--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:34:12 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/thyX/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1039.27         -1042.91
2      -1039.24         -1042.46
--------------------------------------
TOTAL    -1039.25         -1042.71
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.906651    0.089087    0.367455    1.488333    0.872747   1247.01   1374.00    1.000
r(A<->C){all}   0.170110    0.020446    0.000062    0.459721    0.135533    132.44    238.38    1.004
r(A<->G){all}   0.162623    0.018790    0.000039    0.450589    0.124494    187.40    209.16    1.006
r(A<->T){all}   0.155769    0.017596    0.000074    0.423604    0.120149    199.74    260.12    1.000
r(C<->G){all}   0.170961    0.020309    0.000065    0.447991    0.131734    219.66    242.99    1.000
r(C<->T){all}   0.173705    0.020863    0.000058    0.462985    0.135792    229.23    250.35    1.003
r(G<->T){all}   0.166832    0.020063    0.000009    0.448450    0.133013    256.66    310.75    1.008
pi(A){all}      0.193255    0.000208    0.163342    0.219337    0.193171   1139.31   1320.15    1.000
pi(C){all}      0.313257    0.000281    0.280713    0.346086    0.313298    985.73   1050.07    1.001
pi(G){all}      0.296136    0.000264    0.265751    0.329009    0.296122   1182.87   1200.98    1.000
pi(T){all}      0.197351    0.000216    0.169294    0.226298    0.196975   1169.89   1189.96    1.000
alpha{1,2}      0.420732    0.225922    0.000145    1.383276    0.249502    985.17   1152.80    1.000
alpha{3}        0.461734    0.239803    0.000198    1.412645    0.299766    861.62    932.52    1.000
pinvar{all}     0.997946    0.000006    0.993457    1.000000    0.998715   1333.52   1353.45    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-998.155347
Model 2: PositiveSelection	-998.155347
Model 0: one-ratio	-998.155418
Model 7: beta	-998.155347
Model 8: beta&w>1	-998.155347


Model 0 vs 1	1.4200000009623182E-4

Model 2 vs 1	0.0

Model 8 vs 7	0.0
>C1
VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
ATEA
>C2
VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
ATEA
>C3
VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
ATEA
>C4
VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
ATEA
>C5
VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
ATEA
>C6
VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
ATEA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=254 

C1              VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
C2              VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
C3              VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
C4              VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
C5              VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
C6              VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
                **************************************************

C1              NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
C2              NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
C3              NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
C4              NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
C5              NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
C6              NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
                **************************************************

C1              YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
C2              YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
C3              YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
C4              YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
C5              YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
C6              YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
                **************************************************

C1              NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
C2              NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
C3              NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
C4              NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
C5              NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
C6              NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
                **************************************************

C1              AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
C2              AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
C3              AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
C4              AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
C5              AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
C6              AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
                **************************************************

C1              ATEA
C2              ATEA
C3              ATEA
C4              ATEA
C5              ATEA
C6              ATEA
                ****




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  254 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7620]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [7620]--->[7620]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.484 Mb, Max= 30.797 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
C2              VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
C3              VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
C4              VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
C5              VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
C6              VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
                **************************************************

C1              NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
C2              NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
C3              NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
C4              NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
C5              NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
C6              NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
                **************************************************

C1              YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
C2              YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
C3              YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
C4              YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
C5              YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
C6              YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
                **************************************************

C1              NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
C2              NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
C3              NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
C4              NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
C5              NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
C6              NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
                **************************************************

C1              AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
C2              AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
C3              AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
C4              AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
C5              AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
C6              AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
                **************************************************

C1              ATEA
C2              ATEA
C3              ATEA
C4              ATEA
C5              ATEA
C6              ATEA
                ****




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT
C2              GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT
C3              GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT
C4              GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT
C5              GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT
C6              GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT
                **************************************************

C1              TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG
C2              TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG
C3              TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG
C4              TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG
C5              TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG
C6              TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG
                **************************************************

C1              CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC
C2              CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC
C3              CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC
C4              CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC
C5              CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC
C6              CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC
                **************************************************

C1              AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT
C2              AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT
C3              AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT
C4              AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT
C5              AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT
C6              AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT
                **************************************************

C1              CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG
C2              CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG
C3              CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG
C4              CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG
C5              CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG
C6              CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG
                **************************************************

C1              GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC
C2              GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC
C3              GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC
C4              GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC
C5              GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC
C6              GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC
                **************************************************

C1              TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT
C2              TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT
C3              TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT
C4              TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT
C5              TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT
C6              TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT
                **************************************************

C1              TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG
C2              TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG
C3              TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG
C4              TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG
C5              TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG
C6              TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG
                **************************************************

C1              CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG
C2              CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG
C3              CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG
C4              CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG
C5              CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG
C6              CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG
                **************************************************

C1              AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG
C2              AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG
C3              AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG
C4              AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG
C5              AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG
C6              AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG
                **************************************************

C1              GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG
C2              GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG
C3              GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG
C4              GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG
C5              GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG
C6              GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG
                **************************************************

C1              AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC
C2              AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC
C3              AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC
C4              AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC
C5              AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC
C6              AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC
                **************************************************

C1              GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT
C2              GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT
C3              GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT
C4              GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT
C5              GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT
C6              GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT
                **************************************************

C1              TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT
C2              TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT
C3              TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT
C4              TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT
C5              TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT
C6              TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT
                **************************************************

C1              TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA
C2              TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA
C3              TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA
C4              TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA
C5              TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA
C6              TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA
                **************************************************

C1              GCCACCGAAGCT
C2              GCCACCGAAGCT
C3              GCCACCGAAGCT
C4              GCCACCGAAGCT
C5              GCCACCGAAGCT
C6              GCCACCGAAGCT
                ************



>C1
GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT
TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG
CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC
AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT
CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG
GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC
TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT
TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG
CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG
AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG
GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG
AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC
GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT
TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT
TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA
GCCACCGAAGCT
>C2
GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT
TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG
CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC
AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT
CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG
GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC
TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT
TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG
CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG
AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG
GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG
AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC
GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT
TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT
TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA
GCCACCGAAGCT
>C3
GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT
TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG
CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC
AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT
CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG
GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC
TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT
TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG
CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG
AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG
GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG
AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC
GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT
TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT
TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA
GCCACCGAAGCT
>C4
GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT
TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG
CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC
AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT
CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG
GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC
TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT
TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG
CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG
AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG
GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG
AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC
GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT
TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT
TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA
GCCACCGAAGCT
>C5
GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT
TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG
CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC
AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT
CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG
GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC
TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT
TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG
CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG
AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG
GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG
AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC
GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT
TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT
TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA
GCCACCGAAGCT
>C6
GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT
TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG
CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC
AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT
CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG
GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC
TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT
TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG
CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG
AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG
GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG
AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC
GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT
TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT
TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA
GCCACCGAAGCT
>C1
VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
ATEA
>C2
VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
ATEA
>C3
VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
ATEA
>C4
VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
ATEA
>C5
VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
ATEA
>C6
VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
ATEA


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 762 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579789951
      Setting output file names to "/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 890514379
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0894829762
      Seed = 844493217
      Swapseed = 1579789951
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1705.392532 -- -24.965149
         Chain 2 -- -1705.392435 -- -24.965149
         Chain 3 -- -1705.392272 -- -24.965149
         Chain 4 -- -1705.392435 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1705.392435 -- -24.965149
         Chain 2 -- -1705.392532 -- -24.965149
         Chain 3 -- -1705.392532 -- -24.965149
         Chain 4 -- -1705.392435 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1705.393] (-1705.392) (-1705.392) (-1705.392) * [-1705.392] (-1705.393) (-1705.393) (-1705.392) 
        500 -- (-1056.000) [-1049.796] (-1055.313) (-1063.708) * (-1047.242) (-1055.240) (-1059.615) [-1053.616] -- 0:00:00
       1000 -- [-1056.106] (-1045.899) (-1048.276) (-1056.070) * (-1044.712) [-1048.042] (-1050.064) (-1054.872) -- 0:00:00
       1500 -- (-1052.279) (-1052.982) [-1047.744] (-1049.626) * (-1048.328) [-1048.049] (-1052.658) (-1045.795) -- 0:00:00
       2000 -- [-1046.465] (-1051.181) (-1052.277) (-1047.205) * (-1048.541) [-1044.178] (-1051.854) (-1053.067) -- 0:00:00
       2500 -- (-1053.839) (-1045.905) [-1052.062] (-1045.735) * (-1058.034) (-1050.953) (-1045.293) [-1047.984] -- 0:00:00
       3000 -- (-1057.326) (-1048.731) [-1048.709] (-1050.223) * (-1046.398) (-1050.206) [-1043.702] (-1042.091) -- 0:00:00
       3500 -- (-1051.165) (-1053.418) [-1046.550] (-1048.680) * (-1056.699) (-1051.381) (-1050.628) [-1049.093] -- 0:00:00
       4000 -- (-1052.919) (-1047.426) (-1054.791) [-1050.144] * [-1044.457] (-1046.665) (-1052.880) (-1051.853) -- 0:00:00
       4500 -- (-1054.651) [-1046.575] (-1052.411) (-1048.085) * (-1046.572) [-1047.749] (-1051.934) (-1053.423) -- 0:00:00
       5000 -- (-1050.090) (-1048.564) [-1043.668] (-1058.161) * [-1045.841] (-1051.117) (-1056.774) (-1047.900) -- 0:00:00

      Average standard deviation of split frequencies: 0.094281

       5500 -- (-1050.582) [-1047.883] (-1054.439) (-1057.244) * [-1047.667] (-1053.772) (-1049.075) (-1046.596) -- 0:00:00
       6000 -- [-1046.389] (-1049.293) (-1053.064) (-1051.042) * (-1052.135) (-1052.143) (-1055.173) [-1049.827] -- 0:00:00
       6500 -- (-1056.708) [-1045.777] (-1045.938) (-1050.447) * (-1049.253) [-1052.149] (-1060.626) (-1048.579) -- 0:00:00
       7000 -- (-1063.862) [-1046.451] (-1053.551) (-1050.191) * (-1051.868) (-1050.957) (-1054.450) [-1051.596] -- 0:00:00
       7500 -- [-1052.359] (-1049.085) (-1046.399) (-1048.338) * (-1048.877) [-1048.799] (-1055.777) (-1043.192) -- 0:00:00
       8000 -- (-1049.151) [-1046.149] (-1048.667) (-1053.378) * (-1046.296) (-1052.512) [-1053.096] (-1045.881) -- 0:00:00
       8500 -- (-1049.168) (-1045.640) (-1055.244) [-1044.221] * (-1055.666) (-1045.585) (-1044.298) [-1045.602] -- 0:00:00
       9000 -- [-1048.712] (-1051.974) (-1052.290) (-1053.116) * (-1050.351) [-1048.391] (-1048.384) (-1051.140) -- 0:00:00
       9500 -- (-1053.878) [-1054.291] (-1054.751) (-1050.346) * (-1048.570) [-1053.253] (-1049.320) (-1053.694) -- 0:00:00
      10000 -- (-1051.476) [-1049.831] (-1054.111) (-1048.964) * [-1048.940] (-1052.416) (-1051.220) (-1052.485) -- 0:00:00

      Average standard deviation of split frequencies: 0.081410

      10500 -- (-1043.319) [-1050.467] (-1047.840) (-1046.217) * (-1051.470) (-1047.565) (-1050.854) [-1043.921] -- 0:01:34
      11000 -- (-1062.889) (-1048.245) (-1043.065) [-1045.492] * (-1050.875) (-1044.319) (-1056.233) [-1052.955] -- 0:01:29
      11500 -- (-1050.559) (-1051.935) [-1045.625] (-1048.954) * (-1055.881) (-1060.835) (-1054.173) [-1050.712] -- 0:01:25
      12000 -- [-1047.112] (-1061.256) (-1045.654) (-1051.090) * (-1057.461) (-1045.557) [-1045.804] (-1057.222) -- 0:01:22
      12500 -- (-1053.420) (-1050.979) [-1049.276] (-1056.504) * (-1055.862) (-1051.128) (-1046.388) [-1051.576] -- 0:01:19
      13000 -- [-1047.327] (-1046.569) (-1048.533) (-1047.807) * (-1047.122) (-1052.863) [-1046.316] (-1051.599) -- 0:01:15
      13500 -- (-1043.816) (-1044.541) [-1054.362] (-1056.324) * (-1050.161) [-1045.171] (-1048.904) (-1052.387) -- 0:01:13
      14000 -- (-1042.019) (-1048.910) [-1055.061] (-1045.834) * (-1052.863) (-1052.252) [-1050.243] (-1047.149) -- 0:01:10
      14500 -- (-1039.738) (-1051.547) [-1050.058] (-1048.060) * (-1048.267) (-1053.395) [-1048.182] (-1050.338) -- 0:01:07
      15000 -- [-1039.597] (-1045.744) (-1052.926) (-1049.265) * [-1052.447] (-1045.366) (-1052.021) (-1047.803) -- 0:01:05

      Average standard deviation of split frequencies: 0.055824

      15500 -- (-1040.428) [-1050.120] (-1050.038) (-1045.726) * (-1052.429) (-1046.212) (-1046.816) [-1046.909] -- 0:01:03
      16000 -- (-1045.645) (-1049.558) [-1051.649] (-1046.773) * (-1053.365) (-1052.119) [-1051.368] (-1050.285) -- 0:01:01
      16500 -- (-1038.959) (-1045.937) (-1052.569) [-1045.390] * (-1051.056) [-1047.914] (-1047.644) (-1049.442) -- 0:00:59
      17000 -- (-1039.865) (-1051.561) (-1047.143) [-1055.813] * [-1052.135] (-1051.169) (-1046.756) (-1053.610) -- 0:00:57
      17500 -- (-1041.190) (-1047.705) (-1045.348) [-1048.245] * (-1045.085) [-1048.429] (-1051.180) (-1044.185) -- 0:00:56
      18000 -- (-1040.655) (-1054.075) [-1054.047] (-1049.280) * (-1046.792) (-1043.985) (-1055.260) [-1045.603] -- 0:00:54
      18500 -- [-1038.192] (-1051.987) (-1049.523) (-1054.348) * [-1048.269] (-1061.851) (-1049.262) (-1047.926) -- 0:00:53
      19000 -- (-1038.907) [-1046.446] (-1048.138) (-1050.980) * (-1055.890) (-1057.048) [-1049.023] (-1049.863) -- 0:00:51
      19500 -- [-1038.270] (-1047.068) (-1050.545) (-1052.568) * (-1052.938) (-1042.774) [-1042.990] (-1050.264) -- 0:00:50
      20000 -- (-1039.561) (-1047.729) (-1052.227) [-1050.691] * (-1048.062) (-1046.129) [-1048.698] (-1056.808) -- 0:00:49

      Average standard deviation of split frequencies: 0.048154

      20500 -- [-1038.622] (-1044.468) (-1044.627) (-1050.625) * (-1044.130) (-1042.322) [-1047.547] (-1048.218) -- 0:00:47
      21000 -- (-1040.098) (-1055.258) (-1047.261) [-1047.573] * (-1050.753) [-1045.902] (-1047.447) (-1049.054) -- 0:00:46
      21500 -- (-1041.028) (-1046.703) [-1049.455] (-1058.375) * (-1047.489) (-1052.101) (-1048.992) [-1046.801] -- 0:00:45
      22000 -- [-1039.315] (-1044.444) (-1055.629) (-1048.279) * [-1043.912] (-1046.329) (-1047.821) (-1045.788) -- 0:00:44
      22500 -- (-1041.143) [-1043.938] (-1053.994) (-1048.702) * [-1053.166] (-1055.572) (-1055.774) (-1050.017) -- 0:00:43
      23000 -- (-1045.110) (-1048.518) [-1046.249] (-1053.943) * [-1046.706] (-1049.628) (-1049.813) (-1047.633) -- 0:00:42
      23500 -- (-1039.336) (-1053.064) [-1053.578] (-1051.020) * (-1048.864) [-1039.869] (-1046.350) (-1047.851) -- 0:00:41
      24000 -- [-1044.407] (-1047.527) (-1047.373) (-1046.274) * (-1043.708) [-1039.346] (-1053.374) (-1045.286) -- 0:00:40
      24500 -- (-1039.447) [-1048.218] (-1050.779) (-1046.828) * [-1043.439] (-1039.214) (-1057.703) (-1049.814) -- 0:00:39
      25000 -- (-1047.042) [-1050.412] (-1046.244) (-1054.594) * (-1057.674) (-1042.265) (-1045.983) [-1048.761] -- 0:01:18

      Average standard deviation of split frequencies: 0.041442

      25500 -- (-1042.460) (-1054.565) [-1051.719] (-1047.976) * (-1051.000) [-1039.306] (-1044.816) (-1052.677) -- 0:01:16
      26000 -- [-1041.140] (-1057.516) (-1053.169) (-1046.693) * (-1047.613) (-1039.392) [-1045.611] (-1050.829) -- 0:01:14
      26500 -- (-1045.352) (-1051.469) (-1045.370) [-1047.859] * (-1049.367) (-1041.047) (-1052.855) [-1046.892] -- 0:01:13
      27000 -- (-1046.447) (-1042.800) [-1045.630] (-1047.386) * (-1042.849) (-1048.703) (-1047.657) [-1049.665] -- 0:01:12
      27500 -- (-1039.268) (-1043.862) (-1049.122) [-1050.266] * (-1045.815) (-1043.606) [-1051.615] (-1050.267) -- 0:01:10
      28000 -- (-1042.302) (-1042.282) [-1047.723] (-1053.476) * [-1047.478] (-1040.987) (-1052.045) (-1049.541) -- 0:01:09
      28500 -- (-1042.774) [-1042.004] (-1046.535) (-1047.322) * (-1049.625) [-1039.330] (-1051.458) (-1042.462) -- 0:01:08
      29000 -- [-1041.042] (-1041.199) (-1046.438) (-1043.906) * (-1053.467) (-1042.931) (-1047.313) [-1056.998] -- 0:01:06
      29500 -- (-1041.404) (-1039.336) [-1043.287] (-1051.182) * (-1053.614) [-1038.906] (-1044.267) (-1052.886) -- 0:01:05
      30000 -- (-1040.041) (-1041.955) (-1045.867) [-1046.345] * (-1049.350) [-1041.085] (-1051.678) (-1047.744) -- 0:01:04

      Average standard deviation of split frequencies: 0.029207

      30500 -- (-1044.680) (-1040.999) (-1048.489) [-1048.253] * (-1049.786) (-1040.680) (-1049.430) [-1053.030] -- 0:01:03
      31000 -- [-1040.609] (-1041.653) (-1054.897) (-1051.023) * [-1048.493] (-1040.833) (-1049.794) (-1044.866) -- 0:01:02
      31500 -- (-1039.717) (-1045.472) (-1056.316) [-1049.862] * (-1051.721) (-1042.787) (-1055.254) [-1044.624] -- 0:01:01
      32000 -- (-1039.913) (-1041.587) [-1047.980] (-1047.901) * (-1045.166) (-1039.123) (-1050.779) [-1044.838] -- 0:01:00
      32500 -- [-1041.746] (-1040.954) (-1056.383) (-1055.918) * (-1049.026) (-1037.688) (-1043.139) [-1046.307] -- 0:00:59
      33000 -- (-1039.038) (-1041.607) [-1045.681] (-1044.256) * [-1048.435] (-1038.552) (-1056.007) (-1054.451) -- 0:00:58
      33500 -- [-1038.825] (-1038.833) (-1055.947) (-1046.031) * (-1055.023) [-1038.967] (-1052.826) (-1053.568) -- 0:00:57
      34000 -- (-1040.162) [-1038.205] (-1053.704) (-1053.512) * (-1056.505) (-1038.942) [-1047.420] (-1055.291) -- 0:00:56
      34500 -- (-1039.108) [-1039.117] (-1044.332) (-1049.143) * (-1049.809) [-1038.486] (-1053.112) (-1064.804) -- 0:00:55
      35000 -- (-1038.274) [-1039.861] (-1053.118) (-1051.363) * (-1042.906) (-1040.224) (-1046.875) [-1052.310] -- 0:00:55

      Average standard deviation of split frequencies: 0.027499

      35500 -- (-1038.058) (-1042.080) (-1052.547) [-1053.864] * (-1050.130) (-1038.967) [-1046.784] (-1052.531) -- 0:00:54
      36000 -- (-1038.085) [-1038.623] (-1048.380) (-1056.271) * (-1054.184) [-1039.652] (-1049.608) (-1045.912) -- 0:00:53
      36500 -- [-1037.675] (-1038.422) (-1047.144) (-1045.876) * (-1043.895) (-1041.185) [-1045.647] (-1052.103) -- 0:00:52
      37000 -- (-1038.434) [-1039.514] (-1049.304) (-1045.819) * (-1050.873) (-1040.212) (-1047.318) [-1045.207] -- 0:00:52
      37500 -- (-1040.160) (-1038.462) (-1049.750) [-1045.627] * (-1048.153) (-1038.381) (-1050.046) [-1048.063] -- 0:00:51
      38000 -- (-1045.243) (-1037.778) [-1053.605] (-1048.309) * (-1050.619) (-1039.532) (-1047.048) [-1050.803] -- 0:00:50
      38500 -- (-1045.377) [-1038.916] (-1050.274) (-1053.464) * (-1049.772) (-1040.825) (-1050.062) [-1051.445] -- 0:00:49
      39000 -- [-1039.723] (-1037.940) (-1052.589) (-1051.970) * (-1050.356) [-1041.756] (-1047.508) (-1047.861) -- 0:00:49
      39500 -- [-1039.719] (-1039.123) (-1050.337) (-1044.941) * [-1049.352] (-1040.053) (-1056.619) (-1065.865) -- 0:00:48
      40000 -- (-1038.718) (-1039.106) (-1056.233) [-1044.694] * (-1045.614) [-1039.290] (-1047.843) (-1049.505) -- 0:01:12

      Average standard deviation of split frequencies: 0.023184

      40500 -- (-1039.001) [-1039.612] (-1054.573) (-1057.451) * (-1077.836) [-1038.569] (-1055.036) (-1043.510) -- 0:01:11
      41000 -- (-1039.458) [-1039.286] (-1046.802) (-1055.015) * (-1053.920) (-1043.886) (-1039.509) [-1048.341] -- 0:01:10
      41500 -- [-1042.209] (-1042.375) (-1044.060) (-1046.399) * (-1043.508) (-1041.534) [-1040.407] (-1052.356) -- 0:01:09
      42000 -- (-1041.206) (-1041.521) (-1052.921) [-1044.824] * (-1046.590) (-1039.301) (-1040.675) [-1045.404] -- 0:01:08
      42500 -- [-1039.263] (-1040.671) (-1059.115) (-1044.712) * (-1038.460) (-1038.769) (-1042.805) [-1049.078] -- 0:01:07
      43000 -- (-1040.337) [-1044.978] (-1086.426) (-1048.691) * [-1039.657] (-1039.058) (-1039.520) (-1043.806) -- 0:01:06
      43500 -- [-1039.370] (-1044.723) (-1051.210) (-1050.500) * (-1040.307) [-1045.174] (-1037.866) (-1049.766) -- 0:01:05
      44000 -- (-1041.244) [-1041.445] (-1041.244) (-1049.226) * (-1038.411) (-1041.354) (-1039.733) [-1048.950] -- 0:01:05
      44500 -- [-1041.493] (-1037.789) (-1039.312) (-1054.517) * [-1038.226] (-1039.339) (-1038.166) (-1046.195) -- 0:01:04
      45000 -- (-1041.393) (-1038.097) (-1038.793) [-1045.127] * (-1044.160) (-1043.211) (-1039.551) [-1049.638] -- 0:01:03

      Average standard deviation of split frequencies: 0.024400

      45500 -- (-1040.886) [-1038.161] (-1037.883) (-1042.341) * (-1042.760) (-1044.192) [-1039.010] (-1053.317) -- 0:01:02
      46000 -- (-1038.647) (-1038.290) (-1040.380) [-1045.773] * (-1047.218) (-1040.208) [-1038.131] (-1045.344) -- 0:01:02
      46500 -- (-1039.592) (-1037.958) [-1039.780] (-1048.614) * (-1045.694) (-1038.757) (-1038.492) [-1047.353] -- 0:01:01
      47000 -- (-1040.389) [-1037.900] (-1039.850) (-1051.195) * (-1042.066) (-1038.711) (-1039.039) [-1045.938] -- 0:01:00
      47500 -- (-1039.962) [-1040.370] (-1039.325) (-1047.935) * (-1039.511) (-1039.309) [-1038.188] (-1049.120) -- 0:01:00
      48000 -- (-1039.775) (-1039.131) [-1040.561] (-1046.342) * (-1037.674) (-1042.373) (-1040.038) [-1048.356] -- 0:00:59
      48500 -- (-1041.428) (-1041.044) [-1039.247] (-1046.350) * (-1042.881) [-1038.247] (-1039.691) (-1056.542) -- 0:00:58
      49000 -- (-1040.718) (-1040.894) (-1038.944) [-1051.134] * (-1040.668) (-1039.235) (-1038.825) [-1046.915] -- 0:00:58
      49500 -- (-1042.049) [-1042.271] (-1041.642) (-1060.224) * (-1039.991) (-1039.782) [-1038.582] (-1046.624) -- 0:00:57
      50000 -- (-1039.272) [-1041.150] (-1042.028) (-1061.026) * (-1040.203) [-1038.880] (-1041.818) (-1053.675) -- 0:00:57

      Average standard deviation of split frequencies: 0.023725

      50500 -- (-1039.219) (-1042.716) (-1040.727) [-1041.849] * [-1040.002] (-1043.407) (-1041.162) (-1052.055) -- 0:00:56
      51000 -- (-1039.914) [-1041.391] (-1039.883) (-1041.628) * [-1040.859] (-1042.493) (-1040.771) (-1049.639) -- 0:00:55
      51500 -- [-1039.067] (-1038.473) (-1038.712) (-1039.684) * (-1039.114) [-1046.501] (-1039.708) (-1056.066) -- 0:00:55
      52000 -- (-1040.053) (-1042.155) [-1039.828] (-1040.981) * [-1038.897] (-1046.605) (-1041.022) (-1051.726) -- 0:00:54
      52500 -- (-1040.394) [-1040.775] (-1038.725) (-1039.999) * [-1040.736] (-1046.377) (-1040.965) (-1052.661) -- 0:00:54
      53000 -- (-1042.551) (-1046.327) [-1041.575] (-1039.403) * (-1043.172) (-1038.444) (-1041.763) [-1048.053] -- 0:00:53
      53500 -- [-1039.330] (-1044.349) (-1041.482) (-1041.420) * (-1042.791) [-1038.769] (-1042.931) (-1054.365) -- 0:00:53
      54000 -- [-1041.264] (-1043.144) (-1037.960) (-1040.074) * (-1039.976) [-1039.829] (-1039.103) (-1048.040) -- 0:00:52
      54500 -- (-1040.076) (-1037.757) [-1037.960] (-1039.933) * (-1040.561) (-1040.897) [-1042.288] (-1051.670) -- 0:00:52
      55000 -- (-1041.171) [-1038.063] (-1039.762) (-1040.206) * (-1039.005) (-1038.124) (-1041.679) [-1051.561] -- 0:00:51

      Average standard deviation of split frequencies: 0.029684

      55500 -- (-1042.743) (-1039.870) [-1038.217] (-1038.536) * (-1038.829) (-1038.085) (-1039.590) [-1045.746] -- 0:01:08
      56000 -- (-1047.290) (-1039.830) (-1039.321) [-1039.683] * (-1043.985) (-1038.394) (-1040.089) [-1051.090] -- 0:01:07
      56500 -- (-1038.377) (-1040.735) [-1039.322] (-1039.592) * (-1042.330) (-1038.310) (-1039.724) [-1048.811] -- 0:01:06
      57000 -- (-1038.499) [-1039.199] (-1039.355) (-1038.276) * (-1040.727) (-1038.967) (-1040.056) [-1050.792] -- 0:01:06
      57500 -- (-1038.454) [-1039.945] (-1038.914) (-1040.098) * (-1043.242) [-1040.166] (-1041.172) (-1055.984) -- 0:01:05
      58000 -- [-1039.017] (-1043.014) (-1041.282) (-1042.358) * (-1042.554) (-1038.319) (-1039.745) [-1043.388] -- 0:01:04
      58500 -- (-1040.445) (-1041.071) [-1041.320] (-1041.430) * (-1040.319) [-1038.202] (-1040.606) (-1056.185) -- 0:01:04
      59000 -- [-1041.585] (-1039.219) (-1040.497) (-1040.208) * (-1040.596) [-1037.637] (-1041.649) (-1049.603) -- 0:01:03
      59500 -- (-1040.745) [-1039.673] (-1041.265) (-1040.331) * (-1041.526) (-1043.424) (-1040.646) [-1044.612] -- 0:01:03
      60000 -- [-1039.478] (-1040.870) (-1040.102) (-1039.377) * (-1040.704) (-1039.238) [-1041.375] (-1045.048) -- 0:01:02

      Average standard deviation of split frequencies: 0.031900

      60500 -- (-1038.957) [-1041.763] (-1039.704) (-1040.126) * (-1043.658) (-1041.409) [-1040.888] (-1052.977) -- 0:01:02
      61000 -- (-1043.195) (-1039.565) (-1039.638) [-1041.181] * (-1040.895) [-1040.389] (-1040.669) (-1049.034) -- 0:01:01
      61500 -- (-1038.167) (-1038.729) (-1046.104) [-1038.615] * (-1039.203) (-1039.497) (-1039.537) [-1050.414] -- 0:01:01
      62000 -- (-1038.307) [-1041.037] (-1041.166) (-1039.282) * (-1039.751) [-1039.003] (-1040.949) (-1046.276) -- 0:01:00
      62500 -- (-1038.668) [-1042.188] (-1038.210) (-1040.334) * (-1043.653) [-1039.774] (-1040.247) (-1056.397) -- 0:01:00
      63000 -- (-1038.557) [-1040.490] (-1039.156) (-1042.712) * (-1041.031) [-1038.967] (-1040.284) (-1052.401) -- 0:00:59
      63500 -- [-1038.291] (-1039.310) (-1039.595) (-1041.099) * (-1040.539) (-1039.518) [-1042.165] (-1047.034) -- 0:00:58
      64000 -- [-1041.421] (-1042.028) (-1039.739) (-1039.604) * [-1038.074] (-1041.757) (-1040.468) (-1048.436) -- 0:00:58
      64500 -- (-1039.886) (-1040.764) (-1039.499) [-1038.616] * (-1038.472) (-1042.025) (-1039.886) [-1043.931] -- 0:00:58
      65000 -- (-1039.714) [-1040.043] (-1041.394) (-1041.385) * [-1043.741] (-1041.182) (-1042.688) (-1050.121) -- 0:00:57

      Average standard deviation of split frequencies: 0.029869

      65500 -- (-1041.489) (-1038.845) (-1038.773) [-1044.505] * (-1039.519) [-1041.494] (-1039.342) (-1055.125) -- 0:00:57
      66000 -- (-1042.039) (-1039.824) (-1039.903) [-1040.965] * [-1038.858] (-1038.905) (-1040.521) (-1048.307) -- 0:00:56
      66500 -- (-1039.840) [-1039.770] (-1039.583) (-1043.726) * [-1039.501] (-1040.102) (-1040.626) (-1046.403) -- 0:00:56
      67000 -- (-1040.475) (-1039.616) (-1041.564) [-1037.804] * (-1042.411) (-1038.968) (-1039.767) [-1042.399] -- 0:00:55
      67500 -- (-1040.193) (-1043.352) (-1038.856) [-1039.024] * (-1040.036) (-1041.163) (-1041.744) [-1043.156] -- 0:00:55
      68000 -- (-1040.994) (-1043.737) [-1039.403] (-1038.380) * (-1039.828) (-1038.752) (-1040.173) [-1044.289] -- 0:00:54
      68500 -- (-1045.708) (-1040.830) (-1037.781) [-1038.074] * (-1041.719) (-1041.041) [-1041.928] (-1050.952) -- 0:00:54
      69000 -- (-1047.576) (-1039.488) [-1037.627] (-1039.874) * (-1041.113) [-1038.936] (-1041.126) (-1047.900) -- 0:00:53
      69500 -- [-1041.817] (-1044.823) (-1038.156) (-1039.912) * (-1043.217) (-1039.124) [-1042.811] (-1049.706) -- 0:00:53
      70000 -- (-1039.681) (-1040.593) [-1038.706] (-1042.345) * (-1043.873) (-1037.980) [-1041.286] (-1048.922) -- 0:00:53

      Average standard deviation of split frequencies: 0.030928

      70500 -- [-1038.300] (-1039.752) (-1040.414) (-1041.035) * (-1042.609) (-1038.244) (-1038.136) [-1051.650] -- 0:00:52
      71000 -- (-1039.727) (-1040.105) (-1039.982) [-1039.906] * (-1038.334) (-1038.268) (-1039.090) [-1049.121] -- 0:01:05
      71500 -- (-1039.713) (-1040.943) [-1040.380] (-1041.463) * (-1039.917) [-1039.248] (-1038.416) (-1044.974) -- 0:01:04
      72000 -- (-1041.835) [-1040.576] (-1039.146) (-1041.017) * (-1038.730) (-1038.629) [-1038.854] (-1058.222) -- 0:01:04
      72500 -- (-1041.277) (-1041.743) [-1039.228] (-1038.336) * [-1039.430] (-1037.802) (-1049.764) (-1071.704) -- 0:01:03
      73000 -- (-1042.991) (-1040.536) [-1041.490] (-1039.908) * (-1040.895) (-1040.802) [-1044.719] (-1043.280) -- 0:01:03
      73500 -- (-1041.380) (-1041.984) (-1040.024) [-1040.198] * (-1039.048) (-1045.496) (-1042.951) [-1041.806] -- 0:01:03
      74000 -- [-1041.031] (-1039.001) (-1040.384) (-1041.558) * (-1040.243) (-1045.851) [-1040.570] (-1044.987) -- 0:01:02
      74500 -- [-1041.265] (-1038.949) (-1041.804) (-1041.057) * [-1038.413] (-1041.893) (-1040.597) (-1041.385) -- 0:01:02
      75000 -- [-1040.682] (-1041.220) (-1042.845) (-1042.986) * [-1041.355] (-1043.783) (-1041.939) (-1040.788) -- 0:01:01

      Average standard deviation of split frequencies: 0.035355

      75500 -- (-1040.143) (-1042.938) (-1041.404) [-1042.587] * [-1039.981] (-1040.265) (-1042.396) (-1039.098) -- 0:01:01
      76000 -- (-1039.985) [-1038.753] (-1038.490) (-1040.620) * (-1038.502) (-1041.154) (-1042.916) [-1040.560] -- 0:01:00
      76500 -- (-1040.491) [-1037.939] (-1039.272) (-1043.252) * (-1041.213) [-1040.507] (-1040.875) (-1039.371) -- 0:01:00
      77000 -- (-1038.624) [-1037.751] (-1038.662) (-1043.488) * (-1039.235) (-1040.656) (-1040.348) [-1038.237] -- 0:00:59
      77500 -- (-1039.024) [-1038.324] (-1038.451) (-1046.717) * [-1040.443] (-1039.938) (-1038.964) (-1038.332) -- 0:00:59
      78000 -- (-1039.168) (-1039.361) (-1038.193) [-1042.519] * (-1040.749) (-1043.030) (-1038.327) [-1039.989] -- 0:00:59
      78500 -- [-1040.676] (-1039.749) (-1039.869) (-1047.868) * (-1048.537) (-1046.334) (-1038.477) [-1038.059] -- 0:00:58
      79000 -- (-1042.469) [-1040.669] (-1038.307) (-1045.163) * (-1044.541) (-1045.493) (-1038.512) [-1041.530] -- 0:00:58
      79500 -- [-1041.679] (-1039.864) (-1040.050) (-1044.126) * (-1042.884) (-1045.156) (-1039.377) [-1039.673] -- 0:00:57
      80000 -- (-1038.581) [-1038.784] (-1040.055) (-1043.367) * [-1039.344] (-1041.351) (-1046.594) (-1040.393) -- 0:00:57

      Average standard deviation of split frequencies: 0.030388

      80500 -- [-1038.854] (-1037.929) (-1037.751) (-1037.728) * [-1040.304] (-1041.542) (-1039.509) (-1041.149) -- 0:00:57
      81000 -- (-1040.174) (-1039.729) [-1038.445] (-1039.937) * (-1040.319) [-1040.347] (-1039.369) (-1040.180) -- 0:00:56
      81500 -- [-1039.981] (-1039.429) (-1042.965) (-1038.921) * (-1040.165) [-1041.925] (-1038.573) (-1038.911) -- 0:00:56
      82000 -- (-1040.976) (-1039.099) [-1041.326] (-1039.035) * (-1040.427) (-1042.175) (-1038.293) [-1039.255] -- 0:00:55
      82500 -- (-1039.951) (-1039.912) [-1042.664] (-1038.668) * (-1044.132) (-1041.039) (-1039.311) [-1041.079] -- 0:00:55
      83000 -- (-1039.850) [-1038.975] (-1039.332) (-1038.971) * (-1045.337) (-1041.038) (-1040.048) [-1042.866] -- 0:00:55
      83500 -- (-1039.722) [-1039.850] (-1040.724) (-1039.313) * (-1041.446) (-1042.981) [-1041.387] (-1042.377) -- 0:00:54
      84000 -- (-1039.015) [-1041.754] (-1041.895) (-1039.623) * (-1041.021) (-1041.698) [-1041.699] (-1039.250) -- 0:00:54
      84500 -- [-1039.495] (-1040.187) (-1038.234) (-1043.111) * (-1039.762) (-1041.159) [-1041.121] (-1043.005) -- 0:00:54
      85000 -- (-1039.486) (-1043.926) [-1038.867] (-1039.561) * [-1041.354] (-1038.212) (-1040.669) (-1043.818) -- 0:00:53

      Average standard deviation of split frequencies: 0.026660

      85500 -- [-1040.268] (-1040.115) (-1038.978) (-1038.793) * [-1039.548] (-1040.065) (-1039.710) (-1042.395) -- 0:00:53
      86000 -- [-1037.973] (-1038.974) (-1040.228) (-1038.535) * [-1038.691] (-1040.059) (-1039.875) (-1041.595) -- 0:00:53
      86500 -- (-1039.374) (-1038.361) (-1040.960) [-1038.623] * (-1039.180) [-1039.547] (-1039.921) (-1040.589) -- 0:00:52
      87000 -- [-1038.211] (-1039.318) (-1043.966) (-1038.674) * [-1039.927] (-1038.917) (-1043.690) (-1040.860) -- 0:00:52
      87500 -- [-1038.168] (-1037.998) (-1038.780) (-1038.680) * (-1038.512) [-1038.839] (-1041.704) (-1038.920) -- 0:01:02
      88000 -- (-1039.556) (-1038.701) [-1039.760] (-1038.542) * (-1038.048) [-1038.996] (-1042.873) (-1038.250) -- 0:01:02
      88500 -- (-1037.976) [-1038.774] (-1039.263) (-1041.924) * (-1038.547) [-1039.077] (-1040.378) (-1037.922) -- 0:01:01
      89000 -- [-1038.576] (-1040.668) (-1037.886) (-1041.113) * (-1039.817) (-1039.869) (-1040.422) [-1040.551] -- 0:01:01
      89500 -- (-1039.776) (-1039.010) (-1038.972) [-1040.895] * (-1039.492) [-1043.238] (-1042.855) (-1038.529) -- 0:01:01
      90000 -- (-1039.715) (-1038.052) (-1038.946) [-1038.375] * (-1039.212) [-1039.832] (-1040.649) (-1039.997) -- 0:01:00

      Average standard deviation of split frequencies: 0.025524

      90500 -- (-1038.510) (-1039.894) (-1040.119) [-1038.736] * [-1040.741] (-1042.146) (-1038.971) (-1038.972) -- 0:01:00
      91000 -- (-1039.109) (-1042.770) [-1042.128] (-1043.315) * [-1040.504] (-1038.729) (-1039.018) (-1038.546) -- 0:00:59
      91500 -- (-1038.173) (-1044.046) [-1041.726] (-1041.051) * (-1038.860) [-1041.840] (-1043.140) (-1039.807) -- 0:00:59
      92000 -- (-1040.834) (-1046.715) [-1039.303] (-1039.234) * (-1039.045) (-1042.564) (-1038.853) [-1039.661] -- 0:00:59
      92500 -- (-1041.421) (-1045.591) [-1040.963] (-1039.996) * (-1040.344) (-1041.337) (-1041.693) [-1041.056] -- 0:00:58
      93000 -- (-1042.255) (-1042.288) (-1039.786) [-1038.607] * (-1042.454) (-1039.565) [-1040.036] (-1043.627) -- 0:00:58
      93500 -- [-1042.986] (-1039.678) (-1038.982) (-1038.421) * (-1039.828) (-1038.614) (-1040.093) [-1040.031] -- 0:00:58
      94000 -- (-1039.867) (-1039.038) [-1039.246] (-1040.621) * (-1038.098) (-1038.628) [-1038.564] (-1038.743) -- 0:00:57
      94500 -- [-1041.342] (-1039.413) (-1041.520) (-1043.220) * (-1039.280) [-1038.680] (-1038.635) (-1041.221) -- 0:00:57
      95000 -- (-1042.111) (-1041.627) [-1038.617] (-1040.321) * [-1039.078] (-1038.945) (-1042.749) (-1038.573) -- 0:00:57

      Average standard deviation of split frequencies: 0.021746

      95500 -- (-1039.482) [-1039.263] (-1038.498) (-1043.296) * (-1038.978) (-1039.790) (-1040.448) [-1039.152] -- 0:00:56
      96000 -- [-1046.509] (-1039.082) (-1038.486) (-1043.848) * (-1039.799) [-1037.662] (-1039.000) (-1039.111) -- 0:00:56
      96500 -- (-1040.706) (-1038.716) [-1038.591] (-1039.983) * (-1041.053) [-1038.485] (-1043.909) (-1038.478) -- 0:00:56
      97000 -- (-1040.016) (-1039.835) (-1039.835) [-1040.166] * (-1040.353) (-1037.756) [-1042.514] (-1038.974) -- 0:00:55
      97500 -- (-1043.750) (-1040.479) [-1040.589] (-1041.165) * [-1039.161] (-1042.334) (-1043.070) (-1038.993) -- 0:00:55
      98000 -- [-1040.031] (-1041.295) (-1039.360) (-1043.286) * (-1038.682) (-1039.750) [-1040.559] (-1038.948) -- 0:00:55
      98500 -- (-1040.617) [-1041.721] (-1040.158) (-1040.393) * (-1038.066) (-1039.783) (-1039.904) [-1037.864] -- 0:00:54
      99000 -- [-1040.251] (-1043.645) (-1042.193) (-1039.987) * (-1038.026) [-1041.508] (-1042.050) (-1039.722) -- 0:00:54
      99500 -- (-1042.404) (-1045.443) (-1039.961) [-1040.069] * (-1041.917) (-1039.473) (-1042.925) [-1037.830] -- 0:00:54
      100000 -- (-1040.940) (-1041.804) (-1038.676) [-1041.102] * (-1043.586) [-1040.018] (-1041.124) (-1039.400) -- 0:00:54

      Average standard deviation of split frequencies: 0.026926

      100500 -- [-1040.677] (-1040.102) (-1039.514) (-1038.555) * (-1039.854) (-1039.924) (-1039.046) [-1037.830] -- 0:00:53
      101000 -- [-1042.571] (-1039.524) (-1039.522) (-1041.386) * (-1039.806) [-1040.940] (-1042.766) (-1037.740) -- 0:00:53
      101500 -- (-1042.232) (-1040.467) [-1040.574] (-1041.650) * [-1037.924] (-1038.314) (-1044.166) (-1039.728) -- 0:00:53
      102000 -- (-1039.522) (-1041.260) (-1039.047) [-1042.340] * (-1040.106) [-1038.258] (-1042.596) (-1038.733) -- 0:00:52
      102500 -- (-1039.042) (-1038.730) [-1041.029] (-1042.915) * (-1041.222) [-1038.457] (-1042.293) (-1040.904) -- 0:00:52
      103000 -- (-1038.906) (-1038.631) [-1038.791] (-1039.409) * (-1040.847) (-1038.735) [-1045.178] (-1041.806) -- 0:00:52
      103500 -- (-1039.399) (-1039.159) (-1040.247) [-1039.974] * (-1040.547) [-1038.910] (-1038.955) (-1039.936) -- 0:00:51
      104000 -- (-1040.846) (-1038.713) [-1040.005] (-1042.793) * (-1042.422) (-1037.572) [-1040.691] (-1040.531) -- 0:01:00
      104500 -- (-1041.375) (-1039.401) (-1040.055) [-1038.965] * (-1041.719) [-1037.913] (-1039.212) (-1041.225) -- 0:00:59
      105000 -- (-1043.508) [-1039.105] (-1039.845) (-1040.257) * (-1039.889) [-1041.538] (-1040.971) (-1040.160) -- 0:00:59

      Average standard deviation of split frequencies: 0.024566

      105500 -- [-1041.131] (-1039.011) (-1039.709) (-1040.583) * (-1042.909) (-1041.082) [-1041.150] (-1045.356) -- 0:00:59
      106000 -- (-1042.120) [-1038.863] (-1040.224) (-1041.414) * (-1039.498) [-1041.664] (-1043.250) (-1040.140) -- 0:00:59
      106500 -- (-1042.713) (-1039.230) [-1040.259] (-1039.457) * (-1038.671) (-1044.016) (-1040.793) [-1040.438] -- 0:00:58
      107000 -- (-1041.728) (-1039.217) [-1038.561] (-1038.716) * [-1039.623] (-1040.497) (-1039.718) (-1042.068) -- 0:00:58
      107500 -- (-1041.231) (-1039.742) [-1038.399] (-1038.686) * (-1039.428) [-1040.505] (-1041.963) (-1039.717) -- 0:00:58
      108000 -- (-1037.655) (-1039.441) (-1039.011) [-1042.012] * (-1041.896) (-1041.673) [-1046.111] (-1043.114) -- 0:00:57
      108500 -- [-1038.370] (-1039.898) (-1038.404) (-1039.818) * (-1041.320) (-1041.549) (-1045.165) [-1038.899] -- 0:00:57
      109000 -- [-1038.888] (-1041.148) (-1040.455) (-1039.871) * (-1041.825) (-1040.536) [-1042.735] (-1039.399) -- 0:00:57
      109500 -- (-1042.391) (-1039.309) (-1039.529) [-1038.095] * (-1041.259) [-1038.646] (-1039.619) (-1040.464) -- 0:00:56
      110000 -- (-1041.695) [-1039.023] (-1038.617) (-1038.189) * (-1040.482) [-1038.597] (-1045.496) (-1039.334) -- 0:00:56

      Average standard deviation of split frequencies: 0.026836

      110500 -- (-1041.521) (-1039.989) (-1039.834) [-1040.024] * (-1040.125) [-1038.578] (-1040.413) (-1039.536) -- 0:00:56
      111000 -- (-1041.138) (-1043.895) [-1039.309] (-1039.431) * (-1038.800) [-1039.145] (-1039.218) (-1039.651) -- 0:00:56
      111500 -- [-1042.786] (-1039.288) (-1044.428) (-1040.111) * (-1038.760) (-1038.818) (-1041.711) [-1039.646] -- 0:00:55
      112000 -- (-1038.794) (-1039.261) [-1042.083] (-1039.947) * (-1038.682) (-1039.961) [-1038.817] (-1039.878) -- 0:00:55
      112500 -- (-1038.592) (-1039.483) [-1039.281] (-1039.601) * (-1038.517) (-1042.587) [-1041.016] (-1039.456) -- 0:00:55
      113000 -- (-1043.860) (-1040.051) [-1038.960] (-1037.644) * (-1038.506) [-1044.608] (-1042.258) (-1039.516) -- 0:00:54
      113500 -- (-1038.275) (-1041.832) (-1041.576) [-1040.456] * (-1038.480) (-1046.520) [-1041.198] (-1041.598) -- 0:00:54
      114000 -- (-1043.723) (-1041.635) [-1038.944] (-1043.359) * (-1038.774) [-1040.051] (-1039.850) (-1039.109) -- 0:00:54
      114500 -- [-1042.112] (-1046.699) (-1039.507) (-1040.237) * (-1041.281) (-1038.538) [-1043.318] (-1041.241) -- 0:00:54
      115000 -- (-1041.756) (-1041.236) [-1038.087] (-1040.712) * (-1038.982) (-1041.245) (-1041.727) [-1039.802] -- 0:00:53

      Average standard deviation of split frequencies: 0.028447

      115500 -- (-1043.061) [-1038.929] (-1040.496) (-1043.980) * [-1039.257] (-1043.567) (-1040.309) (-1040.190) -- 0:00:53
      116000 -- (-1039.873) [-1037.935] (-1039.438) (-1042.138) * (-1038.378) [-1041.935] (-1040.517) (-1038.924) -- 0:00:53
      116500 -- [-1041.133] (-1039.601) (-1039.697) (-1049.045) * (-1038.114) [-1038.894] (-1039.155) (-1038.936) -- 0:00:53
      117000 -- (-1039.330) (-1038.886) [-1038.697] (-1046.447) * (-1038.000) (-1039.105) [-1041.092] (-1038.040) -- 0:00:52
      117500 -- [-1038.525] (-1039.521) (-1044.572) (-1043.005) * (-1039.567) (-1043.898) (-1041.828) [-1037.819] -- 0:00:52
      118000 -- (-1039.633) [-1039.274] (-1043.025) (-1044.488) * (-1041.058) (-1040.836) (-1041.440) [-1038.221] -- 0:00:52
      118500 -- (-1039.152) [-1042.423] (-1043.223) (-1042.762) * (-1038.569) (-1043.185) (-1041.904) [-1039.715] -- 0:00:52
      119000 -- [-1039.832] (-1038.928) (-1039.739) (-1043.268) * [-1040.358] (-1042.788) (-1039.443) (-1040.689) -- 0:00:51
      119500 -- [-1042.486] (-1038.667) (-1040.120) (-1044.453) * [-1040.077] (-1039.838) (-1038.213) (-1040.379) -- 0:00:51
      120000 -- (-1038.978) (-1040.115) (-1038.209) [-1039.900] * (-1038.727) (-1040.249) (-1040.956) [-1039.970] -- 0:00:51

      Average standard deviation of split frequencies: 0.025702

      120500 -- (-1040.021) (-1043.584) [-1039.660] (-1044.386) * (-1046.272) [-1039.778] (-1041.921) (-1042.230) -- 0:00:58
      121000 -- (-1038.853) (-1039.799) (-1039.917) [-1038.360] * (-1041.938) (-1038.721) (-1041.159) [-1039.728] -- 0:00:58
      121500 -- (-1039.157) (-1042.187) [-1039.585] (-1038.651) * (-1041.939) (-1042.448) (-1040.819) [-1039.483] -- 0:00:57
      122000 -- (-1038.813) [-1041.785] (-1039.895) (-1038.269) * [-1040.934] (-1039.656) (-1042.142) (-1042.627) -- 0:00:57
      122500 -- (-1041.652) (-1039.598) (-1039.409) [-1039.718] * (-1040.368) (-1040.065) (-1039.210) [-1039.965] -- 0:00:57
      123000 -- (-1038.106) [-1040.376] (-1039.466) (-1038.000) * (-1039.279) (-1052.282) (-1043.427) [-1041.438] -- 0:00:57
      123500 -- (-1038.058) (-1038.270) (-1042.174) [-1038.265] * (-1039.645) [-1045.982] (-1041.291) (-1040.159) -- 0:00:56
      124000 -- (-1039.146) (-1039.789) (-1041.844) [-1038.170] * [-1040.545] (-1039.144) (-1047.509) (-1042.388) -- 0:00:56
      124500 -- (-1038.768) [-1040.633] (-1043.173) (-1038.359) * (-1039.227) (-1042.056) (-1039.720) [-1038.115] -- 0:00:56
      125000 -- [-1038.233] (-1039.864) (-1038.774) (-1039.295) * (-1037.718) [-1040.439] (-1039.650) (-1039.867) -- 0:00:56

      Average standard deviation of split frequencies: 0.022804

      125500 -- [-1040.999] (-1038.692) (-1039.673) (-1039.377) * [-1039.720] (-1040.524) (-1038.933) (-1041.606) -- 0:00:55
      126000 -- [-1039.428] (-1038.941) (-1038.061) (-1038.080) * (-1039.851) [-1041.024] (-1039.482) (-1042.578) -- 0:00:55
      126500 -- [-1039.463] (-1040.067) (-1040.218) (-1039.278) * (-1040.469) (-1040.914) [-1039.339] (-1043.953) -- 0:00:55
      127000 -- (-1040.595) (-1041.542) [-1039.949] (-1040.071) * (-1041.522) [-1042.235] (-1039.869) (-1039.276) -- 0:00:54
      127500 -- (-1043.707) (-1039.806) (-1038.215) [-1039.883] * (-1039.118) (-1043.142) [-1040.997] (-1040.718) -- 0:00:54
      128000 -- (-1040.663) (-1038.830) [-1039.198] (-1042.098) * (-1042.003) [-1038.338] (-1038.986) (-1038.853) -- 0:00:54
      128500 -- (-1044.142) (-1039.383) [-1039.461] (-1041.538) * (-1040.015) [-1039.957] (-1043.160) (-1040.283) -- 0:00:54
      129000 -- (-1041.614) (-1039.359) [-1039.612] (-1040.835) * [-1038.602] (-1038.437) (-1041.508) (-1043.093) -- 0:00:54
      129500 -- [-1038.992] (-1042.114) (-1040.688) (-1042.696) * [-1039.263] (-1040.036) (-1041.485) (-1043.903) -- 0:00:53
      130000 -- (-1040.163) (-1040.982) [-1041.502] (-1040.182) * (-1041.784) [-1038.349] (-1040.991) (-1042.866) -- 0:00:53

      Average standard deviation of split frequencies: 0.022007

      130500 -- [-1040.551] (-1042.800) (-1042.326) (-1039.649) * [-1038.817] (-1041.649) (-1041.216) (-1047.624) -- 0:00:53
      131000 -- (-1039.814) (-1039.433) (-1040.320) [-1041.157] * [-1041.894] (-1040.490) (-1039.629) (-1038.759) -- 0:00:53
      131500 -- (-1040.676) [-1038.000] (-1038.813) (-1040.179) * [-1041.227] (-1039.260) (-1040.960) (-1039.784) -- 0:00:52
      132000 -- [-1040.690] (-1037.839) (-1041.669) (-1041.912) * (-1039.436) (-1038.331) [-1041.653] (-1040.164) -- 0:00:52
      132500 -- (-1039.354) (-1041.282) [-1039.358] (-1041.999) * (-1039.675) (-1041.405) (-1041.182) [-1038.443] -- 0:00:52
      133000 -- (-1040.688) (-1041.577) [-1038.181] (-1041.752) * (-1042.033) (-1044.897) (-1038.791) [-1039.078] -- 0:00:52
      133500 -- (-1042.176) [-1041.546] (-1040.956) (-1038.941) * (-1043.939) (-1040.718) (-1040.566) [-1041.151] -- 0:00:51
      134000 -- (-1043.525) [-1042.259] (-1042.559) (-1038.924) * (-1046.592) [-1039.795] (-1038.939) (-1038.669) -- 0:00:58
      134500 -- [-1037.972] (-1038.530) (-1040.652) (-1041.032) * (-1038.619) (-1040.780) [-1039.194] (-1038.667) -- 0:00:57
      135000 -- (-1038.531) (-1038.255) (-1040.743) [-1041.499] * [-1039.104] (-1039.708) (-1040.453) (-1040.321) -- 0:00:57

      Average standard deviation of split frequencies: 0.020137

      135500 -- (-1038.531) (-1037.958) (-1038.227) [-1039.782] * (-1040.035) (-1041.379) (-1044.152) [-1038.905] -- 0:00:57
      136000 -- (-1040.557) (-1038.404) [-1039.932] (-1039.930) * (-1041.895) (-1041.115) (-1041.041) [-1040.053] -- 0:00:57
      136500 -- [-1038.515] (-1038.714) (-1038.581) (-1039.249) * [-1042.056] (-1039.799) (-1040.052) (-1040.480) -- 0:00:56
      137000 -- (-1038.259) [-1039.521] (-1038.581) (-1040.905) * (-1038.219) [-1038.511] (-1039.507) (-1043.019) -- 0:00:56
      137500 -- (-1039.604) (-1040.974) (-1042.248) [-1043.020] * (-1044.708) [-1040.468] (-1039.350) (-1042.971) -- 0:00:56
      138000 -- [-1042.586] (-1039.030) (-1041.808) (-1039.059) * [-1038.280] (-1040.463) (-1039.320) (-1041.312) -- 0:00:56
      138500 -- (-1043.182) (-1037.918) (-1039.922) [-1041.337] * [-1038.491] (-1038.055) (-1039.202) (-1040.390) -- 0:00:55
      139000 -- (-1038.159) (-1040.524) (-1040.305) [-1039.998] * (-1041.521) [-1039.497] (-1040.755) (-1041.355) -- 0:00:55
      139500 -- (-1038.261) [-1042.682] (-1041.828) (-1042.528) * (-1040.391) (-1040.322) (-1039.360) [-1040.127] -- 0:00:55
      140000 -- (-1038.252) [-1041.500] (-1042.424) (-1044.181) * [-1039.383] (-1040.016) (-1040.629) (-1043.408) -- 0:00:55

      Average standard deviation of split frequencies: 0.019755

      140500 -- (-1040.134) (-1041.956) (-1041.772) [-1040.852] * (-1046.483) [-1038.104] (-1039.907) (-1041.311) -- 0:00:55
      141000 -- (-1039.722) (-1043.755) (-1042.190) [-1037.971] * (-1041.156) [-1040.545] (-1040.555) (-1039.775) -- 0:00:54
      141500 -- (-1042.014) [-1044.362] (-1039.493) (-1038.141) * (-1043.127) [-1039.708] (-1043.550) (-1039.146) -- 0:00:54
      142000 -- (-1038.552) [-1038.380] (-1041.156) (-1038.647) * (-1041.557) (-1039.668) (-1044.698) [-1038.275] -- 0:00:54
      142500 -- (-1041.273) (-1041.696) (-1038.122) [-1038.343] * (-1039.407) (-1041.054) (-1039.083) [-1038.409] -- 0:00:54
      143000 -- (-1039.530) [-1038.615] (-1041.477) (-1037.848) * (-1039.715) (-1041.630) [-1038.227] (-1039.391) -- 0:00:53
      143500 -- (-1041.502) (-1042.080) [-1041.798] (-1037.738) * (-1039.523) (-1040.969) [-1049.868] (-1040.058) -- 0:00:53
      144000 -- (-1038.631) (-1046.143) (-1041.682) [-1037.738] * [-1038.620] (-1039.635) (-1039.584) (-1038.915) -- 0:00:53
      144500 -- (-1037.735) [-1038.803] (-1038.861) (-1041.721) * (-1041.041) [-1040.149] (-1041.847) (-1041.328) -- 0:00:53
      145000 -- (-1037.888) (-1039.713) (-1049.094) [-1038.111] * (-1037.695) (-1038.941) [-1041.135] (-1039.507) -- 0:00:53

      Average standard deviation of split frequencies: 0.018353

      145500 -- [-1038.514] (-1041.369) (-1044.091) (-1039.047) * (-1040.853) [-1041.149] (-1037.998) (-1041.483) -- 0:00:52
      146000 -- [-1040.704] (-1042.828) (-1040.956) (-1039.028) * (-1038.738) (-1039.531) [-1039.946] (-1038.735) -- 0:00:52
      146500 -- (-1038.112) (-1044.146) [-1039.750] (-1038.954) * (-1041.617) (-1038.378) (-1038.144) [-1039.283] -- 0:00:52
      147000 -- [-1038.331] (-1042.673) (-1041.838) (-1037.627) * (-1040.260) (-1041.096) [-1038.846] (-1041.249) -- 0:00:52
      147500 -- [-1037.981] (-1038.804) (-1040.592) (-1037.617) * (-1040.162) [-1039.147] (-1038.017) (-1041.162) -- 0:00:57
      148000 -- (-1042.526) (-1040.187) [-1040.228] (-1039.695) * [-1039.244] (-1039.542) (-1039.126) (-1040.685) -- 0:00:57
      148500 -- (-1038.054) (-1038.306) (-1041.813) [-1037.835] * (-1039.987) [-1039.544] (-1041.223) (-1040.268) -- 0:00:57
      149000 -- (-1040.024) [-1040.947] (-1043.445) (-1038.447) * (-1039.068) [-1040.394] (-1038.428) (-1040.336) -- 0:00:57
      149500 -- (-1038.909) (-1039.735) [-1043.114] (-1038.548) * (-1039.073) [-1040.380] (-1038.421) (-1042.195) -- 0:00:56
      150000 -- (-1042.415) (-1041.976) [-1041.374] (-1039.489) * (-1041.650) (-1038.420) [-1038.494] (-1040.862) -- 0:00:56

      Average standard deviation of split frequencies: 0.017291

      150500 -- (-1041.773) [-1038.711] (-1040.338) (-1039.278) * (-1040.235) (-1039.070) [-1039.300] (-1041.162) -- 0:00:56
      151000 -- [-1041.640] (-1038.604) (-1039.268) (-1041.542) * [-1040.941] (-1038.493) (-1043.062) (-1041.460) -- 0:00:56
      151500 -- [-1040.537] (-1038.562) (-1039.867) (-1040.829) * (-1041.770) [-1042.042] (-1044.525) (-1043.135) -- 0:00:56
      152000 -- (-1040.748) (-1038.692) [-1038.852] (-1043.428) * (-1038.877) [-1040.519] (-1038.657) (-1044.438) -- 0:00:55
      152500 -- (-1042.650) [-1040.066] (-1041.583) (-1041.557) * [-1041.413] (-1039.378) (-1038.374) (-1043.387) -- 0:00:55
      153000 -- (-1040.891) (-1040.696) [-1041.031] (-1040.518) * [-1039.259] (-1039.741) (-1038.029) (-1044.943) -- 0:00:55
      153500 -- (-1040.424) [-1039.274] (-1039.353) (-1040.175) * [-1039.622] (-1039.832) (-1039.058) (-1039.985) -- 0:00:55
      154000 -- (-1039.428) (-1046.467) [-1038.280] (-1039.304) * (-1040.319) (-1040.115) [-1037.800] (-1038.571) -- 0:00:54
      154500 -- [-1040.838] (-1040.204) (-1042.085) (-1046.948) * (-1039.330) (-1038.735) [-1039.280] (-1038.978) -- 0:00:54
      155000 -- (-1040.567) (-1042.290) [-1045.108] (-1038.976) * (-1039.127) [-1038.526] (-1040.237) (-1037.671) -- 0:00:54

      Average standard deviation of split frequencies: 0.017459

      155500 -- (-1041.265) [-1039.895] (-1044.200) (-1038.219) * (-1039.787) (-1043.662) (-1040.529) [-1037.668] -- 0:00:54
      156000 -- (-1039.141) (-1041.253) [-1038.449] (-1042.600) * (-1040.269) [-1039.004] (-1038.806) (-1037.912) -- 0:00:54
      156500 -- [-1039.096] (-1041.044) (-1040.312) (-1041.376) * (-1039.364) (-1040.153) (-1042.891) [-1041.195] -- 0:00:53
      157000 -- [-1039.607] (-1040.853) (-1039.219) (-1040.755) * (-1040.099) [-1040.710] (-1041.523) (-1041.677) -- 0:00:53
      157500 -- (-1037.874) (-1038.378) [-1040.521] (-1040.126) * (-1040.303) (-1039.648) (-1038.508) [-1038.851] -- 0:00:53
      158000 -- (-1040.041) (-1039.829) (-1045.622) [-1039.251] * (-1042.096) (-1040.633) (-1040.904) [-1040.953] -- 0:00:53
      158500 -- [-1040.388] (-1039.247) (-1038.961) (-1039.683) * (-1041.417) [-1040.969] (-1040.671) (-1038.567) -- 0:00:53
      159000 -- (-1040.609) (-1039.069) [-1038.305] (-1039.606) * (-1041.908) (-1041.630) (-1042.096) [-1038.040] -- 0:00:52
      159500 -- [-1038.563] (-1039.544) (-1039.569) (-1039.705) * (-1040.624) (-1039.066) [-1039.010] (-1038.637) -- 0:00:52
      160000 -- (-1040.537) (-1038.019) (-1044.342) [-1039.133] * (-1040.615) (-1038.817) [-1038.967] (-1038.398) -- 0:00:52

      Average standard deviation of split frequencies: 0.017278

      160500 -- (-1039.376) (-1037.879) (-1041.643) [-1039.960] * (-1042.505) (-1041.545) [-1038.257] (-1039.934) -- 0:00:52
      161000 -- (-1041.847) (-1040.492) [-1041.593] (-1040.486) * (-1042.311) [-1039.830] (-1038.835) (-1039.059) -- 0:00:52
      161500 -- (-1038.804) (-1039.929) (-1041.560) [-1039.801] * (-1038.323) (-1038.059) (-1038.578) [-1039.022] -- 0:00:51
      162000 -- (-1040.100) (-1041.747) (-1038.486) [-1039.094] * [-1038.550] (-1038.370) (-1039.930) (-1038.175) -- 0:00:51
      162500 -- [-1039.056] (-1043.693) (-1041.705) (-1039.555) * (-1041.217) (-1039.992) [-1039.820] (-1037.899) -- 0:00:51
      163000 -- (-1041.571) (-1041.586) [-1043.139] (-1040.276) * (-1042.276) (-1039.040) (-1041.041) [-1037.639] -- 0:00:56
      163500 -- (-1039.211) (-1039.000) (-1040.661) [-1039.444] * (-1045.069) (-1039.349) [-1040.812] (-1038.595) -- 0:00:56
      164000 -- (-1039.209) (-1042.048) (-1043.819) [-1040.646] * [-1039.733] (-1039.441) (-1039.287) (-1041.735) -- 0:00:56
      164500 -- (-1038.736) (-1039.409) (-1040.825) [-1039.646] * (-1041.013) [-1038.853] (-1040.342) (-1039.628) -- 0:00:55
      165000 -- (-1039.940) (-1038.885) (-1038.165) [-1039.300] * (-1040.286) [-1038.646] (-1042.430) (-1039.551) -- 0:00:55

      Average standard deviation of split frequencies: 0.018932

      165500 -- [-1040.337] (-1040.106) (-1041.621) (-1037.691) * [-1042.216] (-1040.558) (-1042.132) (-1039.850) -- 0:00:55
      166000 -- [-1039.492] (-1046.461) (-1041.800) (-1039.446) * (-1038.912) (-1038.454) (-1039.517) [-1039.963] -- 0:00:55
      166500 -- (-1046.385) (-1039.801) (-1041.869) [-1038.331] * (-1038.569) (-1040.065) [-1038.062] (-1040.446) -- 0:00:55
      167000 -- (-1040.682) [-1038.716] (-1038.915) (-1038.277) * (-1040.150) (-1040.480) [-1044.642] (-1041.000) -- 0:00:54
      167500 -- (-1039.084) (-1038.145) (-1041.487) [-1039.608] * (-1039.347) [-1040.702] (-1043.002) (-1039.299) -- 0:00:54
      168000 -- (-1041.947) [-1038.627] (-1041.642) (-1039.132) * (-1041.710) (-1039.911) [-1040.478] (-1039.299) -- 0:00:54
      168500 -- (-1041.703) (-1040.538) [-1039.114] (-1039.796) * (-1043.937) (-1039.519) [-1039.658] (-1040.169) -- 0:00:54
      169000 -- (-1042.426) [-1040.688] (-1040.009) (-1038.347) * (-1040.606) (-1042.783) [-1040.597] (-1040.427) -- 0:00:54
      169500 -- [-1042.420] (-1039.678) (-1041.778) (-1044.532) * (-1040.177) (-1043.190) (-1040.509) [-1039.728] -- 0:00:53
      170000 -- (-1042.095) [-1041.968] (-1045.804) (-1042.538) * (-1038.131) (-1039.458) [-1040.258] (-1040.548) -- 0:00:53

      Average standard deviation of split frequencies: 0.019181

      170500 -- (-1044.569) (-1041.619) [-1040.962] (-1039.660) * (-1042.299) (-1039.599) (-1039.531) [-1040.013] -- 0:00:53
      171000 -- (-1047.408) (-1042.016) [-1040.690] (-1042.651) * (-1039.910) [-1038.127] (-1039.904) (-1041.093) -- 0:00:53
      171500 -- (-1040.991) [-1039.897] (-1039.683) (-1041.849) * [-1038.567] (-1038.592) (-1040.819) (-1040.402) -- 0:00:53
      172000 -- (-1040.829) [-1039.859] (-1039.156) (-1040.582) * (-1041.993) (-1042.556) (-1043.062) [-1039.602] -- 0:00:52
      172500 -- (-1038.209) [-1039.881] (-1040.771) (-1039.402) * [-1038.714] (-1040.896) (-1038.479) (-1045.154) -- 0:00:52
      173000 -- [-1039.228] (-1040.389) (-1040.202) (-1041.004) * (-1039.008) [-1039.940] (-1038.245) (-1046.494) -- 0:00:52
      173500 -- [-1038.632] (-1041.826) (-1040.700) (-1039.596) * (-1039.388) (-1038.767) [-1040.190] (-1047.826) -- 0:00:52
      174000 -- (-1038.092) (-1041.002) [-1039.850] (-1045.720) * (-1040.978) [-1038.527] (-1040.421) (-1040.689) -- 0:00:52
      174500 -- [-1038.408] (-1039.559) (-1037.893) (-1040.031) * (-1038.237) [-1038.631] (-1040.989) (-1042.366) -- 0:00:52
      175000 -- (-1038.548) [-1038.096] (-1039.007) (-1040.296) * [-1038.008] (-1038.326) (-1042.698) (-1038.358) -- 0:00:51

      Average standard deviation of split frequencies: 0.019493

      175500 -- (-1038.705) [-1038.075] (-1038.624) (-1040.321) * (-1037.837) (-1040.742) (-1041.977) [-1038.484] -- 0:00:51
      176000 -- (-1039.366) [-1038.410] (-1038.859) (-1038.894) * (-1042.795) (-1041.003) (-1043.901) [-1041.480] -- 0:00:51
      176500 -- [-1040.261] (-1040.327) (-1038.264) (-1040.014) * (-1041.489) [-1041.834] (-1040.349) (-1038.675) -- 0:00:51
      177000 -- (-1039.157) [-1040.043] (-1040.323) (-1040.814) * (-1041.473) (-1040.837) (-1039.358) [-1039.874] -- 0:00:51
      177500 -- (-1038.091) (-1041.230) [-1038.333] (-1040.828) * (-1040.537) (-1039.944) [-1039.931] (-1045.688) -- 0:00:50
      178000 -- (-1038.190) (-1040.688) (-1039.696) [-1041.251] * (-1041.866) (-1037.935) [-1037.953] (-1041.620) -- 0:00:50
      178500 -- (-1038.284) (-1037.799) (-1044.850) [-1039.633] * [-1044.721] (-1041.771) (-1040.389) (-1043.997) -- 0:00:55
      179000 -- (-1040.053) (-1040.710) (-1038.896) [-1041.480] * (-1041.276) (-1039.810) (-1044.396) [-1038.489] -- 0:00:55
      179500 -- (-1039.019) (-1039.717) (-1040.769) [-1038.098] * (-1039.303) (-1039.436) [-1042.095] (-1043.751) -- 0:00:54
      180000 -- [-1038.521] (-1041.633) (-1040.606) (-1039.444) * (-1040.569) (-1039.163) [-1039.483] (-1042.276) -- 0:00:54

      Average standard deviation of split frequencies: 0.020050

      180500 -- [-1038.595] (-1039.611) (-1040.069) (-1039.856) * [-1040.448] (-1040.392) (-1039.405) (-1038.770) -- 0:00:54
      181000 -- (-1042.294) (-1038.922) [-1038.032] (-1042.135) * (-1040.992) (-1040.462) (-1042.669) [-1039.667] -- 0:00:54
      181500 -- (-1041.422) (-1041.233) [-1038.426] (-1040.367) * (-1042.492) [-1040.518] (-1038.077) (-1039.048) -- 0:00:54
      182000 -- [-1040.387] (-1039.151) (-1039.172) (-1047.524) * (-1044.025) (-1039.858) (-1039.912) [-1038.380] -- 0:00:53
      182500 -- [-1040.815] (-1039.085) (-1038.276) (-1042.175) * (-1043.411) (-1044.285) (-1039.461) [-1040.118] -- 0:00:53
      183000 -- [-1042.865] (-1038.665) (-1037.814) (-1040.369) * [-1041.341] (-1039.694) (-1039.404) (-1040.353) -- 0:00:53
      183500 -- [-1042.467] (-1038.660) (-1039.006) (-1039.677) * (-1041.073) (-1041.614) [-1040.716] (-1039.021) -- 0:00:53
      184000 -- [-1040.004] (-1040.239) (-1038.011) (-1039.376) * (-1040.874) (-1040.410) (-1039.448) [-1040.143] -- 0:00:53
      184500 -- (-1041.790) [-1040.098] (-1040.878) (-1038.549) * (-1040.542) [-1040.714] (-1041.645) (-1038.437) -- 0:00:53
      185000 -- (-1041.512) [-1039.626] (-1039.621) (-1041.963) * [-1041.439] (-1039.853) (-1038.806) (-1039.487) -- 0:00:52

      Average standard deviation of split frequencies: 0.018942

      185500 -- (-1042.382) (-1042.472) (-1038.782) [-1039.564] * [-1045.733] (-1038.216) (-1043.562) (-1038.546) -- 0:00:52
      186000 -- (-1040.957) (-1047.629) (-1043.365) [-1037.749] * (-1042.889) [-1039.200] (-1039.615) (-1038.605) -- 0:00:52
      186500 -- (-1039.399) (-1042.242) (-1041.435) [-1039.844] * (-1041.402) (-1039.544) [-1039.736] (-1042.612) -- 0:00:52
      187000 -- [-1039.944] (-1041.917) (-1039.813) (-1040.194) * (-1039.784) (-1039.490) (-1038.449) [-1039.963] -- 0:00:52
      187500 -- (-1039.505) (-1042.155) (-1039.191) [-1040.387] * (-1039.466) [-1039.230] (-1037.999) (-1038.473) -- 0:00:52
      188000 -- (-1041.836) (-1045.927) (-1040.499) [-1039.644] * (-1042.027) (-1041.430) [-1039.739] (-1039.374) -- 0:00:51
      188500 -- (-1042.120) (-1044.284) [-1038.706] (-1038.861) * (-1040.951) [-1043.933] (-1039.603) (-1041.199) -- 0:00:51
      189000 -- [-1040.155] (-1041.381) (-1038.967) (-1038.646) * (-1039.623) [-1039.883] (-1041.179) (-1038.489) -- 0:00:51
      189500 -- (-1040.106) (-1039.528) [-1040.685] (-1038.313) * [-1040.731] (-1040.256) (-1044.193) (-1038.527) -- 0:00:51
      190000 -- (-1038.460) (-1040.815) (-1042.069) [-1043.163] * [-1041.479] (-1039.388) (-1041.172) (-1038.075) -- 0:00:51

      Average standard deviation of split frequencies: 0.019389

      190500 -- (-1039.927) (-1041.442) (-1041.966) [-1041.611] * (-1038.974) [-1039.575] (-1040.331) (-1038.400) -- 0:00:50
      191000 -- (-1041.007) [-1042.767] (-1042.659) (-1041.722) * [-1040.244] (-1038.048) (-1038.809) (-1041.172) -- 0:00:50
      191500 -- (-1040.305) [-1038.332] (-1039.164) (-1040.292) * (-1040.378) (-1038.045) [-1039.230] (-1041.535) -- 0:00:50
      192000 -- [-1042.600] (-1038.358) (-1040.417) (-1041.646) * (-1039.530) [-1038.814] (-1042.758) (-1041.166) -- 0:00:50
      192500 -- (-1042.918) (-1039.637) [-1038.096] (-1037.576) * [-1040.426] (-1044.403) (-1039.795) (-1041.611) -- 0:00:50
      193000 -- (-1038.883) (-1038.132) [-1039.496] (-1039.460) * (-1040.895) [-1039.729] (-1038.855) (-1039.986) -- 0:00:50
      193500 -- (-1042.181) [-1038.735] (-1038.189) (-1040.037) * [-1047.907] (-1040.763) (-1042.144) (-1039.411) -- 0:00:50
      194000 -- [-1039.816] (-1038.053) (-1039.842) (-1040.309) * (-1047.578) (-1042.629) [-1038.313] (-1041.136) -- 0:00:49
      194500 -- (-1041.694) (-1041.315) (-1038.755) [-1039.128] * (-1040.169) (-1040.595) [-1038.550] (-1041.197) -- 0:00:49
      195000 -- (-1039.334) [-1038.476] (-1039.995) (-1039.956) * (-1041.762) [-1044.901] (-1039.354) (-1038.998) -- 0:00:53

      Average standard deviation of split frequencies: 0.017722

      195500 -- (-1038.411) (-1037.973) (-1044.977) [-1039.329] * (-1039.270) [-1041.961] (-1038.888) (-1039.654) -- 0:00:53
      196000 -- (-1042.602) [-1039.760] (-1039.620) (-1038.815) * (-1039.031) (-1042.923) [-1042.528] (-1040.101) -- 0:00:53
      196500 -- (-1041.907) (-1039.936) [-1038.180] (-1041.680) * (-1039.753) [-1041.508] (-1039.226) (-1040.000) -- 0:00:53
      197000 -- (-1044.745) (-1040.598) (-1040.276) [-1041.760] * [-1042.050] (-1039.401) (-1039.439) (-1038.874) -- 0:00:52
      197500 -- (-1049.680) (-1038.911) (-1039.556) [-1039.715] * (-1039.124) (-1039.228) (-1039.357) [-1040.243] -- 0:00:52
      198000 -- (-1041.135) (-1042.060) (-1038.657) [-1041.584] * (-1037.893) (-1040.028) (-1039.379) [-1040.046] -- 0:00:52
      198500 -- (-1039.237) [-1042.122] (-1038.805) (-1038.874) * (-1037.888) (-1039.177) [-1039.376] (-1039.146) -- 0:00:52
      199000 -- (-1040.594) (-1040.716) [-1039.597] (-1039.355) * (-1038.521) (-1039.610) [-1038.877] (-1038.713) -- 0:00:52
      199500 -- [-1040.535] (-1039.286) (-1040.562) (-1038.881) * (-1040.071) (-1038.425) (-1042.979) [-1038.737] -- 0:00:52
      200000 -- [-1040.450] (-1047.716) (-1040.285) (-1041.043) * [-1039.271] (-1039.115) (-1039.404) (-1040.446) -- 0:00:51

      Average standard deviation of split frequencies: 0.017681

      200500 -- [-1039.393] (-1042.248) (-1039.247) (-1040.415) * (-1041.348) (-1039.558) (-1037.990) [-1039.006] -- 0:00:51
      201000 -- (-1038.821) (-1040.593) [-1038.714] (-1040.937) * (-1041.419) (-1040.319) [-1040.070] (-1040.888) -- 0:00:51
      201500 -- (-1039.312) (-1038.525) [-1038.455] (-1038.082) * [-1042.909] (-1039.893) (-1043.018) (-1040.455) -- 0:00:51
      202000 -- (-1040.097) (-1038.558) [-1039.773] (-1038.085) * [-1043.183] (-1038.725) (-1037.861) (-1041.030) -- 0:00:51
      202500 -- (-1039.048) (-1039.014) [-1038.849] (-1040.011) * (-1042.102) (-1039.042) [-1039.639] (-1040.001) -- 0:00:51
      203000 -- (-1044.313) (-1038.841) (-1041.369) [-1039.899] * (-1044.888) [-1038.258] (-1037.983) (-1046.280) -- 0:00:51
      203500 -- (-1043.722) (-1038.556) (-1041.009) [-1039.617] * (-1041.066) (-1040.089) [-1039.991] (-1044.713) -- 0:00:50
      204000 -- (-1041.545) (-1039.185) (-1042.212) [-1041.977] * (-1040.995) (-1040.057) [-1038.934] (-1039.819) -- 0:00:50
      204500 -- (-1040.244) [-1040.255] (-1044.918) (-1040.485) * (-1040.867) (-1043.601) [-1039.423] (-1041.157) -- 0:00:50
      205000 -- [-1041.457] (-1039.102) (-1044.076) (-1038.756) * (-1044.293) (-1039.531) [-1041.707] (-1040.087) -- 0:00:50

      Average standard deviation of split frequencies: 0.015891

      205500 -- (-1039.099) (-1042.678) [-1041.385] (-1041.249) * (-1040.246) (-1040.585) [-1038.162] (-1045.104) -- 0:00:50
      206000 -- (-1044.605) (-1045.516) (-1040.162) [-1038.222] * [-1040.644] (-1038.673) (-1037.839) (-1040.026) -- 0:00:50
      206500 -- [-1039.352] (-1040.555) (-1040.507) (-1039.396) * (-1045.213) (-1043.840) (-1038.169) [-1040.775] -- 0:00:49
      207000 -- (-1040.219) [-1038.765] (-1043.065) (-1043.506) * (-1045.036) [-1040.893] (-1039.614) (-1046.343) -- 0:00:49
      207500 -- (-1041.024) (-1039.053) [-1039.701] (-1043.910) * (-1050.032) [-1038.560] (-1038.169) (-1039.446) -- 0:00:49
      208000 -- (-1040.967) [-1039.590] (-1039.993) (-1040.560) * (-1045.343) [-1039.048] (-1038.457) (-1039.843) -- 0:00:49
      208500 -- (-1041.267) (-1039.672) (-1041.733) [-1040.016] * (-1043.042) (-1041.680) (-1038.542) [-1039.547] -- 0:00:49
      209000 -- (-1039.376) (-1039.730) [-1042.296] (-1039.542) * (-1041.316) (-1040.704) [-1039.393] (-1038.517) -- 0:00:49
      209500 -- (-1038.748) [-1039.988] (-1037.949) (-1038.565) * (-1040.196) (-1040.705) (-1040.292) [-1039.102] -- 0:00:49
      210000 -- [-1038.448] (-1038.456) (-1039.468) (-1038.379) * [-1040.306] (-1040.802) (-1037.891) (-1041.540) -- 0:00:48

      Average standard deviation of split frequencies: 0.014918

      210500 -- (-1040.449) (-1039.970) (-1037.726) [-1039.142] * (-1038.494) (-1041.939) (-1038.359) [-1039.440] -- 0:00:48
      211000 -- (-1039.806) (-1039.698) [-1042.118] (-1041.489) * (-1043.037) (-1045.130) (-1040.864) [-1039.958] -- 0:00:48
      211500 -- (-1041.544) (-1041.490) (-1048.443) [-1042.349] * (-1039.593) (-1037.960) [-1042.288] (-1038.919) -- 0:00:52
      212000 -- (-1047.867) (-1041.772) (-1042.476) [-1038.721] * [-1038.347] (-1039.025) (-1038.597) (-1038.698) -- 0:00:52
      212500 -- [-1040.518] (-1040.138) (-1043.888) (-1039.516) * (-1039.409) [-1038.474] (-1039.112) (-1041.804) -- 0:00:51
      213000 -- (-1042.267) [-1043.142] (-1040.479) (-1037.989) * (-1048.234) [-1040.652] (-1038.608) (-1038.357) -- 0:00:51
      213500 -- (-1042.184) [-1040.631] (-1039.042) (-1039.616) * (-1042.264) [-1038.303] (-1042.443) (-1040.757) -- 0:00:51
      214000 -- (-1042.782) (-1041.808) [-1038.609] (-1039.970) * (-1042.476) (-1040.136) [-1040.025] (-1039.111) -- 0:00:51
      214500 -- (-1039.501) [-1038.588] (-1040.151) (-1040.112) * (-1039.320) (-1038.517) [-1038.189] (-1041.167) -- 0:00:51
      215000 -- (-1040.698) [-1038.301] (-1041.542) (-1042.245) * (-1040.140) [-1040.123] (-1038.911) (-1038.510) -- 0:00:51

      Average standard deviation of split frequencies: 0.015883

      215500 -- (-1041.926) (-1042.827) (-1039.244) [-1045.337] * [-1040.493] (-1040.145) (-1039.362) (-1041.898) -- 0:00:50
      216000 -- (-1039.837) (-1038.518) [-1038.749] (-1039.000) * (-1042.722) (-1037.700) (-1039.970) [-1039.071] -- 0:00:50
      216500 -- (-1041.008) (-1038.484) [-1038.982] (-1039.514) * (-1039.717) (-1038.337) [-1039.523] (-1039.381) -- 0:00:50
      217000 -- (-1041.521) (-1039.732) [-1039.266] (-1039.714) * (-1041.973) [-1040.660] (-1049.585) (-1042.128) -- 0:00:50
      217500 -- (-1044.803) (-1041.429) (-1040.791) [-1039.511] * [-1040.232] (-1039.397) (-1041.753) (-1039.511) -- 0:00:50
      218000 -- (-1043.280) (-1039.992) [-1040.478] (-1038.087) * (-1041.267) (-1040.000) [-1040.005] (-1041.976) -- 0:00:50
      218500 -- (-1040.127) (-1043.076) (-1041.949) [-1038.625] * [-1042.559] (-1038.947) (-1041.507) (-1039.993) -- 0:00:50
      219000 -- (-1040.195) (-1039.811) (-1037.722) [-1041.022] * (-1041.053) (-1040.023) (-1043.702) [-1041.910] -- 0:00:49
      219500 -- [-1038.725] (-1039.075) (-1038.904) (-1039.364) * (-1040.145) (-1041.097) (-1043.595) [-1040.895] -- 0:00:49
      220000 -- [-1039.030] (-1043.995) (-1038.121) (-1038.782) * (-1043.835) (-1040.140) [-1039.130] (-1038.871) -- 0:00:49

      Average standard deviation of split frequencies: 0.016497

      220500 -- (-1040.648) (-1043.922) [-1039.026] (-1039.103) * [-1039.030] (-1040.380) (-1039.628) (-1041.284) -- 0:00:49
      221000 -- [-1039.352] (-1038.994) (-1039.671) (-1040.327) * [-1041.164] (-1038.096) (-1043.023) (-1043.253) -- 0:00:49
      221500 -- [-1040.715] (-1038.415) (-1041.970) (-1041.248) * (-1039.028) (-1040.401) [-1042.841] (-1038.794) -- 0:00:49
      222000 -- (-1039.558) (-1038.473) (-1041.994) [-1040.131] * (-1039.130) (-1039.316) (-1043.083) [-1042.915] -- 0:00:49
      222500 -- (-1039.221) (-1038.833) [-1038.677] (-1041.078) * (-1038.464) [-1038.918] (-1040.020) (-1044.306) -- 0:00:48
      223000 -- [-1039.504] (-1038.096) (-1038.484) (-1040.317) * (-1038.246) [-1041.154] (-1040.985) (-1038.597) -- 0:00:48
      223500 -- (-1040.432) [-1038.299] (-1038.621) (-1039.401) * (-1037.830) [-1038.194] (-1039.793) (-1042.243) -- 0:00:48
      224000 -- (-1038.116) (-1038.518) (-1039.137) [-1039.531] * (-1038.186) [-1041.378] (-1041.935) (-1037.673) -- 0:00:48
      224500 -- (-1043.581) (-1039.042) (-1039.844) [-1042.066] * (-1039.155) (-1040.666) [-1038.888] (-1038.342) -- 0:00:48
      225000 -- [-1041.029] (-1039.213) (-1039.172) (-1039.384) * (-1038.548) (-1041.141) (-1039.196) [-1038.448] -- 0:00:48

      Average standard deviation of split frequencies: 0.018657

      225500 -- (-1041.947) (-1039.082) (-1040.084) [-1039.301] * [-1038.626] (-1043.135) (-1040.438) (-1040.369) -- 0:00:48
      226000 -- (-1040.187) (-1038.909) [-1039.198] (-1038.786) * (-1037.961) [-1040.249] (-1038.466) (-1038.756) -- 0:00:47
      226500 -- (-1038.365) (-1038.239) (-1039.848) [-1039.127] * (-1041.650) (-1043.658) (-1040.962) [-1039.855] -- 0:00:47
      227000 -- (-1039.749) (-1037.684) [-1041.127] (-1040.619) * [-1041.139] (-1040.338) (-1040.129) (-1040.136) -- 0:00:47
      227500 -- (-1039.737) (-1038.280) [-1040.639] (-1040.565) * (-1040.792) (-1040.230) (-1040.731) [-1039.981] -- 0:00:47
      228000 -- (-1038.584) (-1042.220) [-1039.855] (-1041.833) * [-1039.280] (-1039.230) (-1040.675) (-1039.570) -- 0:00:50
      228500 -- (-1039.155) (-1041.889) [-1040.055] (-1040.998) * (-1039.852) (-1039.578) [-1039.831] (-1040.157) -- 0:00:50
      229000 -- (-1038.648) [-1039.319] (-1039.969) (-1040.986) * (-1038.855) [-1039.164] (-1039.788) (-1043.218) -- 0:00:50
      229500 -- (-1039.923) (-1038.938) [-1039.951] (-1039.134) * (-1039.171) [-1039.508] (-1040.650) (-1040.974) -- 0:00:50
      230000 -- (-1041.447) (-1040.328) [-1038.600] (-1042.324) * (-1040.114) [-1041.492] (-1040.942) (-1043.606) -- 0:00:50

      Average standard deviation of split frequencies: 0.019528

      230500 -- (-1041.850) [-1038.723] (-1042.153) (-1040.796) * [-1039.884] (-1040.065) (-1039.310) (-1041.326) -- 0:00:50
      231000 -- [-1039.443] (-1039.365) (-1039.503) (-1037.909) * (-1041.314) (-1045.346) [-1038.145] (-1039.516) -- 0:00:49
      231500 -- (-1040.741) (-1039.005) (-1040.435) [-1037.909] * [-1039.035] (-1038.639) (-1039.313) (-1038.825) -- 0:00:49
      232000 -- (-1041.400) [-1039.366] (-1041.009) (-1040.026) * (-1038.955) (-1038.501) (-1046.875) [-1039.192] -- 0:00:49
      232500 -- (-1041.852) (-1047.734) [-1039.739] (-1038.004) * (-1040.265) (-1042.710) [-1044.822] (-1040.404) -- 0:00:49
      233000 -- (-1038.031) (-1038.163) (-1039.131) [-1039.775] * [-1043.271] (-1042.776) (-1039.915) (-1043.734) -- 0:00:49
      233500 -- [-1038.934] (-1041.309) (-1040.088) (-1041.018) * (-1041.351) (-1043.347) [-1039.341] (-1042.453) -- 0:00:49
      234000 -- (-1041.100) (-1040.787) [-1039.869] (-1038.596) * [-1042.760] (-1042.535) (-1039.074) (-1038.946) -- 0:00:49
      234500 -- (-1042.056) [-1041.058] (-1044.721) (-1038.319) * (-1040.472) (-1040.444) (-1043.803) [-1042.285] -- 0:00:48
      235000 -- (-1042.469) (-1041.372) [-1045.006] (-1038.321) * [-1041.451] (-1038.733) (-1040.985) (-1041.283) -- 0:00:48

      Average standard deviation of split frequencies: 0.019870

      235500 -- (-1038.781) (-1039.350) (-1041.795) [-1040.769] * (-1043.732) (-1039.378) (-1039.071) [-1040.136] -- 0:00:48
      236000 -- [-1039.784] (-1039.051) (-1042.005) (-1041.517) * (-1040.159) (-1040.315) (-1038.167) [-1038.167] -- 0:00:48
      236500 -- (-1040.632) (-1039.746) (-1039.547) [-1038.554] * (-1038.765) (-1039.145) [-1040.994] (-1038.217) -- 0:00:48
      237000 -- (-1043.309) (-1039.692) (-1042.473) [-1039.925] * (-1039.751) (-1038.667) [-1043.225] (-1039.359) -- 0:00:48
      237500 -- (-1041.389) (-1040.595) [-1040.940] (-1044.593) * (-1042.710) (-1038.025) [-1039.578] (-1040.058) -- 0:00:48
      238000 -- (-1042.762) [-1040.048] (-1042.510) (-1046.252) * (-1044.371) [-1038.686] (-1039.036) (-1039.636) -- 0:00:48
      238500 -- [-1039.345] (-1040.424) (-1039.393) (-1039.351) * (-1043.490) [-1037.915] (-1038.164) (-1038.202) -- 0:00:47
      239000 -- [-1038.922] (-1039.730) (-1038.818) (-1040.347) * (-1039.427) (-1038.079) (-1041.179) [-1042.227] -- 0:00:47
      239500 -- (-1039.391) [-1039.923] (-1038.734) (-1039.701) * [-1043.035] (-1038.774) (-1040.411) (-1038.914) -- 0:00:47
      240000 -- (-1039.338) (-1039.315) (-1038.590) [-1040.301] * (-1043.592) [-1039.126] (-1040.351) (-1039.927) -- 0:00:47

      Average standard deviation of split frequencies: 0.019805

      240500 -- (-1039.605) [-1039.414] (-1039.744) (-1038.594) * (-1041.214) (-1039.126) [-1040.919] (-1041.055) -- 0:00:47
      241000 -- [-1039.429] (-1038.185) (-1039.506) (-1040.067) * (-1039.645) (-1038.341) [-1039.645] (-1038.698) -- 0:00:47
      241500 -- (-1040.713) [-1038.602] (-1039.153) (-1039.973) * (-1041.361) [-1042.293] (-1038.687) (-1039.126) -- 0:00:47
      242000 -- (-1039.731) [-1038.784] (-1038.612) (-1038.963) * [-1038.198] (-1041.415) (-1040.205) (-1040.938) -- 0:00:46
      242500 -- [-1041.094] (-1039.265) (-1039.686) (-1039.342) * (-1041.924) [-1041.416] (-1038.988) (-1046.077) -- 0:00:46
      243000 -- (-1038.302) [-1039.232] (-1039.102) (-1043.410) * (-1038.267) (-1039.014) (-1043.723) [-1038.954] -- 0:00:46
      243500 -- (-1038.502) (-1038.299) [-1039.729] (-1042.949) * (-1038.166) [-1040.294] (-1043.534) (-1038.124) -- 0:00:46
      244000 -- [-1038.591] (-1038.191) (-1038.651) (-1039.785) * [-1041.181] (-1043.010) (-1040.218) (-1043.264) -- 0:00:46
      244500 -- (-1041.306) (-1038.135) [-1038.766] (-1037.932) * (-1041.389) (-1041.818) (-1041.342) [-1042.799] -- 0:00:49
      245000 -- (-1042.044) [-1039.723] (-1038.953) (-1039.655) * (-1039.623) [-1040.477] (-1041.537) (-1039.656) -- 0:00:49

      Average standard deviation of split frequencies: 0.020440

      245500 -- (-1042.317) (-1039.510) (-1038.343) [-1039.083] * (-1040.328) [-1043.382] (-1039.807) (-1039.075) -- 0:00:49
      246000 -- (-1041.982) (-1039.511) [-1038.789] (-1038.529) * (-1041.573) (-1041.210) (-1040.496) [-1038.597] -- 0:00:49
      246500 -- [-1039.696] (-1040.052) (-1041.221) (-1042.623) * (-1042.194) (-1045.051) [-1039.647] (-1038.747) -- 0:00:48
      247000 -- (-1040.288) [-1038.898] (-1040.879) (-1041.446) * (-1046.832) (-1038.658) [-1038.777] (-1040.719) -- 0:00:48
      247500 -- (-1038.939) (-1038.607) (-1038.953) [-1039.444] * (-1039.499) [-1038.084] (-1040.971) (-1041.623) -- 0:00:48
      248000 -- (-1039.245) (-1039.365) (-1041.960) [-1038.448] * [-1039.079] (-1038.880) (-1040.346) (-1040.072) -- 0:00:48
      248500 -- [-1039.532] (-1039.725) (-1041.670) (-1038.619) * (-1040.580) [-1042.349] (-1041.492) (-1042.472) -- 0:00:48
      249000 -- [-1043.172] (-1039.617) (-1048.500) (-1038.535) * (-1038.547) [-1041.801] (-1039.884) (-1041.567) -- 0:00:48
      249500 -- (-1046.306) [-1038.003] (-1042.221) (-1038.294) * (-1041.535) [-1040.380] (-1039.315) (-1038.746) -- 0:00:48
      250000 -- (-1042.574) (-1038.603) [-1040.891] (-1040.093) * [-1038.813] (-1038.345) (-1039.096) (-1039.099) -- 0:00:48

      Average standard deviation of split frequencies: 0.020269

      250500 -- (-1045.334) [-1038.971] (-1040.376) (-1039.669) * (-1039.343) [-1038.927] (-1041.654) (-1040.802) -- 0:00:47
      251000 -- (-1042.014) (-1040.170) (-1040.610) [-1040.501] * [-1039.327] (-1041.227) (-1042.468) (-1046.012) -- 0:00:47
      251500 -- (-1039.122) [-1038.724] (-1038.412) (-1040.759) * (-1038.421) (-1039.647) (-1045.290) [-1041.133] -- 0:00:47
      252000 -- (-1038.565) (-1039.813) [-1039.154] (-1040.235) * (-1041.595) (-1039.648) [-1043.814] (-1041.786) -- 0:00:47
      252500 -- (-1038.306) [-1040.979] (-1042.451) (-1040.249) * (-1041.686) (-1038.350) (-1042.127) [-1038.494] -- 0:00:47
      253000 -- (-1038.246) (-1039.054) (-1041.495) [-1039.741] * (-1043.323) (-1039.797) [-1039.197] (-1039.603) -- 0:00:47
      253500 -- (-1038.255) (-1038.466) [-1045.376] (-1039.623) * (-1038.589) (-1038.542) (-1039.889) [-1039.376] -- 0:00:47
      254000 -- (-1041.475) [-1038.174] (-1046.552) (-1043.210) * (-1038.589) (-1039.039) (-1041.526) [-1038.653] -- 0:00:46
      254500 -- [-1041.396] (-1039.275) (-1048.376) (-1045.675) * (-1040.243) (-1042.639) (-1039.824) [-1039.280] -- 0:00:46
      255000 -- [-1044.431] (-1041.307) (-1040.103) (-1041.253) * (-1039.341) (-1039.224) (-1038.940) [-1040.729] -- 0:00:46

      Average standard deviation of split frequencies: 0.019949

      255500 -- [-1041.611] (-1039.750) (-1037.647) (-1039.012) * (-1041.980) (-1040.872) [-1038.197] (-1039.453) -- 0:00:46
      256000 -- (-1041.158) [-1039.525] (-1038.925) (-1042.605) * (-1043.281) [-1040.048] (-1040.468) (-1040.131) -- 0:00:46
      256500 -- (-1042.824) [-1040.347] (-1038.757) (-1038.108) * [-1039.777] (-1039.207) (-1038.734) (-1041.233) -- 0:00:46
      257000 -- [-1041.364] (-1038.978) (-1038.651) (-1038.334) * (-1043.259) (-1039.052) (-1040.111) [-1040.326] -- 0:00:46
      257500 -- [-1038.318] (-1038.883) (-1039.086) (-1040.084) * (-1047.407) (-1042.896) (-1039.946) [-1040.311] -- 0:00:46
      258000 -- (-1038.934) (-1041.450) (-1040.271) [-1039.613] * (-1042.075) [-1040.292] (-1041.084) (-1041.587) -- 0:00:46
      258500 -- (-1040.286) [-1040.257] (-1038.373) (-1041.307) * [-1041.082] (-1042.247) (-1038.033) (-1047.242) -- 0:00:45
      259000 -- [-1038.760] (-1042.585) (-1038.854) (-1039.714) * (-1041.715) (-1040.255) [-1042.471] (-1042.438) -- 0:00:45
      259500 -- (-1040.294) [-1038.229] (-1038.598) (-1039.816) * (-1039.928) (-1041.375) [-1041.542] (-1039.527) -- 0:00:45
      260000 -- [-1039.564] (-1039.175) (-1038.552) (-1038.711) * (-1039.363) (-1041.544) [-1043.058] (-1039.266) -- 0:00:45

      Average standard deviation of split frequencies: 0.020496

      260500 -- [-1042.546] (-1040.942) (-1040.415) (-1038.106) * (-1038.994) (-1043.371) [-1038.982] (-1042.464) -- 0:00:45
      261000 -- (-1039.110) (-1039.891) (-1043.222) [-1038.307] * (-1039.200) [-1041.581] (-1039.828) (-1043.544) -- 0:00:48
      261500 -- (-1038.956) (-1040.321) (-1040.976) [-1038.930] * (-1043.866) [-1041.502] (-1038.880) (-1039.925) -- 0:00:48
      262000 -- (-1040.463) [-1040.770] (-1042.462) (-1042.210) * [-1038.523] (-1040.702) (-1040.421) (-1042.189) -- 0:00:47
      262500 -- (-1041.996) (-1041.666) [-1038.072] (-1038.835) * [-1040.341] (-1040.950) (-1040.379) (-1041.919) -- 0:00:47
      263000 -- (-1039.056) [-1039.347] (-1039.311) (-1040.816) * (-1040.703) (-1040.595) (-1040.578) [-1037.981] -- 0:00:47
      263500 -- (-1038.467) [-1038.826] (-1041.424) (-1037.984) * [-1041.291] (-1045.136) (-1041.120) (-1037.981) -- 0:00:47
      264000 -- (-1042.205) (-1041.617) (-1040.477) [-1038.303] * (-1042.874) (-1041.904) (-1041.105) [-1039.954] -- 0:00:47
      264500 -- (-1040.682) (-1043.840) [-1039.493] (-1039.551) * (-1041.246) [-1045.736] (-1040.821) (-1040.251) -- 0:00:47
      265000 -- (-1039.571) (-1040.515) (-1039.416) [-1039.893] * (-1039.876) [-1047.051] (-1039.563) (-1040.634) -- 0:00:47

      Average standard deviation of split frequencies: 0.019593

      265500 -- (-1041.825) (-1041.633) [-1038.263] (-1040.235) * (-1040.457) (-1041.197) [-1044.904] (-1039.867) -- 0:00:47
      266000 -- (-1042.064) [-1040.045] (-1038.377) (-1041.008) * [-1038.834] (-1042.294) (-1039.200) (-1044.636) -- 0:00:46
      266500 -- (-1040.165) (-1040.132) (-1042.393) [-1039.454] * (-1040.649) [-1041.102] (-1041.069) (-1039.415) -- 0:00:46
      267000 -- (-1044.038) (-1039.842) [-1040.290] (-1046.946) * (-1040.803) [-1038.712] (-1038.615) (-1038.100) -- 0:00:46
      267500 -- (-1038.585) [-1040.607] (-1041.062) (-1040.477) * (-1040.600) [-1039.536] (-1041.320) (-1040.939) -- 0:00:46
      268000 -- (-1039.867) (-1040.299) [-1038.760] (-1040.832) * (-1040.633) (-1039.140) [-1039.861] (-1039.059) -- 0:00:46
      268500 -- (-1040.313) (-1042.110) (-1040.635) [-1038.104] * [-1040.067] (-1039.463) (-1038.623) (-1038.126) -- 0:00:46
      269000 -- (-1044.246) [-1041.731] (-1038.262) (-1038.492) * (-1041.482) [-1040.502] (-1037.774) (-1039.247) -- 0:00:46
      269500 -- (-1041.861) (-1043.810) (-1039.497) [-1037.774] * (-1040.626) [-1039.963] (-1039.801) (-1039.332) -- 0:00:46
      270000 -- [-1038.844] (-1039.489) (-1040.499) (-1037.768) * (-1039.698) (-1039.215) (-1041.641) [-1038.524] -- 0:00:45

      Average standard deviation of split frequencies: 0.019061

      270500 -- (-1040.293) [-1037.843] (-1043.529) (-1038.377) * [-1038.442] (-1041.917) (-1040.732) (-1040.565) -- 0:00:45
      271000 -- (-1040.587) [-1038.633] (-1040.655) (-1043.699) * (-1037.907) (-1046.158) [-1039.452] (-1038.744) -- 0:00:45
      271500 -- (-1038.671) (-1043.078) (-1037.802) [-1039.937] * (-1037.900) (-1042.415) (-1041.971) [-1038.530] -- 0:00:45
      272000 -- (-1041.685) (-1042.985) [-1039.258] (-1037.979) * [-1038.208] (-1040.878) (-1045.361) (-1042.212) -- 0:00:45
      272500 -- (-1040.849) (-1040.133) (-1039.066) [-1040.743] * (-1038.585) (-1040.650) [-1041.931] (-1040.852) -- 0:00:45
      273000 -- (-1042.170) (-1042.581) (-1039.226) [-1041.501] * [-1038.933] (-1040.739) (-1040.551) (-1038.790) -- 0:00:45
      273500 -- (-1042.176) (-1042.129) [-1037.803] (-1040.576) * (-1039.002) [-1039.271] (-1041.551) (-1040.296) -- 0:00:45
      274000 -- (-1040.162) (-1043.025) (-1038.223) [-1039.452] * (-1038.840) (-1041.398) (-1040.166) [-1038.314] -- 0:00:45
      274500 -- (-1043.950) (-1042.425) (-1039.287) [-1038.665] * (-1038.692) (-1041.431) [-1038.779] (-1040.471) -- 0:00:44
      275000 -- [-1039.184] (-1040.524) (-1041.613) (-1038.270) * (-1039.940) (-1038.795) [-1039.246] (-1043.558) -- 0:00:44

      Average standard deviation of split frequencies: 0.020306

      275500 -- [-1041.749] (-1041.990) (-1038.777) (-1038.302) * (-1041.159) [-1038.219] (-1040.948) (-1042.920) -- 0:00:44
      276000 -- (-1039.538) (-1043.127) (-1038.815) [-1040.575] * [-1038.642] (-1043.885) (-1040.502) (-1044.505) -- 0:00:44
      276500 -- (-1039.527) (-1040.761) [-1038.726] (-1041.252) * (-1037.968) (-1045.218) (-1042.476) [-1046.914] -- 0:00:44
      277000 -- [-1039.622] (-1041.278) (-1040.352) (-1040.837) * (-1037.734) (-1040.368) [-1040.847] (-1041.221) -- 0:00:44
      277500 -- (-1040.851) (-1040.631) (-1038.943) [-1042.697] * (-1039.343) (-1039.069) [-1041.726] (-1041.448) -- 0:00:46
      278000 -- (-1040.910) (-1039.603) (-1041.323) [-1039.156] * (-1039.526) (-1041.291) [-1040.009] (-1040.467) -- 0:00:46
      278500 -- (-1037.939) [-1048.465] (-1040.659) (-1038.289) * (-1041.277) (-1041.123) [-1038.827] (-1039.865) -- 0:00:46
      279000 -- (-1040.034) (-1043.747) [-1039.734] (-1038.577) * (-1039.956) (-1039.710) (-1038.899) [-1040.179] -- 0:00:46
      279500 -- [-1038.616] (-1042.350) (-1039.625) (-1040.643) * (-1039.592) (-1039.610) [-1038.836] (-1037.758) -- 0:00:46
      280000 -- (-1039.221) (-1041.239) [-1039.844] (-1038.788) * (-1040.133) (-1039.339) [-1038.890] (-1038.703) -- 0:00:46

      Average standard deviation of split frequencies: 0.019875

      280500 -- (-1038.627) (-1040.189) [-1040.236] (-1038.039) * (-1041.640) (-1040.635) [-1040.815] (-1038.631) -- 0:00:46
      281000 -- (-1039.487) (-1038.344) (-1040.237) [-1039.395] * [-1041.326] (-1038.010) (-1038.319) (-1038.176) -- 0:00:46
      281500 -- (-1039.588) [-1038.134] (-1041.215) (-1038.661) * (-1039.971) (-1038.623) (-1038.111) [-1040.724] -- 0:00:45
      282000 -- (-1038.055) (-1037.994) (-1040.820) [-1039.358] * (-1041.650) (-1038.158) (-1040.087) [-1046.257] -- 0:00:45
      282500 -- [-1038.521] (-1037.790) (-1040.839) (-1038.804) * (-1041.120) (-1041.912) [-1043.013] (-1042.774) -- 0:00:45
      283000 -- [-1041.144] (-1048.476) (-1042.950) (-1038.609) * (-1041.194) (-1040.140) (-1040.634) [-1039.568] -- 0:00:45
      283500 -- (-1041.490) (-1039.836) [-1038.970] (-1039.095) * (-1040.227) (-1042.855) (-1040.331) [-1039.568] -- 0:00:45
      284000 -- (-1041.779) (-1039.382) [-1039.109] (-1037.967) * [-1039.501] (-1038.961) (-1039.675) (-1039.899) -- 0:00:45
      284500 -- [-1040.290] (-1041.190) (-1038.049) (-1040.876) * (-1043.080) (-1044.465) (-1038.901) [-1039.380] -- 0:00:45
      285000 -- (-1039.945) [-1040.277] (-1041.155) (-1038.424) * (-1041.216) (-1040.132) (-1040.746) [-1042.010] -- 0:00:45

      Average standard deviation of split frequencies: 0.019230

      285500 -- (-1038.138) [-1040.477] (-1040.588) (-1038.468) * (-1040.489) [-1038.274] (-1040.430) (-1041.293) -- 0:00:45
      286000 -- (-1041.098) [-1040.605] (-1042.462) (-1039.553) * (-1038.914) (-1037.979) (-1038.374) [-1039.015] -- 0:00:44
      286500 -- (-1040.193) (-1039.795) (-1040.524) [-1042.633] * (-1043.255) [-1040.729] (-1039.237) (-1038.415) -- 0:00:44
      287000 -- (-1043.695) (-1038.304) (-1042.394) [-1039.190] * (-1039.086) [-1038.655] (-1039.432) (-1044.487) -- 0:00:44
      287500 -- (-1039.313) (-1039.745) [-1037.933] (-1039.305) * (-1046.588) (-1038.700) (-1040.741) [-1039.829] -- 0:00:44
      288000 -- (-1038.354) (-1039.461) [-1037.859] (-1039.572) * (-1038.706) [-1038.914] (-1043.459) (-1041.342) -- 0:00:44
      288500 -- [-1038.648] (-1039.679) (-1039.190) (-1041.483) * [-1040.655] (-1041.886) (-1039.278) (-1042.299) -- 0:00:44
      289000 -- (-1038.760) (-1039.078) [-1040.853] (-1038.027) * [-1040.541] (-1045.744) (-1040.721) (-1043.958) -- 0:00:44
      289500 -- (-1039.449) (-1038.621) [-1042.716] (-1037.955) * (-1040.115) (-1041.908) [-1041.645] (-1041.609) -- 0:00:44
      290000 -- [-1039.028] (-1040.920) (-1043.007) (-1041.433) * (-1040.067) (-1042.779) [-1039.841] (-1044.443) -- 0:00:44

      Average standard deviation of split frequencies: 0.017299

      290500 -- [-1039.459] (-1039.278) (-1044.450) (-1040.711) * (-1042.304) [-1039.643] (-1041.939) (-1038.960) -- 0:00:43
      291000 -- [-1038.716] (-1039.608) (-1045.268) (-1040.261) * [-1039.016] (-1038.104) (-1042.875) (-1037.968) -- 0:00:43
      291500 -- (-1040.317) (-1039.544) (-1043.964) [-1040.942] * [-1038.152] (-1039.808) (-1041.038) (-1039.855) -- 0:00:43
      292000 -- [-1039.117] (-1038.788) (-1046.721) (-1038.012) * [-1038.094] (-1039.900) (-1039.485) (-1042.824) -- 0:00:43
      292500 -- [-1037.856] (-1040.123) (-1040.036) (-1039.421) * (-1039.921) (-1041.158) (-1039.123) [-1041.339] -- 0:00:43
      293000 -- (-1042.163) (-1040.222) [-1040.706] (-1039.418) * (-1038.764) [-1040.573] (-1039.375) (-1041.578) -- 0:00:43
      293500 -- (-1040.832) [-1038.841] (-1038.625) (-1039.106) * (-1039.421) (-1039.850) (-1039.530) [-1041.539] -- 0:00:43
      294000 -- (-1040.265) [-1038.555] (-1039.177) (-1040.185) * [-1039.847] (-1042.887) (-1040.029) (-1038.022) -- 0:00:45
      294500 -- [-1038.294] (-1038.910) (-1042.721) (-1040.092) * (-1042.463) (-1043.723) (-1043.570) [-1042.547] -- 0:00:45
      295000 -- (-1039.631) (-1039.001) [-1041.508] (-1038.483) * (-1041.809) (-1040.821) (-1044.902) [-1041.224] -- 0:00:45

      Average standard deviation of split frequencies: 0.018138

      295500 -- (-1044.388) (-1040.082) (-1042.686) [-1038.599] * (-1038.820) (-1039.779) (-1039.983) [-1037.837] -- 0:00:45
      296000 -- [-1038.984] (-1039.403) (-1040.924) (-1038.482) * (-1037.988) (-1045.095) (-1039.080) [-1043.391] -- 0:00:45
      296500 -- (-1040.440) (-1043.978) (-1039.728) [-1038.336] * (-1038.993) (-1038.574) [-1040.403] (-1044.297) -- 0:00:45
      297000 -- (-1039.730) (-1037.892) (-1039.935) [-1040.985] * [-1038.560] (-1038.871) (-1043.698) (-1043.714) -- 0:00:44
      297500 -- (-1039.971) (-1040.164) (-1039.872) [-1040.672] * (-1038.474) [-1046.467] (-1042.868) (-1039.752) -- 0:00:44
      298000 -- (-1037.801) (-1043.734) (-1039.064) [-1042.127] * (-1038.630) [-1040.320] (-1040.299) (-1041.785) -- 0:00:44
      298500 -- (-1039.185) [-1041.111] (-1038.746) (-1039.397) * (-1037.994) [-1039.338] (-1039.919) (-1041.660) -- 0:00:44
      299000 -- [-1040.205] (-1042.925) (-1038.275) (-1040.851) * [-1039.023] (-1039.754) (-1039.610) (-1038.552) -- 0:00:44
      299500 -- [-1038.488] (-1041.991) (-1038.649) (-1038.432) * [-1038.334] (-1042.235) (-1038.350) (-1039.960) -- 0:00:44
      300000 -- [-1043.666] (-1041.167) (-1038.681) (-1041.689) * [-1044.601] (-1041.459) (-1038.091) (-1043.383) -- 0:00:44

      Average standard deviation of split frequencies: 0.017412

      300500 -- (-1039.693) (-1038.780) (-1041.022) [-1041.441] * [-1040.697] (-1043.296) (-1042.232) (-1040.651) -- 0:00:44
      301000 -- [-1040.714] (-1040.412) (-1043.234) (-1043.682) * [-1038.260] (-1043.331) (-1038.084) (-1040.815) -- 0:00:44
      301500 -- (-1040.466) (-1040.170) (-1042.174) [-1042.004] * (-1040.724) (-1043.653) [-1037.911] (-1040.576) -- 0:00:44
      302000 -- (-1043.163) (-1041.697) [-1039.136] (-1039.412) * [-1043.798] (-1041.125) (-1041.356) (-1041.814) -- 0:00:43
      302500 -- (-1039.531) (-1041.511) (-1039.057) [-1039.421] * (-1047.409) (-1042.792) [-1039.943] (-1040.758) -- 0:00:43
      303000 -- (-1040.715) (-1039.241) [-1039.152] (-1042.470) * [-1043.930] (-1041.804) (-1040.963) (-1038.008) -- 0:00:43
      303500 -- [-1038.406] (-1039.173) (-1039.488) (-1041.631) * [-1041.337] (-1038.793) (-1040.955) (-1038.121) -- 0:00:43
      304000 -- (-1040.526) (-1040.945) [-1039.215] (-1038.709) * (-1041.286) (-1038.402) (-1042.845) [-1039.634] -- 0:00:43
      304500 -- (-1038.254) [-1041.530] (-1038.704) (-1039.405) * (-1041.483) (-1038.978) (-1039.753) [-1040.601] -- 0:00:43
      305000 -- (-1038.776) (-1039.890) [-1039.928] (-1041.893) * (-1039.461) [-1039.437] (-1038.616) (-1038.644) -- 0:00:43

      Average standard deviation of split frequencies: 0.018081

      305500 -- (-1041.198) (-1039.327) [-1038.612] (-1041.778) * (-1039.744) (-1046.570) [-1039.143] (-1039.335) -- 0:00:43
      306000 -- (-1037.934) (-1038.495) [-1043.714] (-1048.496) * (-1040.033) [-1040.928] (-1040.500) (-1040.996) -- 0:00:43
      306500 -- [-1038.740] (-1038.836) (-1039.290) (-1045.869) * (-1041.196) (-1039.150) [-1038.642] (-1041.211) -- 0:00:42
      307000 -- (-1037.807) [-1041.075] (-1039.856) (-1040.809) * (-1040.416) (-1039.201) [-1044.362] (-1038.997) -- 0:00:42
      307500 -- (-1040.715) (-1040.106) [-1039.685] (-1039.211) * (-1039.595) [-1040.513] (-1040.163) (-1042.166) -- 0:00:42
      308000 -- [-1040.851] (-1039.756) (-1039.285) (-1041.053) * (-1040.510) (-1039.870) [-1042.208] (-1041.958) -- 0:00:42
      308500 -- [-1039.567] (-1040.255) (-1039.674) (-1041.407) * (-1042.132) (-1039.010) (-1041.911) [-1037.894] -- 0:00:42
      309000 -- (-1038.761) (-1039.849) (-1042.698) [-1039.825] * (-1039.324) (-1039.496) [-1038.154] (-1039.965) -- 0:00:42
      309500 -- (-1041.178) (-1039.068) (-1044.845) [-1044.404] * (-1039.354) [-1039.850] (-1039.428) (-1038.955) -- 0:00:42
      310000 -- (-1038.852) (-1043.706) (-1039.290) [-1040.233] * (-1040.276) (-1040.116) [-1039.400] (-1042.001) -- 0:00:42

      Average standard deviation of split frequencies: 0.018368

      310500 -- (-1041.140) (-1038.987) (-1040.739) [-1040.618] * (-1039.131) [-1038.703] (-1044.991) (-1039.636) -- 0:00:44
      311000 -- (-1040.518) (-1039.127) [-1037.786] (-1039.061) * [-1039.830] (-1038.267) (-1039.006) (-1043.657) -- 0:00:44
      311500 -- (-1040.330) (-1040.603) (-1038.561) [-1038.676] * [-1038.513] (-1039.202) (-1037.959) (-1038.112) -- 0:00:44
      312000 -- (-1039.041) (-1040.165) [-1040.054] (-1040.273) * [-1041.985] (-1039.038) (-1039.438) (-1039.531) -- 0:00:44
      312500 -- [-1042.519] (-1039.583) (-1039.626) (-1039.317) * (-1041.358) [-1040.571] (-1042.207) (-1039.471) -- 0:00:44
      313000 -- (-1039.030) (-1040.489) (-1040.356) [-1042.385] * (-1039.168) (-1038.439) [-1038.069] (-1039.903) -- 0:00:43
      313500 -- (-1041.609) [-1045.138] (-1041.527) (-1041.852) * (-1039.530) (-1041.059) (-1041.348) [-1039.472] -- 0:00:43
      314000 -- (-1041.480) (-1042.854) [-1040.977] (-1039.845) * (-1039.612) (-1041.892) (-1042.130) [-1041.649] -- 0:00:43
      314500 -- (-1041.618) [-1040.267] (-1040.306) (-1040.072) * (-1039.440) (-1040.363) [-1038.691] (-1040.002) -- 0:00:43
      315000 -- (-1042.536) (-1039.672) [-1039.948] (-1038.471) * [-1039.782] (-1040.947) (-1040.808) (-1038.467) -- 0:00:43

      Average standard deviation of split frequencies: 0.018564

      315500 -- (-1046.610) [-1040.918] (-1039.392) (-1038.568) * (-1040.607) [-1040.320] (-1039.563) (-1041.106) -- 0:00:43
      316000 -- (-1042.379) (-1040.658) (-1037.850) [-1038.917] * [-1040.188] (-1038.197) (-1040.587) (-1039.907) -- 0:00:43
      316500 -- (-1038.186) (-1038.126) (-1038.081) [-1040.621] * [-1041.049] (-1039.836) (-1038.402) (-1044.312) -- 0:00:43
      317000 -- [-1038.345] (-1039.355) (-1038.471) (-1041.380) * (-1039.356) [-1044.053] (-1039.581) (-1041.753) -- 0:00:43
      317500 -- (-1045.228) (-1038.536) [-1040.327] (-1038.568) * (-1042.245) (-1039.757) [-1042.298] (-1040.574) -- 0:00:42
      318000 -- [-1043.089] (-1039.290) (-1045.258) (-1041.961) * (-1041.500) (-1037.678) (-1041.281) [-1040.503] -- 0:00:42
      318500 -- (-1042.336) (-1039.478) [-1043.206] (-1044.287) * (-1039.068) (-1039.711) (-1041.471) [-1037.830] -- 0:00:42
      319000 -- (-1041.357) (-1039.904) [-1040.726] (-1042.881) * (-1040.050) (-1043.027) [-1040.575] (-1039.113) -- 0:00:42
      319500 -- [-1040.063] (-1039.755) (-1044.233) (-1041.917) * [-1039.872] (-1042.743) (-1041.253) (-1039.122) -- 0:00:42
      320000 -- [-1038.322] (-1038.843) (-1042.717) (-1041.101) * (-1039.482) [-1039.037] (-1041.250) (-1038.625) -- 0:00:42

      Average standard deviation of split frequencies: 0.018703

      320500 -- (-1040.548) (-1039.466) [-1039.832] (-1040.539) * (-1041.347) (-1038.724) [-1039.365] (-1038.305) -- 0:00:42
      321000 -- [-1038.771] (-1040.390) (-1039.465) (-1039.679) * (-1041.563) (-1039.478) [-1039.115] (-1041.718) -- 0:00:42
      321500 -- (-1038.265) (-1038.560) [-1038.690] (-1038.659) * (-1041.710) (-1040.698) [-1038.867] (-1042.993) -- 0:00:42
      322000 -- (-1038.107) [-1038.702] (-1038.124) (-1039.963) * (-1038.306) (-1038.698) [-1039.879] (-1041.552) -- 0:00:42
      322500 -- (-1039.148) (-1039.261) [-1039.669] (-1044.050) * [-1039.653] (-1040.250) (-1043.127) (-1045.309) -- 0:00:42
      323000 -- (-1040.362) [-1041.838] (-1038.554) (-1045.504) * (-1041.272) (-1040.335) [-1038.526] (-1042.224) -- 0:00:41
      323500 -- (-1040.122) (-1040.211) (-1039.996) [-1046.524] * (-1040.413) (-1038.907) (-1039.019) [-1041.429] -- 0:00:41
      324000 -- (-1039.060) [-1042.923] (-1038.734) (-1039.593) * (-1039.326) (-1040.113) [-1038.653] (-1044.580) -- 0:00:41
      324500 -- (-1039.241) (-1040.550) [-1038.334] (-1038.298) * [-1038.222] (-1038.936) (-1038.993) (-1037.984) -- 0:00:41
      325000 -- (-1039.509) (-1037.891) (-1040.050) [-1040.982] * (-1038.399) (-1039.290) (-1039.276) [-1041.077] -- 0:00:41

      Average standard deviation of split frequencies: 0.018718

      325500 -- (-1038.540) [-1037.911] (-1043.365) (-1040.536) * (-1041.328) (-1038.767) [-1039.333] (-1040.964) -- 0:00:41
      326000 -- (-1039.608) [-1037.905] (-1038.348) (-1043.151) * (-1038.754) (-1038.424) (-1042.318) [-1038.688] -- 0:00:41
      326500 -- (-1041.602) (-1038.369) (-1041.331) [-1041.645] * (-1040.857) (-1038.238) (-1038.608) [-1038.583] -- 0:00:43
      327000 -- (-1039.709) (-1039.199) (-1046.162) [-1040.013] * (-1040.079) [-1038.923] (-1044.701) (-1040.408) -- 0:00:43
      327500 -- (-1039.215) [-1038.747] (-1044.248) (-1038.173) * (-1039.193) [-1040.841] (-1042.254) (-1038.671) -- 0:00:43
      328000 -- (-1044.391) (-1043.305) (-1041.558) [-1040.375] * [-1039.310] (-1040.329) (-1041.317) (-1038.315) -- 0:00:43
      328500 -- (-1039.602) (-1039.329) [-1038.135] (-1040.047) * (-1039.911) [-1040.012] (-1039.351) (-1038.586) -- 0:00:42
      329000 -- (-1040.731) (-1038.479) [-1038.235] (-1042.375) * (-1039.363) (-1041.137) [-1038.357] (-1040.852) -- 0:00:42
      329500 -- (-1042.582) (-1041.078) [-1038.835] (-1041.923) * [-1039.874] (-1041.926) (-1038.502) (-1040.217) -- 0:00:42
      330000 -- (-1046.479) [-1040.891] (-1038.181) (-1041.358) * [-1038.362] (-1041.753) (-1038.620) (-1040.324) -- 0:00:42

      Average standard deviation of split frequencies: 0.018375

      330500 -- (-1040.056) (-1040.097) [-1038.417] (-1040.097) * [-1038.144] (-1041.943) (-1040.677) (-1043.312) -- 0:00:42
      331000 -- (-1045.012) (-1041.458) (-1042.913) [-1038.965] * [-1037.614] (-1040.949) (-1039.886) (-1039.712) -- 0:00:42
      331500 -- [-1040.588] (-1040.710) (-1041.322) (-1040.464) * [-1039.444] (-1047.083) (-1042.688) (-1038.939) -- 0:00:42
      332000 -- (-1038.844) (-1040.160) [-1038.662] (-1041.017) * [-1038.543] (-1039.692) (-1041.449) (-1039.560) -- 0:00:42
      332500 -- (-1040.393) [-1038.422] (-1039.726) (-1041.607) * (-1037.723) (-1039.573) [-1040.050] (-1038.137) -- 0:00:42
      333000 -- [-1042.337] (-1039.204) (-1041.087) (-1041.471) * [-1040.624] (-1037.667) (-1039.154) (-1042.833) -- 0:00:42
      333500 -- (-1038.280) (-1039.826) (-1041.060) [-1041.423] * (-1039.538) [-1038.455] (-1038.641) (-1040.043) -- 0:00:41
      334000 -- (-1039.532) [-1040.038] (-1041.281) (-1042.447) * (-1038.630) (-1040.268) [-1042.394] (-1039.255) -- 0:00:41
      334500 -- (-1039.552) (-1044.463) [-1040.655] (-1041.740) * (-1043.824) [-1039.690] (-1040.351) (-1041.966) -- 0:00:41
      335000 -- (-1040.604) (-1040.533) [-1041.885] (-1042.949) * (-1041.758) (-1038.292) [-1039.340] (-1043.390) -- 0:00:41

      Average standard deviation of split frequencies: 0.018395

      335500 -- (-1040.891) (-1040.026) (-1040.477) [-1040.456] * (-1040.130) (-1038.992) [-1040.156] (-1042.017) -- 0:00:41
      336000 -- [-1039.907] (-1040.868) (-1041.059) (-1038.154) * (-1043.031) (-1038.460) [-1040.726] (-1042.654) -- 0:00:41
      336500 -- [-1043.827] (-1040.220) (-1041.310) (-1043.939) * [-1041.263] (-1038.034) (-1045.096) (-1038.323) -- 0:00:41
      337000 -- (-1040.513) (-1040.739) [-1040.353] (-1045.777) * (-1038.137) [-1038.424] (-1043.924) (-1040.012) -- 0:00:41
      337500 -- [-1042.277] (-1039.989) (-1039.726) (-1042.528) * (-1037.939) (-1039.009) (-1041.231) [-1040.101] -- 0:00:41
      338000 -- [-1039.943] (-1043.195) (-1038.678) (-1041.072) * (-1037.986) (-1041.274) [-1044.058] (-1037.995) -- 0:00:41
      338500 -- [-1037.823] (-1043.898) (-1039.781) (-1038.869) * (-1043.206) (-1038.508) [-1037.723] (-1037.977) -- 0:00:41
      339000 -- [-1038.737] (-1040.838) (-1046.246) (-1038.004) * (-1044.724) (-1038.607) [-1037.663] (-1041.154) -- 0:00:40
      339500 -- (-1039.642) [-1038.580] (-1043.454) (-1039.230) * [-1039.370] (-1041.666) (-1041.193) (-1039.649) -- 0:00:40
      340000 -- (-1041.459) (-1039.064) [-1040.028] (-1038.934) * (-1044.240) [-1040.446] (-1038.944) (-1040.100) -- 0:00:40

      Average standard deviation of split frequencies: 0.017989

      340500 -- (-1041.232) (-1042.254) (-1050.745) [-1039.130] * (-1040.018) (-1039.320) (-1040.347) [-1038.992] -- 0:00:40
      341000 -- (-1038.886) [-1038.849] (-1043.624) (-1038.346) * (-1040.432) (-1038.954) (-1040.454) [-1040.020] -- 0:00:40
      341500 -- (-1038.194) [-1041.096] (-1044.442) (-1038.173) * [-1042.117] (-1041.127) (-1039.834) (-1038.142) -- 0:00:40
      342000 -- (-1042.028) [-1038.623] (-1039.259) (-1040.071) * (-1042.041) (-1042.882) (-1040.185) [-1038.565] -- 0:00:40
      342500 -- [-1042.996] (-1041.073) (-1042.979) (-1040.865) * (-1040.042) (-1039.621) (-1038.760) [-1037.966] -- 0:00:40
      343000 -- (-1041.360) (-1039.333) (-1045.861) [-1038.833] * [-1040.445] (-1040.637) (-1039.356) (-1037.995) -- 0:00:40
      343500 -- (-1039.408) (-1042.672) [-1042.287] (-1039.804) * (-1040.420) (-1039.148) [-1042.636] (-1042.341) -- 0:00:42
      344000 -- [-1040.185] (-1039.852) (-1041.487) (-1041.260) * (-1041.094) [-1039.090] (-1042.159) (-1042.208) -- 0:00:41
      344500 -- (-1039.096) [-1041.489] (-1040.949) (-1039.874) * (-1041.869) [-1039.249] (-1042.053) (-1042.206) -- 0:00:41
      345000 -- [-1039.461] (-1041.168) (-1039.608) (-1038.979) * (-1041.805) (-1038.328) (-1043.067) [-1045.059] -- 0:00:41

      Average standard deviation of split frequencies: 0.017182

      345500 -- (-1039.328) (-1040.073) (-1040.307) [-1038.636] * [-1038.834] (-1037.974) (-1041.763) (-1040.609) -- 0:00:41
      346000 -- [-1039.472] (-1038.728) (-1042.800) (-1040.455) * (-1038.649) [-1040.707] (-1040.117) (-1039.212) -- 0:00:41
      346500 -- [-1045.163] (-1038.384) (-1043.308) (-1040.526) * [-1039.301] (-1039.418) (-1038.605) (-1041.340) -- 0:00:41
      347000 -- [-1040.152] (-1038.637) (-1043.273) (-1040.049) * (-1037.862) (-1040.601) [-1039.102] (-1040.078) -- 0:00:41
      347500 -- [-1041.062] (-1039.894) (-1042.408) (-1041.848) * (-1037.834) (-1040.541) [-1038.919] (-1039.703) -- 0:00:41
      348000 -- (-1046.598) [-1038.857] (-1041.002) (-1041.441) * (-1037.855) (-1038.701) [-1041.763] (-1037.820) -- 0:00:41
      348500 -- (-1040.324) (-1039.853) (-1039.787) [-1038.843] * (-1040.181) (-1039.570) (-1039.680) [-1040.897] -- 0:00:41
      349000 -- (-1040.265) (-1038.324) [-1041.312] (-1038.756) * (-1040.729) [-1040.849] (-1039.171) (-1039.611) -- 0:00:41
      349500 -- (-1038.366) [-1039.353] (-1041.639) (-1040.126) * (-1040.545) (-1039.616) (-1038.407) [-1040.917] -- 0:00:40
      350000 -- [-1043.136] (-1041.277) (-1041.555) (-1043.215) * (-1040.408) (-1038.418) [-1038.223] (-1038.698) -- 0:00:40

      Average standard deviation of split frequencies: 0.015982

      350500 -- (-1040.304) (-1042.158) [-1041.655] (-1042.930) * (-1042.171) (-1042.190) (-1040.009) [-1039.221] -- 0:00:40
      351000 -- (-1039.156) (-1040.021) [-1040.230] (-1041.239) * (-1041.998) (-1041.874) (-1040.676) [-1039.995] -- 0:00:40
      351500 -- (-1041.665) [-1040.497] (-1042.075) (-1039.490) * (-1039.912) (-1040.888) (-1039.461) [-1040.251] -- 0:00:40
      352000 -- (-1040.969) (-1038.924) (-1039.973) [-1040.621] * (-1041.757) (-1043.381) (-1042.410) [-1039.312] -- 0:00:40
      352500 -- (-1042.190) (-1049.105) [-1039.353] (-1044.900) * (-1041.294) [-1038.992] (-1039.490) (-1040.185) -- 0:00:40
      353000 -- [-1041.483] (-1046.515) (-1038.493) (-1039.369) * (-1044.589) (-1043.375) (-1040.272) [-1039.674] -- 0:00:40
      353500 -- (-1042.059) (-1040.832) (-1038.124) [-1037.775] * (-1041.009) (-1041.879) (-1042.383) [-1040.494] -- 0:00:40
      354000 -- (-1042.915) (-1041.334) [-1037.996] (-1039.273) * (-1040.411) [-1039.120] (-1042.000) (-1041.259) -- 0:00:40
      354500 -- (-1040.839) (-1039.459) (-1038.016) [-1037.923] * (-1037.951) [-1039.811] (-1042.463) (-1039.861) -- 0:00:40
      355000 -- (-1039.640) [-1040.063] (-1041.918) (-1039.963) * (-1038.601) [-1040.967] (-1040.385) (-1039.639) -- 0:00:39

      Average standard deviation of split frequencies: 0.016046

      355500 -- (-1039.217) (-1042.549) (-1038.531) [-1042.333] * [-1039.388] (-1042.448) (-1040.489) (-1041.587) -- 0:00:39
      356000 -- [-1040.350] (-1041.815) (-1040.327) (-1039.417) * (-1041.974) (-1039.639) [-1044.176] (-1041.987) -- 0:00:39
      356500 -- (-1041.259) [-1041.696] (-1039.813) (-1038.301) * (-1040.505) (-1040.528) [-1040.068] (-1040.467) -- 0:00:39
      357000 -- (-1040.393) [-1040.374] (-1041.410) (-1040.774) * [-1041.144] (-1040.865) (-1043.099) (-1040.377) -- 0:00:39
      357500 -- (-1039.524) (-1038.722) (-1042.290) [-1041.016] * (-1038.096) [-1039.322] (-1043.640) (-1039.556) -- 0:00:39
      358000 -- (-1038.269) [-1040.259] (-1038.231) (-1038.289) * (-1040.337) (-1041.036) [-1039.978] (-1038.455) -- 0:00:39
      358500 -- (-1038.555) [-1039.659] (-1039.009) (-1039.538) * (-1040.835) [-1038.955] (-1037.653) (-1038.811) -- 0:00:39
      359000 -- (-1042.822) (-1044.098) [-1042.356] (-1040.390) * (-1042.762) [-1038.956] (-1038.739) (-1041.226) -- 0:00:39
      359500 -- (-1040.392) (-1053.762) (-1041.156) [-1039.534] * (-1040.849) (-1041.381) (-1039.680) [-1039.519] -- 0:00:40
      360000 -- (-1039.043) (-1039.465) (-1041.496) [-1039.012] * [-1040.508] (-1038.661) (-1038.846) (-1038.729) -- 0:00:40

      Average standard deviation of split frequencies: 0.016175

      360500 -- (-1038.091) (-1041.271) (-1038.160) [-1040.195] * (-1038.576) [-1040.541] (-1038.297) (-1040.728) -- 0:00:40
      361000 -- [-1037.762] (-1039.614) (-1041.236) (-1043.419) * (-1038.766) (-1043.008) (-1039.610) [-1038.778] -- 0:00:40
      361500 -- (-1039.296) (-1045.398) [-1040.214] (-1042.034) * (-1038.734) (-1042.625) (-1039.168) [-1038.868] -- 0:00:40
      362000 -- (-1043.471) [-1046.306] (-1040.560) (-1039.345) * [-1041.393] (-1041.196) (-1037.911) (-1038.924) -- 0:00:40
      362500 -- [-1040.594] (-1045.119) (-1039.501) (-1040.602) * (-1041.571) (-1042.113) [-1038.437] (-1044.959) -- 0:00:40
      363000 -- [-1039.604] (-1043.606) (-1041.054) (-1043.789) * [-1039.954] (-1040.308) (-1038.438) (-1038.725) -- 0:00:40
      363500 -- [-1038.583] (-1040.118) (-1044.743) (-1042.855) * (-1040.693) (-1043.258) (-1039.106) [-1039.168] -- 0:00:40
      364000 -- (-1041.627) [-1039.482] (-1044.344) (-1037.883) * (-1039.270) [-1039.365] (-1038.941) (-1041.070) -- 0:00:40
      364500 -- (-1039.586) (-1041.502) [-1040.900] (-1038.215) * (-1044.391) [-1039.079] (-1038.709) (-1041.318) -- 0:00:40
      365000 -- (-1041.403) (-1038.783) (-1043.016) [-1039.160] * (-1042.479) [-1038.428] (-1039.443) (-1040.863) -- 0:00:40

      Average standard deviation of split frequencies: 0.015153

      365500 -- (-1039.872) [-1038.344] (-1040.132) (-1040.527) * (-1042.800) (-1039.846) (-1039.277) [-1038.904] -- 0:00:39
      366000 -- [-1040.276] (-1038.339) (-1041.380) (-1039.691) * (-1040.447) (-1038.854) [-1039.475] (-1038.450) -- 0:00:39
      366500 -- [-1039.179] (-1039.492) (-1039.311) (-1040.207) * (-1038.527) [-1042.919] (-1041.006) (-1038.460) -- 0:00:39
      367000 -- [-1041.203] (-1040.107) (-1038.361) (-1039.661) * (-1039.977) (-1038.778) (-1039.253) [-1038.552] -- 0:00:39
      367500 -- (-1041.255) (-1039.821) [-1040.889] (-1039.158) * (-1040.002) (-1038.658) (-1039.164) [-1039.688] -- 0:00:39
      368000 -- (-1040.782) (-1038.829) [-1040.086] (-1040.260) * (-1037.625) [-1039.894] (-1041.689) (-1040.287) -- 0:00:39
      368500 -- (-1039.387) (-1038.573) (-1038.697) [-1044.708] * (-1037.625) [-1039.564] (-1042.777) (-1043.877) -- 0:00:39
      369000 -- [-1041.314] (-1039.451) (-1038.995) (-1039.230) * (-1037.967) (-1040.378) [-1039.623] (-1038.808) -- 0:00:39
      369500 -- (-1042.712) [-1039.435] (-1038.249) (-1039.477) * (-1039.360) (-1039.570) [-1039.786] (-1038.537) -- 0:00:39
      370000 -- (-1048.851) [-1043.006] (-1038.370) (-1039.488) * (-1039.320) [-1039.285] (-1040.436) (-1038.794) -- 0:00:39

      Average standard deviation of split frequencies: 0.015023

      370500 -- (-1042.771) (-1041.250) (-1039.178) [-1039.926] * (-1038.368) [-1039.284] (-1045.486) (-1038.953) -- 0:00:39
      371000 -- (-1041.770) (-1042.589) [-1038.670] (-1038.464) * (-1038.241) [-1038.644] (-1045.366) (-1039.311) -- 0:00:38
      371500 -- (-1046.082) (-1039.860) [-1039.582] (-1039.703) * [-1038.978] (-1038.469) (-1045.265) (-1046.298) -- 0:00:38
      372000 -- [-1041.651] (-1038.654) (-1038.220) (-1040.981) * (-1042.060) (-1044.347) (-1044.447) [-1043.165] -- 0:00:38
      372500 -- (-1039.698) (-1040.200) [-1038.677] (-1043.292) * [-1038.763] (-1040.173) (-1038.669) (-1039.873) -- 0:00:38
      373000 -- [-1039.495] (-1039.655) (-1038.956) (-1039.142) * [-1042.850] (-1039.957) (-1039.683) (-1043.619) -- 0:00:38
      373500 -- (-1038.992) (-1037.934) (-1041.154) [-1039.490] * (-1041.132) [-1040.282] (-1038.890) (-1039.969) -- 0:00:38
      374000 -- (-1038.885) (-1039.417) [-1038.871] (-1040.413) * (-1039.847) (-1040.165) [-1039.634] (-1042.245) -- 0:00:38
      374500 -- (-1039.755) (-1039.475) [-1038.111] (-1041.192) * (-1039.755) (-1043.318) [-1041.054] (-1038.653) -- 0:00:38
      375000 -- [-1040.504] (-1041.387) (-1038.824) (-1040.529) * (-1038.411) (-1042.612) (-1040.212) [-1038.322] -- 0:00:38

      Average standard deviation of split frequencies: 0.013717

      375500 -- (-1038.655) (-1040.404) [-1038.659] (-1039.892) * [-1039.306] (-1040.319) (-1040.023) (-1038.704) -- 0:00:39
      376000 -- (-1039.624) (-1038.954) (-1038.874) [-1040.350] * (-1039.888) (-1039.949) (-1041.078) [-1038.094] -- 0:00:39
      376500 -- (-1038.843) (-1038.532) (-1041.080) [-1042.310] * (-1038.967) (-1041.339) (-1043.356) [-1037.881] -- 0:00:39
      377000 -- (-1039.045) (-1039.043) (-1042.278) [-1038.505] * (-1038.872) (-1039.103) (-1040.459) [-1038.157] -- 0:00:39
      377500 -- (-1039.058) (-1039.697) [-1040.208] (-1038.425) * (-1039.736) [-1037.729] (-1039.020) (-1038.683) -- 0:00:39
      378000 -- (-1039.923) (-1038.416) [-1040.377] (-1041.110) * (-1040.063) (-1040.195) (-1038.856) [-1040.574] -- 0:00:39
      378500 -- (-1041.882) [-1038.072] (-1043.952) (-1038.723) * (-1040.824) (-1039.558) [-1040.354] (-1041.271) -- 0:00:39
      379000 -- (-1038.995) (-1038.586) [-1040.349] (-1038.513) * (-1041.956) [-1041.025] (-1041.914) (-1040.122) -- 0:00:39
      379500 -- (-1038.532) [-1040.260] (-1038.522) (-1038.752) * (-1043.531) (-1042.307) (-1039.004) [-1040.063] -- 0:00:39
      380000 -- [-1040.888] (-1039.788) (-1038.593) (-1039.241) * [-1039.410] (-1040.173) (-1042.586) (-1039.087) -- 0:00:39

      Average standard deviation of split frequencies: 0.013768

      380500 -- (-1039.332) [-1042.414] (-1043.566) (-1039.934) * (-1041.739) [-1039.421] (-1039.768) (-1040.620) -- 0:00:39
      381000 -- (-1044.821) [-1040.559] (-1038.800) (-1038.650) * (-1041.766) (-1037.816) [-1038.812] (-1044.179) -- 0:00:38
      381500 -- (-1039.165) [-1040.300] (-1040.061) (-1039.733) * [-1041.810] (-1040.789) (-1044.548) (-1040.287) -- 0:00:38
      382000 -- (-1038.634) (-1038.830) (-1038.980) [-1039.658] * [-1041.227] (-1040.490) (-1042.300) (-1038.717) -- 0:00:38
      382500 -- (-1042.518) (-1038.708) [-1039.136] (-1041.891) * (-1041.568) (-1038.748) [-1040.923] (-1038.815) -- 0:00:38
      383000 -- [-1038.213] (-1042.965) (-1041.035) (-1048.014) * (-1041.729) (-1039.221) [-1040.338] (-1040.661) -- 0:00:38
      383500 -- [-1038.230] (-1039.600) (-1040.264) (-1040.176) * (-1040.650) (-1039.026) (-1039.450) [-1038.521] -- 0:00:38
      384000 -- (-1038.071) (-1042.854) [-1040.760] (-1043.133) * (-1038.867) (-1039.329) (-1038.928) [-1039.036] -- 0:00:38
      384500 -- [-1038.426] (-1040.525) (-1039.421) (-1041.084) * (-1038.896) (-1042.005) [-1038.802] (-1043.470) -- 0:00:38
      385000 -- (-1042.966) (-1040.601) (-1041.455) [-1039.512] * (-1042.067) (-1041.685) [-1043.793] (-1040.171) -- 0:00:38

      Average standard deviation of split frequencies: 0.013937

      385500 -- (-1042.762) [-1038.540] (-1039.834) (-1039.932) * [-1040.740] (-1041.795) (-1041.178) (-1039.656) -- 0:00:38
      386000 -- (-1042.659) (-1038.322) (-1042.773) [-1047.407] * [-1040.096] (-1039.775) (-1040.638) (-1037.768) -- 0:00:38
      386500 -- (-1045.221) [-1042.725] (-1039.861) (-1042.013) * [-1038.893] (-1039.915) (-1040.445) (-1037.775) -- 0:00:38
      387000 -- (-1043.914) (-1043.225) [-1039.759] (-1039.751) * (-1038.466) [-1040.663] (-1041.770) (-1041.972) -- 0:00:38
      387500 -- [-1044.954] (-1038.680) (-1039.421) (-1038.753) * (-1039.524) [-1039.979] (-1039.716) (-1044.281) -- 0:00:37
      388000 -- (-1044.171) (-1041.524) (-1039.665) [-1041.897] * (-1041.202) (-1040.757) [-1042.989] (-1040.555) -- 0:00:37
      388500 -- (-1040.486) (-1041.695) [-1039.807] (-1041.241) * (-1044.719) (-1043.062) [-1038.967] (-1039.753) -- 0:00:37
      389000 -- [-1038.524] (-1042.662) (-1039.871) (-1042.156) * (-1046.424) [-1040.117] (-1039.550) (-1038.841) -- 0:00:37
      389500 -- (-1037.792) (-1041.421) [-1039.125] (-1039.897) * (-1040.556) [-1039.685] (-1041.370) (-1038.438) -- 0:00:37
      390000 -- (-1037.875) [-1038.768] (-1040.200) (-1038.638) * (-1039.123) [-1039.615] (-1038.434) (-1038.821) -- 0:00:37

      Average standard deviation of split frequencies: 0.013952

      390500 -- (-1041.452) [-1040.608] (-1038.988) (-1040.452) * [-1039.906] (-1038.949) (-1040.314) (-1042.063) -- 0:00:37
      391000 -- (-1038.939) [-1040.952] (-1039.373) (-1041.343) * [-1041.120] (-1039.435) (-1038.824) (-1040.206) -- 0:00:37
      391500 -- (-1040.097) [-1039.024] (-1039.033) (-1039.251) * [-1043.329] (-1040.258) (-1038.498) (-1042.464) -- 0:00:38
      392000 -- (-1046.085) (-1038.159) [-1038.078] (-1040.120) * (-1041.101) [-1039.496] (-1041.138) (-1040.054) -- 0:00:38
      392500 -- [-1039.489] (-1040.642) (-1043.363) (-1040.280) * [-1038.522] (-1041.163) (-1041.194) (-1040.744) -- 0:00:38
      393000 -- [-1040.409] (-1039.346) (-1041.270) (-1039.702) * [-1038.667] (-1043.659) (-1039.654) (-1039.011) -- 0:00:38
      393500 -- (-1039.220) [-1040.439] (-1038.328) (-1040.274) * (-1038.375) (-1041.281) [-1039.629] (-1041.648) -- 0:00:38
      394000 -- (-1040.125) (-1040.439) [-1038.674] (-1043.279) * (-1040.534) [-1039.884] (-1039.290) (-1039.733) -- 0:00:38
      394500 -- (-1039.148) (-1039.709) [-1042.178] (-1042.420) * (-1039.519) (-1041.028) [-1041.239] (-1039.679) -- 0:00:38
      395000 -- [-1039.841] (-1041.089) (-1040.185) (-1038.929) * [-1043.607] (-1044.862) (-1040.004) (-1039.756) -- 0:00:38

      Average standard deviation of split frequencies: 0.013392

      395500 -- [-1039.854] (-1041.875) (-1038.831) (-1042.099) * (-1042.399) (-1041.301) [-1039.033] (-1038.470) -- 0:00:38
      396000 -- (-1040.522) (-1039.508) [-1040.596] (-1042.400) * [-1040.416] (-1041.200) (-1038.683) (-1037.585) -- 0:00:38
      396500 -- (-1041.456) (-1041.837) (-1041.998) [-1037.973] * (-1041.096) (-1037.742) (-1038.943) [-1039.217] -- 0:00:38
      397000 -- (-1041.033) [-1038.962] (-1039.064) (-1039.822) * (-1039.331) [-1039.426] (-1038.884) (-1039.155) -- 0:00:37
      397500 -- (-1042.296) [-1038.630] (-1039.808) (-1040.796) * (-1039.746) [-1041.724] (-1039.995) (-1039.196) -- 0:00:37
      398000 -- (-1041.605) (-1039.801) [-1039.023] (-1042.108) * (-1038.613) (-1038.999) (-1040.215) [-1038.002] -- 0:00:37
      398500 -- (-1037.905) [-1039.583] (-1039.752) (-1038.317) * (-1040.571) (-1039.739) (-1041.017) [-1037.892] -- 0:00:37
      399000 -- (-1038.398) (-1037.814) [-1038.486] (-1038.430) * (-1041.512) (-1042.347) (-1040.764) [-1038.409] -- 0:00:37
      399500 -- (-1040.596) (-1038.782) (-1041.643) [-1038.262] * (-1038.969) (-1040.136) (-1038.349) [-1039.472] -- 0:00:37
      400000 -- (-1041.041) (-1040.240) (-1040.308) [-1038.494] * (-1039.001) [-1039.901] (-1038.775) (-1039.716) -- 0:00:37

      Average standard deviation of split frequencies: 0.013236

      400500 -- (-1039.937) [-1040.131] (-1039.367) (-1041.433) * [-1040.141] (-1042.648) (-1038.795) (-1039.397) -- 0:00:37
      401000 -- (-1041.148) [-1041.271] (-1040.448) (-1041.200) * [-1039.203] (-1039.763) (-1038.667) (-1038.570) -- 0:00:37
      401500 -- (-1040.989) (-1038.216) [-1039.939] (-1042.533) * (-1040.067) (-1041.234) [-1040.075] (-1039.130) -- 0:00:37
      402000 -- (-1040.558) [-1039.153] (-1043.654) (-1042.315) * [-1038.781] (-1039.572) (-1040.973) (-1039.272) -- 0:00:37
      402500 -- (-1040.159) (-1039.093) [-1040.016] (-1040.538) * (-1039.995) (-1041.846) [-1039.130] (-1039.051) -- 0:00:37
      403000 -- (-1039.735) [-1041.375] (-1038.997) (-1040.665) * (-1038.890) (-1039.220) [-1038.089] (-1040.019) -- 0:00:37
      403500 -- (-1039.189) (-1039.975) (-1038.161) [-1040.585] * [-1041.490] (-1038.928) (-1042.491) (-1039.164) -- 0:00:36
      404000 -- [-1039.487] (-1040.532) (-1038.857) (-1039.966) * [-1044.396] (-1040.348) (-1047.629) (-1039.130) -- 0:00:36
      404500 -- (-1038.960) (-1038.423) (-1038.194) [-1042.153] * (-1039.991) (-1041.211) [-1039.488] (-1039.167) -- 0:00:36
      405000 -- (-1040.194) (-1041.779) (-1039.134) [-1039.644] * (-1041.458) (-1040.521) (-1040.843) [-1041.145] -- 0:00:36

      Average standard deviation of split frequencies: 0.012917

      405500 -- (-1040.667) (-1041.332) (-1038.641) [-1039.261] * (-1041.710) [-1039.354] (-1039.891) (-1040.113) -- 0:00:36
      406000 -- (-1040.116) [-1038.993] (-1046.295) (-1040.237) * (-1039.135) [-1040.501] (-1038.220) (-1040.000) -- 0:00:36
      406500 -- [-1037.863] (-1039.921) (-1041.406) (-1043.424) * (-1039.252) (-1041.169) [-1039.764] (-1042.474) -- 0:00:36
      407000 -- (-1039.890) [-1043.138] (-1042.335) (-1049.630) * [-1039.249] (-1040.046) (-1044.497) (-1044.327) -- 0:00:36
      407500 -- (-1042.420) (-1039.359) [-1040.851] (-1045.196) * (-1038.533) (-1041.160) [-1040.839] (-1040.198) -- 0:00:37
      408000 -- (-1040.455) [-1038.720] (-1040.753) (-1038.898) * (-1040.670) (-1041.481) (-1042.333) [-1040.433] -- 0:00:37
      408500 -- (-1045.021) (-1039.429) [-1042.033] (-1038.797) * (-1040.837) [-1039.984] (-1047.365) (-1040.374) -- 0:00:37
      409000 -- (-1042.254) [-1038.742] (-1040.623) (-1038.909) * (-1038.906) (-1040.966) (-1043.480) [-1043.508] -- 0:00:37
      409500 -- [-1039.529] (-1044.093) (-1039.186) (-1040.004) * (-1039.782) (-1041.452) (-1040.203) [-1041.136] -- 0:00:37
      410000 -- [-1040.295] (-1038.675) (-1040.395) (-1037.990) * (-1039.836) (-1040.200) [-1040.592] (-1042.090) -- 0:00:37

      Average standard deviation of split frequencies: 0.012627

      410500 -- [-1041.268] (-1039.124) (-1039.848) (-1042.922) * [-1039.382] (-1040.698) (-1043.887) (-1041.983) -- 0:00:37
      411000 -- (-1042.378) [-1038.923] (-1040.913) (-1039.460) * (-1042.786) (-1038.927) (-1041.382) [-1039.736] -- 0:00:37
      411500 -- (-1040.625) (-1042.943) [-1040.367] (-1038.196) * [-1038.213] (-1040.301) (-1041.619) (-1039.576) -- 0:00:37
      412000 -- [-1044.673] (-1039.568) (-1039.561) (-1037.828) * (-1038.840) (-1041.027) [-1042.483] (-1039.397) -- 0:00:37
      412500 -- (-1042.764) (-1040.807) (-1040.048) [-1041.091] * (-1040.898) (-1038.099) [-1039.924] (-1041.317) -- 0:00:37
      413000 -- [-1039.029] (-1038.393) (-1039.526) (-1039.838) * [-1039.426] (-1038.179) (-1040.071) (-1042.971) -- 0:00:36
      413500 -- [-1039.293] (-1039.879) (-1040.045) (-1041.910) * (-1038.938) (-1038.837) [-1041.056] (-1047.713) -- 0:00:36
      414000 -- (-1041.267) [-1041.167] (-1038.144) (-1044.533) * [-1038.048] (-1041.446) (-1039.237) (-1043.526) -- 0:00:36
      414500 -- (-1041.956) (-1038.350) (-1038.719) [-1039.280] * [-1038.739] (-1041.435) (-1039.829) (-1038.119) -- 0:00:36
      415000 -- [-1038.157] (-1039.815) (-1039.757) (-1038.836) * (-1040.164) (-1039.726) (-1039.551) [-1038.655] -- 0:00:36

      Average standard deviation of split frequencies: 0.011119

      415500 -- (-1042.186) (-1039.050) [-1040.770] (-1041.490) * (-1041.788) [-1038.598] (-1045.431) (-1039.185) -- 0:00:36
      416000 -- [-1038.365] (-1040.543) (-1039.391) (-1038.437) * [-1037.914] (-1037.763) (-1041.953) (-1038.711) -- 0:00:36
      416500 -- (-1041.335) (-1040.149) [-1040.486] (-1039.419) * [-1038.627] (-1039.171) (-1041.307) (-1043.256) -- 0:00:36
      417000 -- (-1039.036) [-1040.195] (-1038.538) (-1043.604) * [-1039.242] (-1039.393) (-1040.002) (-1040.984) -- 0:00:36
      417500 -- [-1040.417] (-1043.188) (-1040.953) (-1042.600) * (-1041.224) [-1040.979] (-1041.481) (-1041.926) -- 0:00:36
      418000 -- [-1039.955] (-1042.759) (-1038.711) (-1041.321) * (-1040.141) (-1038.709) (-1040.698) [-1039.849] -- 0:00:36
      418500 -- (-1039.715) (-1038.873) [-1040.426] (-1040.440) * (-1040.017) [-1041.110] (-1042.855) (-1038.494) -- 0:00:36
      419000 -- [-1039.404] (-1043.976) (-1038.988) (-1040.475) * (-1039.720) (-1039.424) [-1039.782] (-1040.920) -- 0:00:36
      419500 -- (-1039.720) [-1042.987] (-1039.075) (-1038.172) * (-1040.859) [-1038.953] (-1042.536) (-1041.403) -- 0:00:35
      420000 -- (-1040.807) (-1041.590) [-1038.055] (-1043.084) * [-1039.510] (-1038.822) (-1043.500) (-1042.412) -- 0:00:35

      Average standard deviation of split frequencies: 0.010996

      420500 -- (-1037.769) (-1042.365) [-1037.912] (-1040.519) * (-1039.879) (-1038.318) [-1039.780] (-1042.301) -- 0:00:35
      421000 -- [-1042.809] (-1041.970) (-1039.577) (-1040.105) * (-1040.947) (-1038.793) (-1038.492) [-1039.798] -- 0:00:35
      421500 -- (-1039.348) (-1046.273) [-1041.702] (-1039.110) * (-1043.660) (-1042.880) (-1038.567) [-1038.910] -- 0:00:35
      422000 -- (-1038.968) (-1044.739) (-1044.034) [-1038.469] * (-1043.198) (-1041.446) [-1040.496] (-1039.330) -- 0:00:35
      422500 -- [-1038.619] (-1043.273) (-1040.925) (-1041.361) * (-1041.551) (-1040.068) (-1037.845) [-1038.618] -- 0:00:35
      423000 -- (-1042.348) [-1040.780] (-1040.432) (-1038.649) * (-1043.227) (-1040.412) [-1039.457] (-1039.294) -- 0:00:35
      423500 -- (-1038.896) [-1040.861] (-1039.081) (-1039.687) * [-1038.113] (-1039.566) (-1039.191) (-1039.843) -- 0:00:36
      424000 -- (-1040.187) [-1041.391] (-1041.864) (-1039.625) * (-1039.200) (-1038.299) [-1039.880] (-1041.741) -- 0:00:36
      424500 -- (-1040.483) (-1038.169) [-1041.474] (-1042.951) * (-1041.307) (-1038.140) [-1039.481] (-1038.751) -- 0:00:36
      425000 -- (-1039.362) (-1038.800) (-1039.303) [-1038.164] * (-1040.247) [-1038.395] (-1039.854) (-1039.147) -- 0:00:36

      Average standard deviation of split frequencies: 0.009752

      425500 -- (-1038.412) (-1038.453) (-1041.176) [-1041.174] * (-1043.703) [-1038.400] (-1040.712) (-1039.117) -- 0:00:36
      426000 -- (-1039.252) (-1040.208) (-1038.882) [-1039.782] * (-1040.382) [-1038.804] (-1041.787) (-1040.877) -- 0:00:36
      426500 -- (-1041.836) (-1040.023) [-1038.068] (-1038.592) * (-1038.628) [-1038.704] (-1042.372) (-1042.501) -- 0:00:36
      427000 -- [-1038.675] (-1040.323) (-1038.929) (-1040.471) * (-1038.997) (-1037.988) (-1043.231) [-1038.316] -- 0:00:36
      427500 -- (-1038.804) [-1041.097] (-1041.170) (-1039.822) * [-1039.149] (-1038.429) (-1039.267) (-1042.599) -- 0:00:36
      428000 -- (-1040.854) (-1042.610) [-1039.894] (-1040.105) * [-1038.531] (-1041.322) (-1042.154) (-1041.699) -- 0:00:36
      428500 -- [-1038.597] (-1044.492) (-1038.470) (-1041.053) * (-1042.157) (-1040.436) [-1041.934] (-1040.616) -- 0:00:36
      429000 -- (-1038.816) (-1045.412) (-1039.102) [-1038.356] * [-1039.947] (-1039.924) (-1039.158) (-1042.051) -- 0:00:35
      429500 -- [-1040.694] (-1038.580) (-1039.046) (-1041.555) * (-1037.986) [-1038.768] (-1039.013) (-1038.812) -- 0:00:35
      430000 -- [-1039.843] (-1040.274) (-1042.556) (-1040.002) * (-1039.908) (-1038.652) (-1039.731) [-1037.808] -- 0:00:35

      Average standard deviation of split frequencies: 0.009988

      430500 -- (-1037.847) (-1039.353) [-1038.400] (-1037.826) * (-1039.022) (-1040.600) [-1037.725] (-1038.248) -- 0:00:35
      431000 -- (-1038.454) [-1038.951] (-1037.529) (-1039.231) * (-1039.483) (-1041.390) [-1039.651] (-1039.659) -- 0:00:35
      431500 -- (-1041.699) (-1037.992) [-1038.513] (-1039.077) * (-1038.270) [-1042.975] (-1043.212) (-1040.135) -- 0:00:35
      432000 -- (-1039.726) (-1037.734) (-1041.311) [-1038.666] * [-1039.326] (-1043.983) (-1040.332) (-1048.330) -- 0:00:35
      432500 -- (-1039.425) (-1039.143) [-1042.645] (-1039.121) * (-1047.163) (-1041.633) [-1038.183] (-1038.470) -- 0:00:35
      433000 -- (-1038.268) (-1039.450) (-1038.875) [-1038.614] * (-1039.393) (-1041.829) (-1042.407) [-1039.065] -- 0:00:35
      433500 -- (-1038.606) (-1040.496) [-1041.367] (-1038.485) * (-1041.051) [-1039.109] (-1039.538) (-1042.105) -- 0:00:35
      434000 -- (-1039.489) [-1043.699] (-1040.960) (-1040.528) * (-1038.531) (-1039.014) (-1039.569) [-1039.513] -- 0:00:35
      434500 -- [-1040.428] (-1043.803) (-1041.211) (-1041.766) * (-1038.022) (-1042.231) (-1040.560) [-1039.736] -- 0:00:35
      435000 -- (-1040.263) (-1042.389) [-1038.389] (-1041.947) * [-1038.172] (-1040.098) (-1040.433) (-1039.314) -- 0:00:35

      Average standard deviation of split frequencies: 0.008395

      435500 -- (-1038.859) (-1038.640) (-1039.468) [-1038.804] * [-1042.086] (-1040.185) (-1039.383) (-1040.761) -- 0:00:34
      436000 -- (-1040.178) [-1038.607] (-1040.359) (-1039.438) * (-1041.685) [-1042.669] (-1040.505) (-1043.141) -- 0:00:34
      436500 -- (-1039.842) (-1039.330) (-1040.556) [-1041.274] * [-1039.462] (-1041.894) (-1039.583) (-1038.418) -- 0:00:34
      437000 -- (-1039.665) (-1037.679) [-1040.873] (-1041.836) * [-1039.110] (-1041.548) (-1038.929) (-1038.895) -- 0:00:34
      437500 -- (-1041.625) (-1038.507) (-1038.813) [-1039.063] * (-1041.873) (-1040.970) (-1042.571) [-1039.107] -- 0:00:34
      438000 -- [-1038.948] (-1042.379) (-1041.518) (-1038.176) * (-1041.351) (-1040.762) (-1039.006) [-1040.543] -- 0:00:34
      438500 -- [-1038.122] (-1040.523) (-1039.154) (-1041.834) * [-1039.935] (-1040.785) (-1040.223) (-1038.684) -- 0:00:34
      439000 -- (-1043.015) (-1049.162) (-1039.678) [-1039.242] * [-1039.985] (-1038.405) (-1040.315) (-1042.376) -- 0:00:35
      439500 -- (-1040.998) [-1039.655] (-1038.815) (-1041.228) * [-1039.404] (-1042.429) (-1040.284) (-1039.978) -- 0:00:35
      440000 -- (-1039.724) [-1039.314] (-1038.816) (-1042.101) * (-1043.314) [-1040.356] (-1040.239) (-1039.815) -- 0:00:35

      Average standard deviation of split frequencies: 0.007866

      440500 -- [-1045.122] (-1039.645) (-1040.345) (-1041.882) * (-1044.103) (-1041.999) (-1040.906) [-1039.092] -- 0:00:35
      441000 -- [-1038.746] (-1043.221) (-1039.835) (-1041.543) * (-1040.182) (-1039.172) (-1038.918) [-1040.679] -- 0:00:35
      441500 -- [-1038.654] (-1039.941) (-1047.153) (-1039.571) * (-1038.318) (-1038.642) [-1040.488] (-1039.579) -- 0:00:35
      442000 -- (-1039.306) (-1039.275) [-1040.610] (-1040.452) * [-1038.432] (-1039.910) (-1039.122) (-1042.866) -- 0:00:35
      442500 -- [-1038.332] (-1039.097) (-1038.444) (-1044.632) * [-1039.350] (-1041.783) (-1043.061) (-1043.689) -- 0:00:35
      443000 -- (-1039.401) [-1041.279] (-1039.345) (-1040.025) * (-1039.668) (-1043.196) [-1039.248] (-1039.610) -- 0:00:35
      443500 -- (-1038.895) [-1039.559] (-1044.296) (-1039.713) * (-1038.522) (-1040.179) [-1043.165] (-1040.682) -- 0:00:35
      444000 -- (-1041.078) [-1040.034] (-1038.080) (-1038.383) * [-1038.800] (-1040.567) (-1042.371) (-1039.000) -- 0:00:35
      444500 -- (-1038.710) (-1039.363) (-1039.430) [-1040.847] * [-1040.658] (-1041.344) (-1043.011) (-1040.754) -- 0:00:34
      445000 -- (-1040.923) [-1041.680] (-1041.512) (-1039.933) * (-1038.563) [-1043.644] (-1042.135) (-1041.549) -- 0:00:34

      Average standard deviation of split frequencies: 0.007772

      445500 -- (-1043.036) (-1043.584) [-1040.641] (-1040.949) * (-1037.728) (-1042.107) (-1040.455) [-1043.214] -- 0:00:34
      446000 -- [-1041.362] (-1042.544) (-1046.009) (-1041.230) * [-1037.738] (-1041.829) (-1039.566) (-1039.644) -- 0:00:34
      446500 -- [-1040.504] (-1039.214) (-1039.655) (-1039.648) * [-1038.977] (-1040.306) (-1042.013) (-1038.770) -- 0:00:34
      447000 -- [-1038.795] (-1038.640) (-1038.849) (-1042.984) * (-1040.257) (-1040.611) [-1038.908] (-1040.208) -- 0:00:34
      447500 -- (-1045.285) [-1040.012] (-1042.476) (-1038.431) * (-1039.152) (-1041.594) (-1038.727) [-1039.550] -- 0:00:34
      448000 -- (-1038.715) [-1042.602] (-1038.424) (-1038.810) * (-1043.734) (-1041.594) (-1042.271) [-1039.402] -- 0:00:34
      448500 -- (-1037.970) (-1042.555) (-1040.549) [-1038.944] * (-1042.447) (-1042.543) (-1047.821) [-1039.360] -- 0:00:34
      449000 -- (-1038.049) (-1041.879) [-1038.580] (-1041.634) * (-1044.493) (-1043.731) (-1039.028) [-1040.660] -- 0:00:34
      449500 -- (-1039.120) (-1045.214) [-1037.773] (-1040.379) * [-1037.835] (-1040.725) (-1039.723) (-1040.231) -- 0:00:34
      450000 -- (-1038.847) (-1040.064) (-1037.775) [-1038.848] * (-1041.490) [-1041.748] (-1039.070) (-1045.130) -- 0:00:34

      Average standard deviation of split frequencies: 0.007584

      450500 -- [-1039.612] (-1043.034) (-1038.141) (-1038.589) * (-1039.842) (-1039.353) [-1038.353] (-1044.891) -- 0:00:34
      451000 -- (-1039.369) (-1039.961) [-1038.299] (-1040.972) * [-1038.867] (-1038.986) (-1038.414) (-1042.475) -- 0:00:34
      451500 -- (-1038.195) (-1039.187) (-1042.094) [-1038.570] * (-1039.936) (-1039.965) (-1038.839) [-1038.569] -- 0:00:34
      452000 -- [-1043.491] (-1038.024) (-1043.368) (-1039.078) * (-1041.023) (-1041.323) [-1041.988] (-1039.510) -- 0:00:33
      452500 -- (-1039.144) [-1039.133] (-1040.688) (-1044.423) * (-1040.620) [-1038.640] (-1040.552) (-1042.120) -- 0:00:33
      453000 -- (-1039.141) (-1042.126) [-1042.331] (-1042.038) * (-1043.246) (-1038.775) (-1038.525) [-1040.717] -- 0:00:33
      453500 -- (-1041.137) (-1040.521) (-1039.279) [-1040.859] * (-1039.789) [-1039.876] (-1038.179) (-1044.010) -- 0:00:33
      454000 -- (-1042.572) [-1037.935] (-1038.430) (-1040.165) * (-1042.601) (-1040.329) [-1038.942] (-1042.059) -- 0:00:33
      454500 -- (-1046.512) (-1039.312) [-1038.413] (-1041.841) * (-1040.379) (-1041.780) [-1042.385] (-1043.226) -- 0:00:33
      455000 -- [-1040.418] (-1041.591) (-1040.230) (-1038.209) * (-1039.484) (-1038.754) [-1038.799] (-1038.015) -- 0:00:34

      Average standard deviation of split frequencies: 0.007115

      455500 -- (-1041.359) (-1041.832) (-1043.217) [-1038.548] * [-1039.588] (-1039.383) (-1039.473) (-1039.445) -- 0:00:34
      456000 -- (-1038.082) [-1038.409] (-1039.428) (-1040.384) * (-1040.822) (-1042.322) (-1039.615) [-1038.393] -- 0:00:34
      456500 -- (-1040.204) [-1041.943] (-1038.035) (-1043.551) * (-1040.181) (-1038.180) (-1040.757) [-1039.408] -- 0:00:34
      457000 -- [-1039.085] (-1040.314) (-1037.819) (-1041.012) * (-1042.158) (-1039.734) [-1038.328] (-1041.062) -- 0:00:34
      457500 -- [-1042.862] (-1039.608) (-1041.139) (-1043.857) * (-1045.370) (-1039.992) [-1038.552] (-1042.632) -- 0:00:34
      458000 -- (-1040.657) (-1040.223) (-1040.453) [-1039.277] * (-1042.714) (-1038.846) [-1040.418] (-1039.333) -- 0:00:34
      458500 -- (-1038.207) (-1039.183) [-1044.666] (-1038.371) * (-1045.654) (-1037.966) (-1045.228) [-1039.405] -- 0:00:34
      459000 -- [-1041.001] (-1041.850) (-1045.164) (-1039.726) * (-1039.745) [-1038.902] (-1043.511) (-1038.017) -- 0:00:34
      459500 -- (-1038.995) (-1040.099) [-1038.172] (-1039.579) * (-1046.229) (-1042.326) (-1045.753) [-1039.542] -- 0:00:34
      460000 -- (-1040.071) (-1041.472) (-1038.219) [-1039.494] * [-1042.920] (-1040.305) (-1040.155) (-1038.134) -- 0:00:34

      Average standard deviation of split frequencies: 0.008050

      460500 -- [-1039.005] (-1042.944) (-1039.583) (-1041.154) * (-1040.211) [-1039.543] (-1038.796) (-1039.059) -- 0:00:33
      461000 -- (-1044.700) (-1039.139) [-1040.309] (-1038.882) * (-1040.090) (-1038.425) [-1037.963] (-1039.425) -- 0:00:33
      461500 -- [-1040.917] (-1039.685) (-1038.906) (-1038.650) * [-1038.208] (-1038.952) (-1039.471) (-1039.815) -- 0:00:33
      462000 -- (-1039.788) [-1038.044] (-1041.056) (-1041.559) * [-1038.512] (-1038.949) (-1038.145) (-1038.818) -- 0:00:33
      462500 -- [-1043.856] (-1040.192) (-1041.755) (-1039.882) * (-1040.182) (-1039.341) (-1038.155) [-1041.762] -- 0:00:33
      463000 -- (-1042.830) (-1040.433) (-1038.117) [-1040.314] * (-1039.172) (-1044.890) (-1037.925) [-1039.482] -- 0:00:33
      463500 -- [-1038.455] (-1042.728) (-1038.144) (-1038.967) * (-1041.523) (-1040.634) (-1038.962) [-1041.694] -- 0:00:33
      464000 -- [-1038.766] (-1038.976) (-1038.189) (-1039.489) * [-1042.356] (-1042.865) (-1039.083) (-1037.993) -- 0:00:33
      464500 -- (-1038.766) [-1038.726] (-1038.967) (-1040.015) * (-1043.278) (-1044.429) [-1038.195] (-1038.765) -- 0:00:33
      465000 -- (-1038.903) [-1038.295] (-1039.753) (-1041.488) * (-1042.853) [-1037.743] (-1038.116) (-1041.167) -- 0:00:33

      Average standard deviation of split frequencies: 0.007553

      465500 -- (-1039.842) (-1044.518) (-1039.144) [-1041.778] * (-1043.319) (-1038.115) [-1040.037] (-1039.682) -- 0:00:33
      466000 -- [-1041.493] (-1045.070) (-1041.505) (-1040.663) * (-1041.880) (-1039.826) [-1045.838] (-1039.556) -- 0:00:33
      466500 -- (-1038.459) (-1047.897) (-1041.785) [-1041.228] * (-1040.717) [-1041.311] (-1042.819) (-1039.909) -- 0:00:33
      467000 -- [-1039.195] (-1041.108) (-1042.392) (-1039.440) * [-1038.667] (-1041.424) (-1039.116) (-1040.445) -- 0:00:33
      467500 -- (-1041.570) (-1040.211) [-1039.167] (-1040.761) * [-1039.917] (-1040.180) (-1042.460) (-1040.590) -- 0:00:33
      468000 -- (-1039.114) (-1040.189) [-1037.918] (-1040.318) * (-1039.308) [-1040.407] (-1041.697) (-1038.380) -- 0:00:32
      468500 -- (-1041.171) [-1040.310] (-1040.023) (-1042.575) * (-1038.300) (-1045.831) (-1040.885) [-1040.190] -- 0:00:32
      469000 -- [-1040.645] (-1039.165) (-1042.339) (-1039.485) * (-1038.187) (-1040.808) (-1038.795) [-1041.407] -- 0:00:32
      469500 -- (-1038.865) (-1039.037) [-1042.489] (-1039.151) * (-1038.142) [-1042.015] (-1039.254) (-1041.386) -- 0:00:32
      470000 -- (-1040.443) [-1039.295] (-1041.462) (-1039.319) * (-1037.982) (-1043.660) [-1040.244] (-1041.118) -- 0:00:32

      Average standard deviation of split frequencies: 0.007412

      470500 -- [-1040.837] (-1038.065) (-1041.332) (-1041.442) * [-1038.142] (-1038.500) (-1038.946) (-1040.352) -- 0:00:32
      471000 -- (-1040.046) [-1037.826] (-1038.365) (-1038.915) * [-1038.456] (-1039.292) (-1040.655) (-1039.053) -- 0:00:33
      471500 -- [-1039.554] (-1043.317) (-1039.407) (-1039.831) * (-1039.472) (-1039.150) (-1038.078) [-1038.869] -- 0:00:33
      472000 -- (-1038.591) (-1038.959) (-1040.082) [-1039.480] * (-1043.160) [-1040.244] (-1038.631) (-1040.090) -- 0:00:33
      472500 -- [-1038.006] (-1039.210) (-1041.862) (-1041.646) * (-1041.251) (-1038.463) [-1037.997] (-1039.667) -- 0:00:33
      473000 -- [-1037.946] (-1042.112) (-1038.881) (-1040.469) * (-1044.215) (-1038.391) [-1040.129] (-1037.757) -- 0:00:33
      473500 -- (-1038.367) [-1039.002] (-1039.183) (-1041.581) * (-1039.990) [-1040.291] (-1038.987) (-1038.453) -- 0:00:33
      474000 -- (-1043.691) (-1038.746) (-1040.361) [-1040.542] * [-1038.303] (-1040.079) (-1040.195) (-1037.820) -- 0:00:33
      474500 -- (-1042.647) (-1040.498) [-1043.250] (-1041.615) * (-1039.522) (-1039.032) (-1040.072) [-1038.105] -- 0:00:33
      475000 -- (-1039.845) [-1043.139] (-1038.685) (-1038.175) * (-1040.395) [-1039.554] (-1042.091) (-1039.022) -- 0:00:33

      Average standard deviation of split frequencies: 0.007989

      475500 -- (-1038.525) [-1042.165] (-1038.975) (-1038.185) * (-1039.319) (-1038.850) (-1040.085) [-1039.612] -- 0:00:33
      476000 -- (-1041.080) (-1043.981) (-1039.587) [-1038.641] * (-1039.954) [-1039.287] (-1041.422) (-1039.720) -- 0:00:33
      476500 -- [-1039.803] (-1041.872) (-1040.666) (-1039.274) * [-1039.361] (-1040.254) (-1038.606) (-1039.574) -- 0:00:32
      477000 -- (-1042.168) (-1041.181) (-1039.966) [-1041.276] * (-1043.231) (-1041.290) [-1042.620] (-1038.031) -- 0:00:32
      477500 -- (-1039.646) [-1038.189] (-1040.174) (-1039.933) * [-1042.325] (-1040.913) (-1042.795) (-1039.281) -- 0:00:32
      478000 -- (-1041.651) [-1039.217] (-1040.316) (-1040.539) * [-1040.274] (-1041.383) (-1048.717) (-1039.799) -- 0:00:32
      478500 -- (-1042.511) (-1041.523) [-1039.011] (-1040.925) * [-1042.293] (-1041.200) (-1040.131) (-1047.174) -- 0:00:32
      479000 -- [-1039.365] (-1040.545) (-1040.110) (-1040.477) * [-1040.252] (-1039.320) (-1038.860) (-1043.764) -- 0:00:32
      479500 -- (-1038.619) [-1039.253] (-1043.747) (-1038.727) * [-1043.765] (-1045.085) (-1042.165) (-1040.047) -- 0:00:32
      480000 -- (-1042.663) (-1040.250) (-1045.299) [-1040.527] * (-1042.724) (-1042.996) [-1039.244] (-1038.656) -- 0:00:32

      Average standard deviation of split frequencies: 0.008892

      480500 -- [-1038.958] (-1038.793) (-1039.464) (-1039.147) * [-1038.792] (-1040.722) (-1041.424) (-1039.177) -- 0:00:32
      481000 -- (-1038.502) [-1039.211] (-1044.599) (-1038.906) * (-1039.568) (-1038.252) (-1038.703) [-1039.573] -- 0:00:32
      481500 -- [-1038.033] (-1038.476) (-1039.414) (-1042.874) * (-1038.923) [-1038.464] (-1040.136) (-1039.997) -- 0:00:32
      482000 -- (-1038.329) [-1039.142] (-1039.551) (-1039.551) * (-1040.543) [-1039.366] (-1040.388) (-1041.354) -- 0:00:32
      482500 -- [-1039.017] (-1040.463) (-1042.050) (-1043.313) * (-1041.229) (-1039.431) (-1044.078) [-1038.266] -- 0:00:32
      483000 -- (-1040.472) (-1040.029) [-1041.435] (-1043.608) * (-1039.623) (-1040.527) (-1040.187) [-1039.512] -- 0:00:32
      483500 -- [-1042.402] (-1039.507) (-1040.806) (-1039.879) * (-1042.979) [-1041.108] (-1040.155) (-1038.814) -- 0:00:32
      484000 -- (-1041.149) (-1039.150) (-1041.982) [-1040.698] * (-1044.127) [-1038.071] (-1041.677) (-1040.336) -- 0:00:31
      484500 -- (-1040.038) [-1039.457] (-1040.825) (-1039.905) * [-1039.342] (-1041.210) (-1038.988) (-1040.785) -- 0:00:31
      485000 -- (-1040.516) (-1039.244) (-1038.996) [-1038.879] * [-1042.722] (-1038.949) (-1040.341) (-1039.199) -- 0:00:32

      Average standard deviation of split frequencies: 0.008471

      485500 -- (-1040.823) (-1040.220) (-1040.704) [-1038.425] * [-1038.625] (-1039.929) (-1039.603) (-1038.540) -- 0:00:32
      486000 -- [-1047.308] (-1042.962) (-1040.265) (-1043.385) * (-1038.936) (-1040.620) [-1040.139] (-1039.901) -- 0:00:32
      486500 -- [-1039.999] (-1038.726) (-1040.049) (-1042.990) * (-1038.047) [-1039.205] (-1044.436) (-1039.116) -- 0:00:32
      487000 -- (-1041.400) (-1038.033) (-1038.608) [-1041.522] * (-1040.102) (-1041.180) (-1038.905) [-1039.903] -- 0:00:32
      487500 -- [-1040.857] (-1038.229) (-1040.305) (-1038.223) * [-1041.077] (-1039.436) (-1038.263) (-1039.181) -- 0:00:32
      488000 -- (-1040.503) (-1039.471) (-1044.524) [-1038.446] * (-1038.773) [-1038.848] (-1042.053) (-1039.200) -- 0:00:32
      488500 -- (-1039.824) (-1040.934) (-1039.995) [-1038.647] * (-1044.906) (-1040.641) (-1042.244) [-1040.184] -- 0:00:32
      489000 -- (-1040.144) (-1039.758) (-1039.306) [-1039.499] * [-1041.139] (-1040.500) (-1040.506) (-1040.290) -- 0:00:32
      489500 -- (-1038.685) [-1038.673] (-1038.494) (-1039.346) * [-1037.974] (-1040.845) (-1039.408) (-1039.393) -- 0:00:32
      490000 -- [-1040.717] (-1038.099) (-1038.124) (-1037.841) * [-1040.016] (-1042.464) (-1038.611) (-1038.440) -- 0:00:32

      Average standard deviation of split frequencies: 0.007942

      490500 -- [-1039.164] (-1041.725) (-1038.208) (-1037.841) * [-1038.630] (-1038.404) (-1038.540) (-1039.214) -- 0:00:32
      491000 -- (-1038.900) [-1041.014] (-1038.845) (-1039.928) * [-1041.386] (-1037.864) (-1039.526) (-1038.127) -- 0:00:32
      491500 -- (-1040.885) (-1039.509) (-1043.766) [-1041.812] * (-1041.921) (-1039.127) (-1042.251) [-1039.159] -- 0:00:32
      492000 -- (-1040.001) [-1040.191] (-1038.881) (-1041.842) * (-1040.817) (-1041.421) [-1039.287] (-1039.517) -- 0:00:32
      492500 -- [-1039.692] (-1050.367) (-1040.108) (-1043.921) * [-1040.364] (-1043.301) (-1039.422) (-1040.442) -- 0:00:31
      493000 -- [-1038.845] (-1039.556) (-1040.020) (-1040.409) * (-1040.526) (-1040.952) [-1041.827] (-1038.836) -- 0:00:31
      493500 -- (-1039.326) [-1038.854] (-1039.168) (-1041.420) * (-1041.682) [-1038.540] (-1047.199) (-1040.069) -- 0:00:31
      494000 -- (-1039.451) [-1039.448] (-1038.991) (-1042.575) * (-1038.217) (-1038.651) [-1040.656] (-1041.165) -- 0:00:31
      494500 -- [-1038.369] (-1039.632) (-1038.758) (-1039.140) * [-1040.038] (-1041.006) (-1041.046) (-1040.993) -- 0:00:31
      495000 -- (-1038.175) (-1042.204) (-1039.523) [-1039.203] * [-1039.877] (-1038.962) (-1041.301) (-1041.305) -- 0:00:31

      Average standard deviation of split frequencies: 0.007730

      495500 -- (-1038.983) (-1038.846) (-1039.343) [-1039.927] * [-1042.201] (-1039.861) (-1038.967) (-1038.735) -- 0:00:31
      496000 -- (-1038.117) (-1040.182) (-1041.057) [-1042.631] * (-1040.384) (-1038.312) (-1038.580) [-1042.307] -- 0:00:31
      496500 -- (-1040.309) (-1043.494) [-1040.104] (-1037.909) * [-1038.799] (-1039.934) (-1042.879) (-1045.848) -- 0:00:31
      497000 -- [-1038.410] (-1042.441) (-1040.617) (-1041.138) * [-1041.399] (-1038.909) (-1038.560) (-1038.655) -- 0:00:31
      497500 -- [-1040.413] (-1044.160) (-1040.125) (-1039.956) * [-1042.731] (-1040.488) (-1039.830) (-1039.795) -- 0:00:31
      498000 -- (-1040.516) (-1041.295) [-1039.730] (-1041.066) * [-1042.613] (-1042.995) (-1040.539) (-1041.628) -- 0:00:32
      498500 -- (-1039.574) (-1042.708) (-1040.795) [-1044.665] * (-1042.033) (-1041.909) (-1039.183) [-1040.706] -- 0:00:32
      499000 -- (-1042.527) [-1039.532] (-1040.865) (-1038.187) * (-1040.855) (-1038.812) [-1041.366] (-1042.783) -- 0:00:32
      499500 -- (-1040.436) (-1039.272) [-1039.474] (-1039.115) * (-1040.391) (-1039.653) (-1038.672) [-1040.288] -- 0:00:32
      500000 -- [-1038.886] (-1041.294) (-1042.727) (-1043.154) * [-1039.154] (-1039.670) (-1038.158) (-1041.191) -- 0:00:32

      Average standard deviation of split frequencies: 0.007156

      500500 -- [-1038.225] (-1039.165) (-1039.626) (-1041.990) * (-1040.372) (-1041.612) [-1040.897] (-1039.385) -- 0:00:31
      501000 -- (-1039.335) (-1039.188) (-1039.172) [-1041.964] * (-1039.593) (-1041.149) (-1039.883) [-1037.667] -- 0:00:31
      501500 -- (-1040.837) [-1039.925] (-1040.986) (-1040.485) * [-1038.769] (-1045.547) (-1041.215) (-1039.577) -- 0:00:31
      502000 -- [-1039.948] (-1037.999) (-1039.119) (-1039.769) * (-1039.065) (-1040.158) [-1038.914] (-1037.847) -- 0:00:31
      502500 -- [-1040.363] (-1038.176) (-1039.983) (-1038.318) * (-1038.380) (-1042.179) (-1038.401) [-1041.344] -- 0:00:31
      503000 -- (-1039.618) (-1039.666) [-1038.620] (-1040.740) * [-1040.328] (-1042.307) (-1038.541) (-1041.477) -- 0:00:31
      503500 -- (-1039.803) (-1042.128) [-1040.618] (-1042.502) * (-1039.264) [-1041.855] (-1038.507) (-1040.269) -- 0:00:31
      504000 -- [-1039.526] (-1041.081) (-1042.642) (-1042.903) * (-1040.570) (-1042.272) [-1038.244] (-1041.004) -- 0:00:31
      504500 -- [-1038.938] (-1041.688) (-1042.324) (-1044.921) * [-1039.688] (-1041.741) (-1038.601) (-1038.675) -- 0:00:31
      505000 -- (-1041.066) [-1039.246] (-1044.911) (-1040.428) * [-1038.525] (-1040.386) (-1039.278) (-1040.009) -- 0:00:31

      Average standard deviation of split frequencies: 0.006521

      505500 -- [-1040.120] (-1040.296) (-1038.382) (-1043.510) * (-1039.164) (-1040.498) (-1039.129) [-1040.122] -- 0:00:31
      506000 -- [-1041.488] (-1040.494) (-1041.169) (-1043.417) * (-1042.599) [-1042.472] (-1038.397) (-1040.199) -- 0:00:31
      506500 -- (-1042.053) [-1038.052] (-1039.566) (-1041.216) * (-1041.546) (-1044.349) (-1039.666) [-1039.228] -- 0:00:31
      507000 -- (-1040.380) (-1039.593) (-1037.736) [-1039.883] * (-1040.377) (-1043.543) (-1043.244) [-1039.129] -- 0:00:31
      507500 -- (-1040.852) [-1038.146] (-1039.493) (-1040.696) * (-1037.836) (-1039.685) (-1039.541) [-1039.424] -- 0:00:31
      508000 -- (-1038.076) (-1037.816) [-1038.979] (-1042.596) * [-1040.300] (-1041.920) (-1043.183) (-1038.549) -- 0:00:30
      508500 -- [-1039.146] (-1039.369) (-1038.236) (-1041.681) * (-1046.004) [-1042.988] (-1041.966) (-1038.291) -- 0:00:30
      509000 -- (-1042.878) (-1042.039) [-1039.648] (-1039.815) * (-1045.831) [-1042.550] (-1040.453) (-1042.318) -- 0:00:30
      509500 -- [-1040.089] (-1040.978) (-1043.008) (-1042.803) * (-1043.681) [-1041.138] (-1039.509) (-1041.883) -- 0:00:30
      510000 -- (-1041.901) (-1038.049) [-1042.840] (-1045.982) * (-1040.454) [-1039.641] (-1038.827) (-1038.655) -- 0:00:30

      Average standard deviation of split frequencies: 0.006339

      510500 -- (-1040.758) [-1038.489] (-1046.153) (-1045.692) * (-1044.808) (-1042.673) (-1040.338) [-1040.089] -- 0:00:31
      511000 -- (-1038.717) [-1040.380] (-1040.686) (-1039.445) * [-1039.223] (-1039.814) (-1038.967) (-1038.442) -- 0:00:31
      511500 -- (-1038.665) [-1040.543] (-1039.514) (-1038.597) * (-1039.672) (-1039.023) [-1039.448] (-1040.249) -- 0:00:31
      512000 -- (-1039.896) [-1039.206] (-1039.309) (-1039.106) * (-1038.529) (-1039.618) [-1041.473] (-1040.645) -- 0:00:31
      512500 -- (-1045.415) [-1039.186] (-1039.277) (-1039.641) * (-1038.347) [-1038.890] (-1040.433) (-1038.555) -- 0:00:31
      513000 -- (-1046.011) (-1039.678) (-1042.464) [-1037.760] * (-1038.483) (-1039.727) [-1042.169] (-1040.238) -- 0:00:31
      513500 -- (-1045.173) (-1038.242) (-1039.957) [-1039.397] * (-1040.112) (-1041.252) (-1040.644) [-1039.109] -- 0:00:31
      514000 -- (-1044.498) (-1040.158) [-1039.610] (-1042.251) * (-1038.862) [-1042.704] (-1040.434) (-1039.243) -- 0:00:31
      514500 -- (-1040.679) [-1039.007] (-1039.647) (-1038.976) * (-1042.068) (-1043.512) (-1038.783) [-1039.182] -- 0:00:31
      515000 -- (-1044.198) (-1037.965) (-1039.275) [-1038.872] * (-1039.407) (-1040.255) [-1040.155] (-1038.856) -- 0:00:31

      Average standard deviation of split frequencies: 0.006030

      515500 -- (-1045.294) (-1040.323) (-1043.216) [-1039.029] * (-1039.097) (-1039.614) (-1039.988) [-1039.368] -- 0:00:31
      516000 -- (-1040.903) (-1038.526) [-1040.431] (-1039.729) * (-1039.186) [-1040.009] (-1040.944) (-1039.248) -- 0:00:30
      516500 -- [-1041.268] (-1038.911) (-1039.993) (-1039.385) * (-1038.106) (-1038.579) (-1042.440) [-1039.021] -- 0:00:30
      517000 -- (-1043.156) (-1038.027) [-1039.366] (-1038.192) * (-1038.368) (-1038.695) (-1041.268) [-1039.292] -- 0:00:30
      517500 -- (-1039.634) (-1040.151) (-1041.530) [-1039.383] * (-1041.388) (-1039.862) (-1038.461) [-1038.595] -- 0:00:30
      518000 -- (-1039.888) [-1042.010] (-1041.635) (-1045.144) * (-1040.362) (-1038.582) (-1042.166) [-1039.507] -- 0:00:30
      518500 -- (-1046.438) (-1043.243) [-1040.711] (-1038.810) * (-1039.210) [-1038.299] (-1042.492) (-1039.303) -- 0:00:30
      519000 -- (-1043.613) (-1043.750) [-1039.856] (-1041.712) * [-1039.207] (-1038.010) (-1040.105) (-1037.775) -- 0:00:30
      519500 -- (-1038.434) (-1045.452) [-1039.624] (-1039.532) * [-1040.787] (-1041.286) (-1039.663) (-1039.011) -- 0:00:30
      520000 -- (-1041.808) (-1042.965) [-1040.378] (-1041.010) * (-1041.192) [-1041.285] (-1044.471) (-1042.205) -- 0:00:30

      Average standard deviation of split frequencies: 0.006519

      520500 -- (-1039.122) [-1044.070] (-1038.364) (-1038.664) * (-1043.024) [-1040.904] (-1040.874) (-1041.162) -- 0:00:30
      521000 -- (-1038.042) (-1040.664) (-1041.822) [-1039.261] * (-1040.712) (-1044.139) [-1040.513] (-1039.517) -- 0:00:30
      521500 -- [-1040.026] (-1038.915) (-1038.756) (-1043.911) * (-1039.448) (-1039.500) [-1038.135] (-1040.086) -- 0:00:30
      522000 -- (-1040.859) (-1039.338) (-1041.504) [-1042.861] * (-1038.961) (-1038.520) [-1037.932] (-1040.118) -- 0:00:30
      522500 -- (-1045.494) [-1038.725] (-1041.166) (-1040.777) * [-1039.622] (-1039.488) (-1039.650) (-10