166 0.184242 0.235001 0.208715 1118.91 1219.70 1.001
alpha{1,2} 0.448899 0.253051 0.000129 1.504828 0.278531 1097.88 1141.22 1.000
alpha{3} 0.478996 0.247787 0.000279 1.483396 0.322939 1328.05 1334.07 1.001
pinvar{all} 0.998460 0.000004 0.995062 1.000000 0.999037 1045.09 1083.48 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/12res/thiL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/12res/thiL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/12res/thiL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/12res/thiL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/12res/thiL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...*.*
8 -- .*...*
9 -- ..*.*.
10 -- .*.***
11 -- ...**.
12 -- .*..*.
13 -- .**...
14 -- .***.*
15 -- .****.
16 -- ..**..
17 -- ..****
18 -- ....**
19 -- ..*..*
20 -- .*.*..
21 -- .**.**
22 -- .*.**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/12res/thiL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 464 0.154564 0.007537 0.149234 0.159893 2
8 456 0.151899 0.010364 0.144570 0.159227 2
9 443 0.147568 0.000471 0.147235 0.147901 2
10 443 0.147568 0.006124 0.143238 0.151899 2
11 436 0.145237 0.001884 0.143904 0.146569 2
12 434 0.144570 0.010364 0.137242 0.151899 2
13 429 0.142905 0.005182 0.139241 0.146569 2
14 427 0.142239 0.016488 0.130580 0.153897 2
15 424 0.141239 0.017901 0.128581 0.153897 2
16 423 0.140906 0.008951 0.134577 0.147235 2
17 414 0.137908 0.000942 0.137242 0.138574 2
18 413 0.137575 0.019315 0.123917 0.151233 2
19 411 0.136909 0.005182 0.133245 0.140573 2
20 410 0.136576 0.011306 0.128581 0.144570 2
21 390 0.129913 0.016017 0.118588 0.141239 2
22 282 0.093937 0.016017 0.082612 0.105263 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/12res/thiL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.096754 0.009854 0.000016 0.289070 0.066729 1.001 2
length{all}[2] 0.099700 0.009412 0.000022 0.300743 0.069777 1.000 2
length{all}[3] 0.100233 0.009841 0.000051 0.289556 0.070399 1.000 2
length{all}[4] 0.099681 0.009766 0.000106 0.299680 0.069210 1.001 2
length{all}[5] 0.098373 0.009881 0.000018 0.296801 0.067671 1.000 2
length{all}[6] 0.102852 0.010484 0.000014 0.300652 0.071377 1.000 2
length{all}[7] 0.099178 0.009360 0.000181 0.309428 0.064945 0.998 2
length{all}[8] 0.097157 0.009261 0.000009 0.283680 0.068408 1.002 2
length{all}[9] 0.097305 0.009495 0.000009 0.291609 0.070835 0.998 2
length{all}[10] 0.096591 0.010148 0.000190 0.295927 0.065546 0.999 2
length{all}[11] 0.103140 0.011038 0.000128 0.313833 0.069031 1.000 2
length{all}[12] 0.100287 0.009649 0.000391 0.311259 0.068208 0.998 2
length{all}[13] 0.104276 0.010790 0.000748 0.306248 0.076570 1.005 2
length{all}[14] 0.101432 0.009741 0.000056 0.303891 0.067546 1.014 2
length{all}[15] 0.097901 0.010221 0.000508 0.320091 0.066136 1.001 2
length{all}[16] 0.097008 0.009394 0.000071 0.286615 0.069124 1.007 2
length{all}[17] 0.090932 0.008163 0.000019 0.277133 0.063091 0.998 2
length{all}[18] 0.100872 0.010387 0.000343 0.307280 0.070626 1.000 2
length{all}[19] 0.096156 0.008873 0.000037 0.273145 0.068907 0.998 2
length{all}[20] 0.098387 0.010438 0.000576 0.309866 0.064543 0.999 2
length{all}[21] 0.102552 0.009884 0.000169 0.306469 0.076553 0.998 2
length{all}[22] 0.102599 0.014187 0.000591 0.312481 0.067674 0.996 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009628
Maximum standard deviation of split frequencies = 0.019315
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.014
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 975
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 57 patterns at 325 / 325 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 57 patterns at 325 / 325 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
55632 bytes for conP
5016 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.012174 0.093311 0.086411 0.022540 0.013885 0.026579 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1336.866975
Iterating by ming2
Initial: fx= 1336.866975
x= 0.01217 0.09331 0.08641 0.02254 0.01388 0.02658 0.30000 1.30000
1 h-m-p 0.0000 0.0000 785.6038 ++ 1313.559924 m 0.0000 13 | 1/8
2 h-m-p 0.0005 0.0267 51.2375 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 718.0191 ++ 1310.825705 m 0.0000 44 | 2/8
4 h-m-p 0.0001 0.0320 43.0819 ---------.. | 2/8
5 h-m-p 0.0000 0.0000 641.3185 ++ 1299.761291 m 0.0000 73 | 3/8
6 h-m-p 0.0004 0.0403 33.8132 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 555.0654 ++ 1295.891473 m 0.0000 104 | 4/8
8 h-m-p 0.0002 0.0545 24.6289 ----------.. | 4/8
9 h-m-p 0.0000 0.0002 451.6442 +++ 1257.267373 m 0.0002 135 | 5/8
10 h-m-p 0.0034 0.0796 17.5910 ------------.. | 5/8
11 h-m-p 0.0000 0.0000 322.9917 ++ 1254.998040 m 0.0000 167 | 6/8
12 h-m-p 0.5422 8.0000 0.0000 ++ 1254.998040 m 8.0000 178 | 6/8
13 h-m-p 0.6421 8.0000 0.0000 ----Y 1254.998040 0 0.0006 195
Out..
lnL = -1254.998040
196 lfun, 196 eigenQcodon, 1176 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.022539 0.079926 0.108985 0.077829 0.016574 0.060845 0.300026 0.898398 0.255139
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.602519
np = 9
lnL0 = -1368.898248
Iterating by ming2
Initial: fx= 1368.898248
x= 0.02254 0.07993 0.10898 0.07783 0.01657 0.06084 0.30003 0.89840 0.25514
1 h-m-p 0.0000 0.0001 744.9017 ++ 1338.884819 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0000 918.4617 ++ 1329.670759 m 0.0000 26 | 2/9
3 h-m-p 0.0000 0.0002 413.3238 ++ 1284.844823 m 0.0002 38 | 3/9
4 h-m-p 0.0000 0.0002 494.3940 ++ 1264.598339 m 0.0002 50 | 4/9
5 h-m-p 0.0000 0.0000 19539.3676 ++ 1263.176741 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 15050.7016 ++ 1254.997868 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 1254.997868 m 8.0000 86 | 6/9
8 h-m-p 0.0160 8.0000 0.1202 ----------Y 1254.997868 0 0.0000 111 | 6/9
9 h-m-p 0.0160 8.0000 0.0006 +++++ 1254.997866 m 8.0000 129 | 6/9
10 h-m-p 0.0212 2.0946 0.2296 ------------Y 1254.997866 0 0.0000 156 | 6/9
11 h-m-p 0.0160 8.0000 0.0001 +++++ 1254.997865 m 8.0000 174 | 6/9
12 h-m-p 0.0053 2.6733 0.2599 ----------Y 1254.997865 0 0.0000 199 | 6/9
13 h-m-p 0.0160 8.0000 0.0016 +++++ 1254.997859 m 8.0000 217 | 6/9
14 h-m-p 0.0455 0.7121 0.2813 ----------C 1254.997859 0 0.0000 242 | 6/9
15 h-m-p 0.0160 8.0000 0.0005 ------N 1254.997859 0 0.0000 263 | 6/9
16 h-m-p 0.0160 8.0000 0.0000 +++++ 1254.997859 m 8.0000 281 | 6/9
17 h-m-p 0.0006 0.2830 0.3684 -----------.. | 6/9
18 h-m-p 0.0160 8.0000 0.0007 +++++ 1254.997855 m 8.0000 323 | 6/9
19 h-m-p 0.0360 8.0000 0.1586 ----------Y 1254.997855 0 0.0000 348 | 6/9
20 h-m-p 0.0038 1.9003 0.0064 +++++ 1254.997846 m 1.9003 366 | 7/9
21 h-m-p 0.0751 8.0000 0.0777 -----------C 1254.997846 0 0.0000 392 | 7/9
22 h-m-p 0.0160 8.0000 0.0027 +++++ 1254.997835 m 8.0000 409 | 7/9
23 h-m-p 0.0778 2.9926 0.2744 -------------Y 1254.997835 0 0.0000 436 | 7/9
24 h-m-p 0.0160 8.0000 0.0001 -------------.. | 7/9
25 h-m-p 0.0160 8.0000 0.0006 +++++ 1254.997832 m 8.0000 478 | 7/9
26 h-m-p 0.0229 4.5424 0.2207 ----------Y 1254.997832 0 0.0000 502 | 7/9
27 h-m-p 0.0019 0.9433 0.0173 +++++ 1254.997821 m 0.9433 519 | 8/9
28 h-m-p 0.0694 8.0000 0.0009 -------Y 1254.997821 0 0.0000 540
Out..
lnL = -1254.997821
541 lfun, 1623 eigenQcodon, 6492 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.064304 0.030791 0.056283 0.022214 0.088211 0.032454 0.292834 1.603986 0.368311 0.492947 1.318282
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 8.468593
np = 11
lnL0 = -1347.888273
Iterating by ming2
Initial: fx= 1347.888273
x= 0.06430 0.03079 0.05628 0.02221 0.08821 0.03245 0.29283 1.60399 0.36831 0.49295 1.31828
1 h-m-p 0.0000 0.0001 760.6631 ++ 1306.432487 m 0.0001 16 | 1/11
2 h-m-p 0.0000 0.0002 271.4069 ++ 1292.608890 m 0.0002 30 | 2/11
3 h-m-p 0.0000 0.0000 2663.3609 ++ 1290.672311 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0000 9849.1506 ++ 1268.394355 m 0.0000 58 | 4/11
5 h-m-p 0.0000 0.0000 7256775.6745 ++ 1263.138107 m 0.0000 72 | 5/11
6 h-m-p 0.0000 0.0000 81256.4518 ++ 1254.997971 m 0.0000 86 | 6/11
7 h-m-p 1.6000 8.0000 0.0001 ++ 1254.997971 m 8.0000 100 | 6/11
8 h-m-p 0.0160 8.0000 0.0415 -------------.. | 6/11
9 h-m-p 0.0160 8.0000 0.0001 +++++ 1254.997971 m 8.0000 152 | 6/11
10 h-m-p 0.0039 1.9316 0.5071 ------------.. | 6/11
11 h-m-p 0.0160 8.0000 0.0001 +++++ 1254.997971 m 8.0000 203 | 6/11
12 h-m-p 0.0038 1.9182 0.5112 ----------Y 1254.997971 0 0.0000 232 | 6/11
13 h-m-p 0.0160 8.0000 0.0007 +++++ 1254.997970 m 8.0000 254 | 6/11
14 h-m-p 0.0133 2.5755 0.4441 ----------C 1254.997970 0 0.0000 283 | 6/11
15 h-m-p 0.0160 8.0000 0.0106 +++++ 1254.997960 m 8.0000 305 | 6/11
16 h-m-p 0.1764 2.5409 0.4801 --------------C 1254.997960 0 0.0000 338 | 6/11
17 h-m-p 0.0160 8.0000 0.0002 +++++ 1254.997960 m 8.0000 360 | 6/11
18 h-m-p 0.0101 5.0479 0.8144 ------------C 1254.997960 0 0.0000 391 | 6/11
19 h-m-p 0.0160 8.0000 0.0011 +++++ 1254.997959 m 8.0000 413 | 6/11
20 h-m-p 0.0113 5.6674 0.8273 -------------.. | 6/11
21 h-m-p 0.0160 8.0000 0.0001 +++++ 1254.997959 m 8.0000 465 | 6/11
22 h-m-p 0.0045 2.2277 0.4815 ---------C 1254.997959 0 0.0000 493 | 6/11
23 h-m-p 0.0160 8.0000 0.0002 +++++ 1254.997959 m 8.0000 515 | 6/11
24 h-m-p 0.0096 4.7974 0.5148 ---------N 1254.997959 0 0.0000 543 | 6/11
25 h-m-p 0.0011 0.5483 0.1327 +++++ 1254.997950 m 0.5483 565 | 7/11
26 h-m-p 0.1330 8.0000 0.5024 -----------C 1254.997950 0 0.0000 595 | 7/11
27 h-m-p 0.0160 8.0000 0.0001 --Y 1254.997950 0 0.0003 615 | 7/11
28 h-m-p 0.0160 8.0000 0.0002 +++++ 1254.997950 m 8.0000 636 | 7/11
29 h-m-p 0.0160 8.0000 1.0339 ------------Y 1254.997950 0 0.0000 666 | 7/11
30 h-m-p 0.0160 8.0000 0.0001 +++++ 1254.997950 m 8.0000 683 | 7/11
31 h-m-p 0.0160 8.0000 1.7802 -------------.. | 7/11
32 h-m-p 0.0160 8.0000 0.0001 +++++ 1254.997950 m 8.0000 729 | 7/11
33 h-m-p 0.0129 6.4500 0.0735 +++++ 1254.997910 m 6.4500 750 | 8/11
34 h-m-p 0.1914 8.0000 2.2745 ------------Y 1254.997910 0 0.0000 780 | 8/11
35 h-m-p 0.0160 8.0000 0.0003 +++++ 1254.997909 m 8.0000 797 | 8/11
36 h-m-p 0.0001 0.0270 39.1813 +++++ 1254.997843 m 0.0270 817 | 9/11
37 h-m-p 0.3286 8.0000 3.1713 +++ 1254.997776 m 8.0000 832 | 9/11
38 h-m-p 1.6000 8.0000 0.0000 N 1254.997776 0 1.6000 846
Out..
lnL = -1254.997776
847 lfun, 3388 eigenQcodon, 15246 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1255.045079 S = -1254.998732 -0.017889
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:06
did 20 / 57 patterns 0:06
did 30 / 57 patterns 0:06
did 40 / 57 patterns 0:06
did 50 / 57 patterns 0:06
did 57 / 57 patterns 0:06
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.083826 0.094514 0.012851 0.010758 0.030677 0.068805 0.000100 0.325904 1.045487
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 16.555581
np = 9
lnL0 = -1346.381311
Iterating by ming2
Initial: fx= 1346.381311
x= 0.08383 0.09451 0.01285 0.01076 0.03068 0.06881 0.00011 0.32590 1.04549
1 h-m-p 0.0000 0.0000 716.5039 ++ 1345.507422 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0030 79.6644 ++++ 1330.192845 m 0.0030 28 | 2/9
3 h-m-p 0.0000 0.0000 248.4679 ++ 1328.233498 m 0.0000 40 | 3/9
4 h-m-p 0.0000 0.0009 166.4525 +++ 1307.447699 m 0.0009 53 | 4/9
5 h-m-p 0.0006 0.0030 156.8262 ++ 1260.086390 m 0.0030 65 | 5/9
6 h-m-p 0.0000 0.0001 520.6316 ++ 1258.916706 m 0.0001 77 | 6/9
7 h-m-p 0.0000 0.0000 1222.1743 ++ 1257.285973 m 0.0000 89 | 7/9
8 h-m-p 0.0015 0.0211 21.0865 -----------.. | 7/9
9 h-m-p 0.0000 0.0000 310.2680 ++ 1254.997776 m 0.0000 122 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 Y 1254.997776 0 1.6000 134 | 8/9
11 h-m-p 0.0160 8.0000 0.0000 +Y 1254.997776 0 0.0640 148 | 8/9
12 h-m-p 0.0160 8.0000 2.1633 ++
QuantileBeta(0.15, 0.00500, 2.66467) = 9.428351e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 9.31039) = 2.337221e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 17.75599) = 1.193952e-161 2000 rounds
+ 1254.997776 m 8.0000 164
QuantileBeta(0.15, 0.00500, 17.75599) = 1.193952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.75599) = 1.193952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.75599) = 1.193952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.75599) = 1.193952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.75599) = 1.193952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.75599) = 1.193952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.75599) = 1.193952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.75599) = 1.235633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.75600) = 1.193952e-161 2000 rounds
| 8/9
13 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 17.75599) = 1.193952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.75599) = 1.193952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.75599) = 1.193952e-161 2000 rounds
N 1254.997776 0 1.6000 176
QuantileBeta(0.15, 0.00500, 17.75599) = 1.193952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.75599) = 1.193952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.75599) = 1.193952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.75599) = 1.193952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.75599) = 1.193952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.75599) = 1.193952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.75599) = 1.193952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.75599) = 1.235633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.75639) = 1.193925e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.75559) = 1.193980e-161 2000 rounds
| 8/9
14 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 17.75599) = 1.193952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.75599) = 1.193952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.75599) = 1.193952e-161 2000 rounds
Y 1254.997776 0 0.0160 189
QuantileBeta(0.15, 0.00500, 17.75599) = 1.193952e-161 2000 rounds
Out..
lnL = -1254.997776
190 lfun, 2090 eigenQcodon, 11400 P(t)
QuantileBeta(0.15, 0.00500, 17.75599) = 1.193952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.75599) = 1.193952e-161 2000 rounds
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.080715 0.026838 0.013274 0.011082 0.069155 0.090831 0.000100 0.900000 0.510663 1.168739 1.299937
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 13.170894
np = 11
lnL0 = -1343.561851
Iterating by ming2
Initial: fx= 1343.561851
x= 0.08072 0.02684 0.01327 0.01108 0.06916 0.09083 0.00011 0.90000 0.51066 1.16874 1.29994
1 h-m-p 0.0000 0.0000 711.8939 ++ 1342.338628 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0007 175.6610 ++++ 1322.876379 m 0.0007 32 | 2/11
3 h-m-p 0.0000 0.0000 338.7366 ++ 1319.450695 m 0.0000 46 | 3/11
4 h-m-p 0.0000 0.0006 308.8905 +++ 1300.716701 m 0.0006 61 | 4/11
5 h-m-p 0.0000 0.0002 1239.3879 ++ 1265.536784 m 0.0002 75 | 5/11
6 h-m-p 0.0000 0.0002 580.1638 ++ 1259.035924 m 0.0002 89 | 6/11
7 h-m-p 0.0007 0.0034 7.4358 -----------.. | 6/11
8 h-m-p 0.0000 0.0000 445.4158 ++ 1258.035668 m 0.0000 126 | 7/11
9 h-m-p 0.0001 0.0126 18.5591 ++++ 1255.450094 m 0.0126 142 | 8/11
10 h-m-p 0.0004 0.0018 1.2990 ++ 1254.997776 m 0.0018 156 | 9/11
11 h-m-p 1.6000 8.0000 0.0000 Y 1254.997776 0 0.4000 170 | 9/11
12 h-m-p 0.0160 8.0000 0.0000 Y 1254.997776 0 0.0160 186 | 9/11
13 h-m-p 0.2025 8.0000 0.0000 Y 1254.997776 0 0.2025 202 | 9/11
14 h-m-p 0.1177 8.0000 0.0000 -Y 1254.997776 0 0.0074 219 | 9/11
15 h-m-p 0.0160 8.0000 0.0000 ---------Y 1254.997776 0 0.0000 244
Out..
lnL = -1254.997776
245 lfun, 2940 eigenQcodon, 16170 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1255.059001 S = -1254.998732 -0.026785
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:13
did 20 / 57 patterns 0:13
did 30 / 57 patterns 0:14
did 40 / 57 patterns 0:14
did 50 / 57 patterns 0:14
did 57 / 57 patterns 0:14
Time used: 0:14
CodeML output code: -1
CODONML (in paml version 4.9h, March 2018) /data/12res/thiL/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 325
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 3 3 3 3 3 3 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 3 3 3 3 3 3
TTC 6 6 6 6 6 6 | TCC 6 6 6 6 6 6 | TAC 0 0 0 0 0 0 | TGC 2 2 2 2 2 2
Leu TTA 2 2 2 2 2 2 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 5 5 5 5 5 5 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 9 9 9 9 9 9
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 4 4 4 4 4 4 | His CAT 5 5 5 5 5 5 | Arg CGT 3 3 3 3 3 3
CTC 3 3 3 3 3 3 | CCC 1 1 1 1 1 1 | CAC 4 4 4 4 4 4 | CGC 8 8 8 8 8 8
CTA 1 1 1 1 1 1 | CCA 2 2 2 2 2 2 | Gln CAA 3 3 3 3 3 3 | CGA 1 1 1 1 1 1
CTG 14 14 14 14 14 14 | CCG 6 6 6 6 6 6 | CAG 6 6 6 6 6 6 | CGG 8 8 8 8 8 8
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 4 4 4 4 | Thr ACT 1 1 1 1 1 1 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 8 8 8 8 8 8 | ACC 4 4 4 4 4 4 | AAC 3 3 3 3 3 3 | AGC 2 2 2 2 2 2
ATA 1 1 1 1 1 1 | ACA 3 3 3 3 3 3 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 3 3 3 3 3 3 | AAG 2 2 2 2 2 2 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 5 5 5 | Ala GCT 10 10 10 10 10 10 | Asp GAT 13 13 13 13 13 13 | Gly GGT 15 15 15 15 15 15
GTC 8 8 8 8 8 8 | GCC 15 15 15 15 15 15 | GAC 15 15 15 15 15 15 | GGC 13 13 13 13 13 13
GTA 5 5 5 5 5 5 | GCA 9 9 9 9 9 9 | Glu GAA 2 2 2 2 2 2 | GGA 4 4 4 4 4 4
GTG 19 19 19 19 19 19 | GCG 18 18 18 18 18 18 | GAG 7 7 7 7 7 7 | GGG 14 14 14 14 14 14
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908471_1_1781_MLBR_RS08440
position 1: T:0.13231 C:0.22154 A:0.11692 G:0.52923
position 2: T:0.27077 C:0.27385 A:0.19692 G:0.25846
position 3: T:0.22154 C:0.30154 A:0.11385 G:0.36308
Average T:0.20821 C:0.26564 A:0.14256 G:0.38359
#2: NC_002677_1_NP_302150_1_1022_thiL
position 1: T:0.13231 C:0.22154 A:0.11692 G:0.52923
position 2: T:0.27077 C:0.27385 A:0.19692 G:0.25846
position 3: T:0.22154 C:0.30154 A:0.11385 G:0.36308
Average T:0.20821 C:0.26564 A:0.14256 G:0.38359
#3: NZ_LVXE01000025_1_WP_010908471_1_1047_A3216_RS08090
position 1: T:0.13231 C:0.22154 A:0.11692 G:0.52923
position 2: T:0.27077 C:0.27385 A:0.19692 G:0.25846
position 3: T:0.22154 C:0.30154 A:0.11385 G:0.36308
Average T:0.20821 C:0.26564 A:0.14256 G:0.38359
#4: NZ_LYPH01000028_1_WP_010908471_1_1129_A8144_RS05420
position 1: T:0.13231 C:0.22154 A:0.11692 G:0.52923
position 2: T:0.27077 C:0.27385 A:0.19692 G:0.25846
position 3: T:0.22154 C:0.30154 A:0.11385 G:0.36308
Average T:0.20821 C:0.26564 A:0.14256 G:0.38359
#5: NZ_CP029543_1_WP_010908471_1_1809_DIJ64_RS09205
position 1: T:0.13231 C:0.22154 A:0.11692 G:0.52923
position 2: T:0.27077 C:0.27385 A:0.19692 G:0.25846
position 3: T:0.22154 C:0.30154 A:0.11385 G:0.36308
Average T:0.20821 C:0.26564 A:0.14256 G:0.38359
#6: NZ_AP014567_1_WP_010908471_1_1856_JK2ML_RS09440
position 1: T:0.13231 C:0.22154 A:0.11692 G:0.52923
position 2: T:0.27077 C:0.27385 A:0.19692 G:0.25846
position 3: T:0.22154 C:0.30154 A:0.11385 G:0.36308
Average T:0.20821 C:0.26564 A:0.14256 G:0.38359
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 18 | Tyr Y TAT 12 | Cys C TGT 18
TTC 36 | TCC 36 | TAC 0 | TGC 12
Leu L TTA 12 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 30 | TCG 12 | TAG 0 | Trp W TGG 54
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 24 | His H CAT 30 | Arg R CGT 18
CTC 18 | CCC 6 | CAC 24 | CGC 48
CTA 6 | CCA 12 | Gln Q CAA 18 | CGA 6
CTG 84 | CCG 36 | CAG 36 | CGG 48
------------------------------------------------------------------------------
Ile I ATT 24 | Thr T ACT 6 | Asn N AAT 0 | Ser S AGT 0
ATC 48 | ACC 24 | AAC 18 | AGC 12
ATA 6 | ACA 18 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 18 | ACG 18 | AAG 12 | AGG 12
------------------------------------------------------------------------------
Val V GTT 30 | Ala A GCT 60 | Asp D GAT 78 | Gly G GGT 90
GTC 48 | GCC 90 | GAC 90 | GGC 78
GTA 30 | GCA 54 | Glu E GAA 12 | GGA 24
GTG 114 | GCG 108 | GAG 42 | GGG 84
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13231 C:0.22154 A:0.11692 G:0.52923
position 2: T:0.27077 C:0.27385 A:0.19692 G:0.25846
position 3: T:0.22154 C:0.30154 A:0.11385 G:0.36308
Average T:0.20821 C:0.26564 A:0.14256 G:0.38359
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -1254.998040 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300026 1.299937
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908471_1_1781_MLBR_RS08440: 0.000004, NC_002677_1_NP_302150_1_1022_thiL: 0.000004, NZ_LVXE01000025_1_WP_010908471_1_1047_A3216_RS08090: 0.000004, NZ_LYPH01000028_1_WP_010908471_1_1129_A8144_RS05420: 0.000004, NZ_CP029543_1_WP_010908471_1_1809_DIJ64_RS09205: 0.000004, NZ_AP014567_1_WP_010908471_1_1856_JK2ML_RS09440: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30003
omega (dN/dS) = 1.29994
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 684.3 290.7 1.2999 0.0000 0.0000 0.0 0.0
7..2 0.000 684.3 290.7 1.2999 0.0000 0.0000 0.0 0.0
7..3 0.000 684.3 290.7 1.2999 0.0000 0.0000 0.0 0.0
7..4 0.000 684.3 290.7 1.2999 0.0000 0.0000 0.0 0.0
7..5 0.000 684.3 290.7 1.2999 0.0000 0.0000 0.0 0.0
7..6 0.000 684.3 290.7 1.2999 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1254.997821 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.292834 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908471_1_1781_MLBR_RS08440: 0.000004, NC_002677_1_NP_302150_1_1022_thiL: 0.000004, NZ_LVXE01000025_1_WP_010908471_1_1047_A3216_RS08090: 0.000004, NZ_LYPH01000028_1_WP_010908471_1_1129_A8144_RS05420: 0.000004, NZ_CP029543_1_WP_010908471_1_1809_DIJ64_RS09205: 0.000004, NZ_AP014567_1_WP_010908471_1_1856_JK2ML_RS09440: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29283
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 684.4 290.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 684.4 290.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 684.4 290.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 684.4 290.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 684.4 290.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 684.4 290.6 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1254.997776 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908471_1_1781_MLBR_RS08440: 0.000004, NC_002677_1_NP_302150_1_1022_thiL: 0.000004, NZ_LVXE01000025_1_WP_010908471_1_1047_A3216_RS08090: 0.000004, NZ_LYPH01000028_1_WP_010908471_1_1129_A8144_RS05420: 0.000004, NZ_CP029543_1_WP_010908471_1_1809_DIJ64_RS09205: 0.000004, NZ_AP014567_1_WP_010908471_1_1856_JK2ML_RS09440: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 691.0 284.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 691.0 284.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 691.0 284.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 691.0 284.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 691.0 284.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 691.0 284.0 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908471_1_1781_MLBR_RS08440)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1254.997776 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 17.755993
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908471_1_1781_MLBR_RS08440: 0.000004, NC_002677_1_NP_302150_1_1022_thiL: 0.000004, NZ_LVXE01000025_1_WP_010908471_1_1047_A3216_RS08090: 0.000004, NZ_LYPH01000028_1_WP_010908471_1_1129_A8144_RS05420: 0.000004, NZ_CP029543_1_WP_010908471_1_1809_DIJ64_RS09205: 0.000004, NZ_AP014567_1_WP_010908471_1_1856_JK2ML_RS09440: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 17.75599
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 691.0 284.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 691.0 284.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 691.0 284.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 691.0 284.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 691.0 284.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 691.0 284.0 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1254.997776 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.283988 1.579932
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908471_1_1781_MLBR_RS08440: 0.000004, NC_002677_1_NP_302150_1_1022_thiL: 0.000004, NZ_LVXE01000025_1_WP_010908471_1_1047_A3216_RS08090: 0.000004, NZ_LYPH01000028_1_WP_010908471_1_1129_A8144_RS05420: 0.000004, NZ_CP029543_1_WP_010908471_1_1809_DIJ64_RS09205: 0.000004, NZ_AP014567_1_WP_010908471_1_1856_JK2ML_RS09440: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.28399
(p1 = 0.00001) w = 1.57993
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.57993
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 691.0 284.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 691.0 284.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 691.0 284.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 691.0 284.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 691.0 284.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 691.0 284.0 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908471_1_1781_MLBR_RS08440)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.095 0.096 0.097 0.098 0.099 0.100 0.102 0.103 0.104 0.105
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.104 0.103 0.102 0.101 0.100 0.099 0.099 0.098 0.097 0.096
Time used: 0:14