--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:34:12 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/thyX/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1039.27 -1042.91
2 -1039.24 -1042.46
--------------------------------------
TOTAL -1039.25 -1042.71
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.906651 0.089087 0.367455 1.488333 0.872747 1247.01 1374.00 1.000
r(A<->C){all} 0.170110 0.020446 0.000062 0.459721 0.135533 132.44 238.38 1.004
r(A<->G){all} 0.162623 0.018790 0.000039 0.450589 0.124494 187.40 209.16 1.006
r(A<->T){all} 0.155769 0.017596 0.000074 0.423604 0.120149 199.74 260.12 1.000
r(C<->G){all} 0.170961 0.020309 0.000065 0.447991 0.131734 219.66 242.99 1.000
r(C<->T){all} 0.173705 0.020863 0.000058 0.462985 0.135792 229.23 250.35 1.003
r(G<->T){all} 0.166832 0.020063 0.000009 0.448450 0.133013 256.66 310.75 1.008
pi(A){all} 0.193255 0.000208 0.163342 0.219337 0.193171 1139.31 1320.15 1.000
pi(C){all} 0.313257 0.000281 0.280713 0.346086 0.313298 985.73 1050.07 1.001
pi(G){all} 0.296136 0.000264 0.265751 0.329009 0.296122 1182.87 1200.98 1.000
pi(T){all} 0.197351 0.000216 0.169294 0.226298 0.196975 1169.89 1189.96 1.000
alpha{1,2} 0.420732 0.225922 0.000145 1.383276 0.249502 985.17 1152.80 1.000
alpha{3} 0.461734 0.239803 0.000198 1.412645 0.299766 861.62 932.52 1.000
pinvar{all} 0.997946 0.000006 0.993457 1.000000 0.998715 1333.52 1353.45 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -998.155347
Model 2: PositiveSelection -998.155347
Model 0: one-ratio -998.155418
Model 7: beta -998.155347
Model 8: beta&w>1 -998.155347
Model 0 vs 1 1.4200000009623182E-4
Model 2 vs 1 0.0
Model 8 vs 7 0.0
>C1
VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
ATEA
>C2
VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
ATEA
>C3
VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
ATEA
>C4
VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
ATEA
>C5
VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
ATEA
>C6
VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
ATEA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=254
C1 VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
C2 VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
C3 VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
C4 VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
C5 VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
C6 VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
**************************************************
C1 NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
C2 NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
C3 NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
C4 NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
C5 NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
C6 NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
**************************************************
C1 YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
C2 YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
C3 YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
C4 YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
C5 YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
C6 YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
**************************************************
C1 NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
C2 NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
C3 NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
C4 NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
C5 NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
C6 NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
**************************************************
C1 AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
C2 AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
C3 AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
C4 AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
C5 AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
C6 AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
**************************************************
C1 ATEA
C2 ATEA
C3 ATEA
C4 ATEA
C5 ATEA
C6 ATEA
****
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 254 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7620]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [7620]--->[7620]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.484 Mb, Max= 30.797 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
C2 VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
C3 VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
C4 VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
C5 VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
C6 VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
**************************************************
C1 NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
C2 NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
C3 NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
C4 NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
C5 NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
C6 NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
**************************************************
C1 YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
C2 YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
C3 YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
C4 YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
C5 YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
C6 YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
**************************************************
C1 NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
C2 NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
C3 NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
C4 NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
C5 NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
C6 NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
**************************************************
C1 AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
C2 AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
C3 AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
C4 AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
C5 AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
C6 AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
**************************************************
C1 ATEA
C2 ATEA
C3 ATEA
C4 ATEA
C5 ATEA
C6 ATEA
****
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT
C2 GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT
C3 GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT
C4 GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT
C5 GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT
C6 GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT
**************************************************
C1 TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG
C2 TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG
C3 TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG
C4 TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG
C5 TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG
C6 TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG
**************************************************
C1 CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC
C2 CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC
C3 CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC
C4 CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC
C5 CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC
C6 CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC
**************************************************
C1 AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT
C2 AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT
C3 AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT
C4 AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT
C5 AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT
C6 AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT
**************************************************
C1 CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG
C2 CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG
C3 CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG
C4 CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG
C5 CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG
C6 CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG
**************************************************
C1 GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC
C2 GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC
C3 GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC
C4 GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC
C5 GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC
C6 GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC
**************************************************
C1 TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT
C2 TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT
C3 TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT
C4 TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT
C5 TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT
C6 TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT
**************************************************
C1 TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG
C2 TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG
C3 TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG
C4 TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG
C5 TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG
C6 TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG
**************************************************
C1 CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG
C2 CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG
C3 CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG
C4 CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG
C5 CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG
C6 CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG
**************************************************
C1 AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG
C2 AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG
C3 AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG
C4 AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG
C5 AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG
C6 AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG
**************************************************
C1 GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG
C2 GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG
C3 GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG
C4 GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG
C5 GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG
C6 GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG
**************************************************
C1 AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC
C2 AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC
C3 AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC
C4 AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC
C5 AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC
C6 AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC
**************************************************
C1 GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT
C2 GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT
C3 GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT
C4 GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT
C5 GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT
C6 GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT
**************************************************
C1 TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT
C2 TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT
C3 TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT
C4 TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT
C5 TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT
C6 TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT
**************************************************
C1 TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA
C2 TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA
C3 TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA
C4 TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA
C5 TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA
C6 TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA
**************************************************
C1 GCCACCGAAGCT
C2 GCCACCGAAGCT
C3 GCCACCGAAGCT
C4 GCCACCGAAGCT
C5 GCCACCGAAGCT
C6 GCCACCGAAGCT
************
>C1
GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT
TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG
CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC
AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT
CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG
GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC
TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT
TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG
CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG
AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG
GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG
AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC
GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT
TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT
TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA
GCCACCGAAGCT
>C2
GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT
TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG
CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC
AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT
CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG
GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC
TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT
TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG
CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG
AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG
GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG
AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC
GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT
TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT
TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA
GCCACCGAAGCT
>C3
GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT
TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG
CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC
AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT
CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG
GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC
TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT
TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG
CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG
AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG
GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG
AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC
GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT
TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT
TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA
GCCACCGAAGCT
>C4
GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT
TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG
CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC
AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT
CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG
GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC
TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT
TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG
CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG
AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG
GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG
AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC
GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT
TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT
TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA
GCCACCGAAGCT
>C5
GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT
TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG
CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC
AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT
CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG
GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC
TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT
TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG
CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG
AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG
GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG
AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC
GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT
TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT
TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA
GCCACCGAAGCT
>C6
GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT
TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG
CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC
AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT
CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG
GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC
TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT
TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG
CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG
AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG
GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG
AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC
GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT
TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT
TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA
GCCACCGAAGCT
>C1
VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
ATEA
>C2
VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
ATEA
>C3
VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
ATEA
>C4
VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
ATEA
>C5
VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
ATEA
>C6
VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
ATEA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 762 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579789951
Setting output file names to "/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 890514379
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0894829762
Seed = 844493217
Swapseed = 1579789951
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1705.392532 -- -24.965149
Chain 2 -- -1705.392435 -- -24.965149
Chain 3 -- -1705.392272 -- -24.965149
Chain 4 -- -1705.392435 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1705.392435 -- -24.965149
Chain 2 -- -1705.392532 -- -24.965149
Chain 3 -- -1705.392532 -- -24.965149
Chain 4 -- -1705.392435 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1705.393] (-1705.392) (-1705.392) (-1705.392) * [-1705.392] (-1705.393) (-1705.393) (-1705.392)
500 -- (-1056.000) [-1049.796] (-1055.313) (-1063.708) * (-1047.242) (-1055.240) (-1059.615) [-1053.616] -- 0:00:00
1000 -- [-1056.106] (-1045.899) (-1048.276) (-1056.070) * (-1044.712) [-1048.042] (-1050.064) (-1054.872) -- 0:00:00
1500 -- (-1052.279) (-1052.982) [-1047.744] (-1049.626) * (-1048.328) [-1048.049] (-1052.658) (-1045.795) -- 0:00:00
2000 -- [-1046.465] (-1051.181) (-1052.277) (-1047.205) * (-1048.541) [-1044.178] (-1051.854) (-1053.067) -- 0:00:00
2500 -- (-1053.839) (-1045.905) [-1052.062] (-1045.735) * (-1058.034) (-1050.953) (-1045.293) [-1047.984] -- 0:00:00
3000 -- (-1057.326) (-1048.731) [-1048.709] (-1050.223) * (-1046.398) (-1050.206) [-1043.702] (-1042.091) -- 0:00:00
3500 -- (-1051.165) (-1053.418) [-1046.550] (-1048.680) * (-1056.699) (-1051.381) (-1050.628) [-1049.093] -- 0:00:00
4000 -- (-1052.919) (-1047.426) (-1054.791) [-1050.144] * [-1044.457] (-1046.665) (-1052.880) (-1051.853) -- 0:00:00
4500 -- (-1054.651) [-1046.575] (-1052.411) (-1048.085) * (-1046.572) [-1047.749] (-1051.934) (-1053.423) -- 0:00:00
5000 -- (-1050.090) (-1048.564) [-1043.668] (-1058.161) * [-1045.841] (-1051.117) (-1056.774) (-1047.900) -- 0:00:00
Average standard deviation of split frequencies: 0.094281
5500 -- (-1050.582) [-1047.883] (-1054.439) (-1057.244) * [-1047.667] (-1053.772) (-1049.075) (-1046.596) -- 0:00:00
6000 -- [-1046.389] (-1049.293) (-1053.064) (-1051.042) * (-1052.135) (-1052.143) (-1055.173) [-1049.827] -- 0:00:00
6500 -- (-1056.708) [-1045.777] (-1045.938) (-1050.447) * (-1049.253) [-1052.149] (-1060.626) (-1048.579) -- 0:00:00
7000 -- (-1063.862) [-1046.451] (-1053.551) (-1050.191) * (-1051.868) (-1050.957) (-1054.450) [-1051.596] -- 0:00:00
7500 -- [-1052.359] (-1049.085) (-1046.399) (-1048.338) * (-1048.877) [-1048.799] (-1055.777) (-1043.192) -- 0:00:00
8000 -- (-1049.151) [-1046.149] (-1048.667) (-1053.378) * (-1046.296) (-1052.512) [-1053.096] (-1045.881) -- 0:00:00
8500 -- (-1049.168) (-1045.640) (-1055.244) [-1044.221] * (-1055.666) (-1045.585) (-1044.298) [-1045.602] -- 0:00:00
9000 -- [-1048.712] (-1051.974) (-1052.290) (-1053.116) * (-1050.351) [-1048.391] (-1048.384) (-1051.140) -- 0:00:00
9500 -- (-1053.878) [-1054.291] (-1054.751) (-1050.346) * (-1048.570) [-1053.253] (-1049.320) (-1053.694) -- 0:00:00
10000 -- (-1051.476) [-1049.831] (-1054.111) (-1048.964) * [-1048.940] (-1052.416) (-1051.220) (-1052.485) -- 0:00:00
Average standard deviation of split frequencies: 0.081410
10500 -- (-1043.319) [-1050.467] (-1047.840) (-1046.217) * (-1051.470) (-1047.565) (-1050.854) [-1043.921] -- 0:01:34
11000 -- (-1062.889) (-1048.245) (-1043.065) [-1045.492] * (-1050.875) (-1044.319) (-1056.233) [-1052.955] -- 0:01:29
11500 -- (-1050.559) (-1051.935) [-1045.625] (-1048.954) * (-1055.881) (-1060.835) (-1054.173) [-1050.712] -- 0:01:25
12000 -- [-1047.112] (-1061.256) (-1045.654) (-1051.090) * (-1057.461) (-1045.557) [-1045.804] (-1057.222) -- 0:01:22
12500 -- (-1053.420) (-1050.979) [-1049.276] (-1056.504) * (-1055.862) (-1051.128) (-1046.388) [-1051.576] -- 0:01:19
13000 -- [-1047.327] (-1046.569) (-1048.533) (-1047.807) * (-1047.122) (-1052.863) [-1046.316] (-1051.599) -- 0:01:15
13500 -- (-1043.816) (-1044.541) [-1054.362] (-1056.324) * (-1050.161) [-1045.171] (-1048.904) (-1052.387) -- 0:01:13
14000 -- (-1042.019) (-1048.910) [-1055.061] (-1045.834) * (-1052.863) (-1052.252) [-1050.243] (-1047.149) -- 0:01:10
14500 -- (-1039.738) (-1051.547) [-1050.058] (-1048.060) * (-1048.267) (-1053.395) [-1048.182] (-1050.338) -- 0:01:07
15000 -- [-1039.597] (-1045.744) (-1052.926) (-1049.265) * [-1052.447] (-1045.366) (-1052.021) (-1047.803) -- 0:01:05
Average standard deviation of split frequencies: 0.055824
15500 -- (-1040.428) [-1050.120] (-1050.038) (-1045.726) * (-1052.429) (-1046.212) (-1046.816) [-1046.909] -- 0:01:03
16000 -- (-1045.645) (-1049.558) [-1051.649] (-1046.773) * (-1053.365) (-1052.119) [-1051.368] (-1050.285) -- 0:01:01
16500 -- (-1038.959) (-1045.937) (-1052.569) [-1045.390] * (-1051.056) [-1047.914] (-1047.644) (-1049.442) -- 0:00:59
17000 -- (-1039.865) (-1051.561) (-1047.143) [-1055.813] * [-1052.135] (-1051.169) (-1046.756) (-1053.610) -- 0:00:57
17500 -- (-1041.190) (-1047.705) (-1045.348) [-1048.245] * (-1045.085) [-1048.429] (-1051.180) (-1044.185) -- 0:00:56
18000 -- (-1040.655) (-1054.075) [-1054.047] (-1049.280) * (-1046.792) (-1043.985) (-1055.260) [-1045.603] -- 0:00:54
18500 -- [-1038.192] (-1051.987) (-1049.523) (-1054.348) * [-1048.269] (-1061.851) (-1049.262) (-1047.926) -- 0:00:53
19000 -- (-1038.907) [-1046.446] (-1048.138) (-1050.980) * (-1055.890) (-1057.048) [-1049.023] (-1049.863) -- 0:00:51
19500 -- [-1038.270] (-1047.068) (-1050.545) (-1052.568) * (-1052.938) (-1042.774) [-1042.990] (-1050.264) -- 0:00:50
20000 -- (-1039.561) (-1047.729) (-1052.227) [-1050.691] * (-1048.062) (-1046.129) [-1048.698] (-1056.808) -- 0:00:49
Average standard deviation of split frequencies: 0.048154
20500 -- [-1038.622] (-1044.468) (-1044.627) (-1050.625) * (-1044.130) (-1042.322) [-1047.547] (-1048.218) -- 0:00:47
21000 -- (-1040.098) (-1055.258) (-1047.261) [-1047.573] * (-1050.753) [-1045.902] (-1047.447) (-1049.054) -- 0:00:46
21500 -- (-1041.028) (-1046.703) [-1049.455] (-1058.375) * (-1047.489) (-1052.101) (-1048.992) [-1046.801] -- 0:00:45
22000 -- [-1039.315] (-1044.444) (-1055.629) (-1048.279) * [-1043.912] (-1046.329) (-1047.821) (-1045.788) -- 0:00:44
22500 -- (-1041.143) [-1043.938] (-1053.994) (-1048.702) * [-1053.166] (-1055.572) (-1055.774) (-1050.017) -- 0:00:43
23000 -- (-1045.110) (-1048.518) [-1046.249] (-1053.943) * [-1046.706] (-1049.628) (-1049.813) (-1047.633) -- 0:00:42
23500 -- (-1039.336) (-1053.064) [-1053.578] (-1051.020) * (-1048.864) [-1039.869] (-1046.350) (-1047.851) -- 0:00:41
24000 -- [-1044.407] (-1047.527) (-1047.373) (-1046.274) * (-1043.708) [-1039.346] (-1053.374) (-1045.286) -- 0:00:40
24500 -- (-1039.447) [-1048.218] (-1050.779) (-1046.828) * [-1043.439] (-1039.214) (-1057.703) (-1049.814) -- 0:00:39
25000 -- (-1047.042) [-1050.412] (-1046.244) (-1054.594) * (-1057.674) (-1042.265) (-1045.983) [-1048.761] -- 0:01:18
Average standard deviation of split frequencies: 0.041442
25500 -- (-1042.460) (-1054.565) [-1051.719] (-1047.976) * (-1051.000) [-1039.306] (-1044.816) (-1052.677) -- 0:01:16
26000 -- [-1041.140] (-1057.516) (-1053.169) (-1046.693) * (-1047.613) (-1039.392) [-1045.611] (-1050.829) -- 0:01:14
26500 -- (-1045.352) (-1051.469) (-1045.370) [-1047.859] * (-1049.367) (-1041.047) (-1052.855) [-1046.892] -- 0:01:13
27000 -- (-1046.447) (-1042.800) [-1045.630] (-1047.386) * (-1042.849) (-1048.703) (-1047.657) [-1049.665] -- 0:01:12
27500 -- (-1039.268) (-1043.862) (-1049.122) [-1050.266] * (-1045.815) (-1043.606) [-1051.615] (-1050.267) -- 0:01:10
28000 -- (-1042.302) (-1042.282) [-1047.723] (-1053.476) * [-1047.478] (-1040.987) (-1052.045) (-1049.541) -- 0:01:09
28500 -- (-1042.774) [-1042.004] (-1046.535) (-1047.322) * (-1049.625) [-1039.330] (-1051.458) (-1042.462) -- 0:01:08
29000 -- [-1041.042] (-1041.199) (-1046.438) (-1043.906) * (-1053.467) (-1042.931) (-1047.313) [-1056.998] -- 0:01:06
29500 -- (-1041.404) (-1039.336) [-1043.287] (-1051.182) * (-1053.614) [-1038.906] (-1044.267) (-1052.886) -- 0:01:05
30000 -- (-1040.041) (-1041.955) (-1045.867) [-1046.345] * (-1049.350) [-1041.085] (-1051.678) (-1047.744) -- 0:01:04
Average standard deviation of split frequencies: 0.029207
30500 -- (-1044.680) (-1040.999) (-1048.489) [-1048.253] * (-1049.786) (-1040.680) (-1049.430) [-1053.030] -- 0:01:03
31000 -- [-1040.609] (-1041.653) (-1054.897) (-1051.023) * [-1048.493] (-1040.833) (-1049.794) (-1044.866) -- 0:01:02
31500 -- (-1039.717) (-1045.472) (-1056.316) [-1049.862] * (-1051.721) (-1042.787) (-1055.254) [-1044.624] -- 0:01:01
32000 -- (-1039.913) (-1041.587) [-1047.980] (-1047.901) * (-1045.166) (-1039.123) (-1050.779) [-1044.838] -- 0:01:00
32500 -- [-1041.746] (-1040.954) (-1056.383) (-1055.918) * (-1049.026) (-1037.688) (-1043.139) [-1046.307] -- 0:00:59
33000 -- (-1039.038) (-1041.607) [-1045.681] (-1044.256) * [-1048.435] (-1038.552) (-1056.007) (-1054.451) -- 0:00:58
33500 -- [-1038.825] (-1038.833) (-1055.947) (-1046.031) * (-1055.023) [-1038.967] (-1052.826) (-1053.568) -- 0:00:57
34000 -- (-1040.162) [-1038.205] (-1053.704) (-1053.512) * (-1056.505) (-1038.942) [-1047.420] (-1055.291) -- 0:00:56
34500 -- (-1039.108) [-1039.117] (-1044.332) (-1049.143) * (-1049.809) [-1038.486] (-1053.112) (-1064.804) -- 0:00:55
35000 -- (-1038.274) [-1039.861] (-1053.118) (-1051.363) * (-1042.906) (-1040.224) (-1046.875) [-1052.310] -- 0:00:55
Average standard deviation of split frequencies: 0.027499
35500 -- (-1038.058) (-1042.080) (-1052.547) [-1053.864] * (-1050.130) (-1038.967) [-1046.784] (-1052.531) -- 0:00:54
36000 -- (-1038.085) [-1038.623] (-1048.380) (-1056.271) * (-1054.184) [-1039.652] (-1049.608) (-1045.912) -- 0:00:53
36500 -- [-1037.675] (-1038.422) (-1047.144) (-1045.876) * (-1043.895) (-1041.185) [-1045.647] (-1052.103) -- 0:00:52
37000 -- (-1038.434) [-1039.514] (-1049.304) (-1045.819) * (-1050.873) (-1040.212) (-1047.318) [-1045.207] -- 0:00:52
37500 -- (-1040.160) (-1038.462) (-1049.750) [-1045.627] * (-1048.153) (-1038.381) (-1050.046) [-1048.063] -- 0:00:51
38000 -- (-1045.243) (-1037.778) [-1053.605] (-1048.309) * (-1050.619) (-1039.532) (-1047.048) [-1050.803] -- 0:00:50
38500 -- (-1045.377) [-1038.916] (-1050.274) (-1053.464) * (-1049.772) (-1040.825) (-1050.062) [-1051.445] -- 0:00:49
39000 -- [-1039.723] (-1037.940) (-1052.589) (-1051.970) * (-1050.356) [-1041.756] (-1047.508) (-1047.861) -- 0:00:49
39500 -- [-1039.719] (-1039.123) (-1050.337) (-1044.941) * [-1049.352] (-1040.053) (-1056.619) (-1065.865) -- 0:00:48
40000 -- (-1038.718) (-1039.106) (-1056.233) [-1044.694] * (-1045.614) [-1039.290] (-1047.843) (-1049.505) -- 0:01:12
Average standard deviation of split frequencies: 0.023184
40500 -- (-1039.001) [-1039.612] (-1054.573) (-1057.451) * (-1077.836) [-1038.569] (-1055.036) (-1043.510) -- 0:01:11
41000 -- (-1039.458) [-1039.286] (-1046.802) (-1055.015) * (-1053.920) (-1043.886) (-1039.509) [-1048.341] -- 0:01:10
41500 -- [-1042.209] (-1042.375) (-1044.060) (-1046.399) * (-1043.508) (-1041.534) [-1040.407] (-1052.356) -- 0:01:09
42000 -- (-1041.206) (-1041.521) (-1052.921) [-1044.824] * (-1046.590) (-1039.301) (-1040.675) [-1045.404] -- 0:01:08
42500 -- [-1039.263] (-1040.671) (-1059.115) (-1044.712) * (-1038.460) (-1038.769) (-1042.805) [-1049.078] -- 0:01:07
43000 -- (-1040.337) [-1044.978] (-1086.426) (-1048.691) * [-1039.657] (-1039.058) (-1039.520) (-1043.806) -- 0:01:06
43500 -- [-1039.370] (-1044.723) (-1051.210) (-1050.500) * (-1040.307) [-1045.174] (-1037.866) (-1049.766) -- 0:01:05
44000 -- (-1041.244) [-1041.445] (-1041.244) (-1049.226) * (-1038.411) (-1041.354) (-1039.733) [-1048.950] -- 0:01:05
44500 -- [-1041.493] (-1037.789) (-1039.312) (-1054.517) * [-1038.226] (-1039.339) (-1038.166) (-1046.195) -- 0:01:04
45000 -- (-1041.393) (-1038.097) (-1038.793) [-1045.127] * (-1044.160) (-1043.211) (-1039.551) [-1049.638] -- 0:01:03
Average standard deviation of split frequencies: 0.024400
45500 -- (-1040.886) [-1038.161] (-1037.883) (-1042.341) * (-1042.760) (-1044.192) [-1039.010] (-1053.317) -- 0:01:02
46000 -- (-1038.647) (-1038.290) (-1040.380) [-1045.773] * (-1047.218) (-1040.208) [-1038.131] (-1045.344) -- 0:01:02
46500 -- (-1039.592) (-1037.958) [-1039.780] (-1048.614) * (-1045.694) (-1038.757) (-1038.492) [-1047.353] -- 0:01:01
47000 -- (-1040.389) [-1037.900] (-1039.850) (-1051.195) * (-1042.066) (-1038.711) (-1039.039) [-1045.938] -- 0:01:00
47500 -- (-1039.962) [-1040.370] (-1039.325) (-1047.935) * (-1039.511) (-1039.309) [-1038.188] (-1049.120) -- 0:01:00
48000 -- (-1039.775) (-1039.131) [-1040.561] (-1046.342) * (-1037.674) (-1042.373) (-1040.038) [-1048.356] -- 0:00:59
48500 -- (-1041.428) (-1041.044) [-1039.247] (-1046.350) * (-1042.881) [-1038.247] (-1039.691) (-1056.542) -- 0:00:58
49000 -- (-1040.718) (-1040.894) (-1038.944) [-1051.134] * (-1040.668) (-1039.235) (-1038.825) [-1046.915] -- 0:00:58
49500 -- (-1042.049) [-1042.271] (-1041.642) (-1060.224) * (-1039.991) (-1039.782) [-1038.582] (-1046.624) -- 0:00:57
50000 -- (-1039.272) [-1041.150] (-1042.028) (-1061.026) * (-1040.203) [-1038.880] (-1041.818) (-1053.675) -- 0:00:57
Average standard deviation of split frequencies: 0.023725
50500 -- (-1039.219) (-1042.716) (-1040.727) [-1041.849] * [-1040.002] (-1043.407) (-1041.162) (-1052.055) -- 0:00:56
51000 -- (-1039.914) [-1041.391] (-1039.883) (-1041.628) * [-1040.859] (-1042.493) (-1040.771) (-1049.639) -- 0:00:55
51500 -- [-1039.067] (-1038.473) (-1038.712) (-1039.684) * (-1039.114) [-1046.501] (-1039.708) (-1056.066) -- 0:00:55
52000 -- (-1040.053) (-1042.155) [-1039.828] (-1040.981) * [-1038.897] (-1046.605) (-1041.022) (-1051.726) -- 0:00:54
52500 -- (-1040.394) [-1040.775] (-1038.725) (-1039.999) * [-1040.736] (-1046.377) (-1040.965) (-1052.661) -- 0:00:54
53000 -- (-1042.551) (-1046.327) [-1041.575] (-1039.403) * (-1043.172) (-1038.444) (-1041.763) [-1048.053] -- 0:00:53
53500 -- [-1039.330] (-1044.349) (-1041.482) (-1041.420) * (-1042.791) [-1038.769] (-1042.931) (-1054.365) -- 0:00:53
54000 -- [-1041.264] (-1043.144) (-1037.960) (-1040.074) * (-1039.976) [-1039.829] (-1039.103) (-1048.040) -- 0:00:52
54500 -- (-1040.076) (-1037.757) [-1037.960] (-1039.933) * (-1040.561) (-1040.897) [-1042.288] (-1051.670) -- 0:00:52
55000 -- (-1041.171) [-1038.063] (-1039.762) (-1040.206) * (-1039.005) (-1038.124) (-1041.679) [-1051.561] -- 0:00:51
Average standard deviation of split frequencies: 0.029684
55500 -- (-1042.743) (-1039.870) [-1038.217] (-1038.536) * (-1038.829) (-1038.085) (-1039.590) [-1045.746] -- 0:01:08
56000 -- (-1047.290) (-1039.830) (-1039.321) [-1039.683] * (-1043.985) (-1038.394) (-1040.089) [-1051.090] -- 0:01:07
56500 -- (-1038.377) (-1040.735) [-1039.322] (-1039.592) * (-1042.330) (-1038.310) (-1039.724) [-1048.811] -- 0:01:06
57000 -- (-1038.499) [-1039.199] (-1039.355) (-1038.276) * (-1040.727) (-1038.967) (-1040.056) [-1050.792] -- 0:01:06
57500 -- (-1038.454) [-1039.945] (-1038.914) (-1040.098) * (-1043.242) [-1040.166] (-1041.172) (-1055.984) -- 0:01:05
58000 -- [-1039.017] (-1043.014) (-1041.282) (-1042.358) * (-1042.554) (-1038.319) (-1039.745) [-1043.388] -- 0:01:04
58500 -- (-1040.445) (-1041.071) [-1041.320] (-1041.430) * (-1040.319) [-1038.202] (-1040.606) (-1056.185) -- 0:01:04
59000 -- [-1041.585] (-1039.219) (-1040.497) (-1040.208) * (-1040.596) [-1037.637] (-1041.649) (-1049.603) -- 0:01:03
59500 -- (-1040.745) [-1039.673] (-1041.265) (-1040.331) * (-1041.526) (-1043.424) (-1040.646) [-1044.612] -- 0:01:03
60000 -- [-1039.478] (-1040.870) (-1040.102) (-1039.377) * (-1040.704) (-1039.238) [-1041.375] (-1045.048) -- 0:01:02
Average standard deviation of split frequencies: 0.031900
60500 -- (-1038.957) [-1041.763] (-1039.704) (-1040.126) * (-1043.658) (-1041.409) [-1040.888] (-1052.977) -- 0:01:02
61000 -- (-1043.195) (-1039.565) (-1039.638) [-1041.181] * (-1040.895) [-1040.389] (-1040.669) (-1049.034) -- 0:01:01
61500 -- (-1038.167) (-1038.729) (-1046.104) [-1038.615] * (-1039.203) (-1039.497) (-1039.537) [-1050.414] -- 0:01:01
62000 -- (-1038.307) [-1041.037] (-1041.166) (-1039.282) * (-1039.751) [-1039.003] (-1040.949) (-1046.276) -- 0:01:00
62500 -- (-1038.668) [-1042.188] (-1038.210) (-1040.334) * (-1043.653) [-1039.774] (-1040.247) (-1056.397) -- 0:01:00
63000 -- (-1038.557) [-1040.490] (-1039.156) (-1042.712) * (-1041.031) [-1038.967] (-1040.284) (-1052.401) -- 0:00:59
63500 -- [-1038.291] (-1039.310) (-1039.595) (-1041.099) * (-1040.539) (-1039.518) [-1042.165] (-1047.034) -- 0:00:58
64000 -- [-1041.421] (-1042.028) (-1039.739) (-1039.604) * [-1038.074] (-1041.757) (-1040.468) (-1048.436) -- 0:00:58
64500 -- (-1039.886) (-1040.764) (-1039.499) [-1038.616] * (-1038.472) (-1042.025) (-1039.886) [-1043.931] -- 0:00:58
65000 -- (-1039.714) [-1040.043] (-1041.394) (-1041.385) * [-1043.741] (-1041.182) (-1042.688) (-1050.121) -- 0:00:57
Average standard deviation of split frequencies: 0.029869
65500 -- (-1041.489) (-1038.845) (-1038.773) [-1044.505] * (-1039.519) [-1041.494] (-1039.342) (-1055.125) -- 0:00:57
66000 -- (-1042.039) (-1039.824) (-1039.903) [-1040.965] * [-1038.858] (-1038.905) (-1040.521) (-1048.307) -- 0:00:56
66500 -- (-1039.840) [-1039.770] (-1039.583) (-1043.726) * [-1039.501] (-1040.102) (-1040.626) (-1046.403) -- 0:00:56
67000 -- (-1040.475) (-1039.616) (-1041.564) [-1037.804] * (-1042.411) (-1038.968) (-1039.767) [-1042.399] -- 0:00:55
67500 -- (-1040.193) (-1043.352) (-1038.856) [-1039.024] * (-1040.036) (-1041.163) (-1041.744) [-1043.156] -- 0:00:55
68000 -- (-1040.994) (-1043.737) [-1039.403] (-1038.380) * (-1039.828) (-1038.752) (-1040.173) [-1044.289] -- 0:00:54
68500 -- (-1045.708) (-1040.830) (-1037.781) [-1038.074] * (-1041.719) (-1041.041) [-1041.928] (-1050.952) -- 0:00:54
69000 -- (-1047.576) (-1039.488) [-1037.627] (-1039.874) * (-1041.113) [-1038.936] (-1041.126) (-1047.900) -- 0:00:53
69500 -- [-1041.817] (-1044.823) (-1038.156) (-1039.912) * (-1043.217) (-1039.124) [-1042.811] (-1049.706) -- 0:00:53
70000 -- (-1039.681) (-1040.593) [-1038.706] (-1042.345) * (-1043.873) (-1037.980) [-1041.286] (-1048.922) -- 0:00:53
Average standard deviation of split frequencies: 0.030928
70500 -- [-1038.300] (-1039.752) (-1040.414) (-1041.035) * (-1042.609) (-1038.244) (-1038.136) [-1051.650] -- 0:00:52
71000 -- (-1039.727) (-1040.105) (-1039.982) [-1039.906] * (-1038.334) (-1038.268) (-1039.090) [-1049.121] -- 0:01:05
71500 -- (-1039.713) (-1040.943) [-1040.380] (-1041.463) * (-1039.917) [-1039.248] (-1038.416) (-1044.974) -- 0:01:04
72000 -- (-1041.835) [-1040.576] (-1039.146) (-1041.017) * (-1038.730) (-1038.629) [-1038.854] (-1058.222) -- 0:01:04
72500 -- (-1041.277) (-1041.743) [-1039.228] (-1038.336) * [-1039.430] (-1037.802) (-1049.764) (-1071.704) -- 0:01:03
73000 -- (-1042.991) (-1040.536) [-1041.490] (-1039.908) * (-1040.895) (-1040.802) [-1044.719] (-1043.280) -- 0:01:03
73500 -- (-1041.380) (-1041.984) (-1040.024) [-1040.198] * (-1039.048) (-1045.496) (-1042.951) [-1041.806] -- 0:01:03
74000 -- [-1041.031] (-1039.001) (-1040.384) (-1041.558) * (-1040.243) (-1045.851) [-1040.570] (-1044.987) -- 0:01:02
74500 -- [-1041.265] (-1038.949) (-1041.804) (-1041.057) * [-1038.413] (-1041.893) (-1040.597) (-1041.385) -- 0:01:02
75000 -- [-1040.682] (-1041.220) (-1042.845) (-1042.986) * [-1041.355] (-1043.783) (-1041.939) (-1040.788) -- 0:01:01
Average standard deviation of split frequencies: 0.035355
75500 -- (-1040.143) (-1042.938) (-1041.404) [-1042.587] * [-1039.981] (-1040.265) (-1042.396) (-1039.098) -- 0:01:01
76000 -- (-1039.985) [-1038.753] (-1038.490) (-1040.620) * (-1038.502) (-1041.154) (-1042.916) [-1040.560] -- 0:01:00
76500 -- (-1040.491) [-1037.939] (-1039.272) (-1043.252) * (-1041.213) [-1040.507] (-1040.875) (-1039.371) -- 0:01:00
77000 -- (-1038.624) [-1037.751] (-1038.662) (-1043.488) * (-1039.235) (-1040.656) (-1040.348) [-1038.237] -- 0:00:59
77500 -- (-1039.024) [-1038.324] (-1038.451) (-1046.717) * [-1040.443] (-1039.938) (-1038.964) (-1038.332) -- 0:00:59
78000 -- (-1039.168) (-1039.361) (-1038.193) [-1042.519] * (-1040.749) (-1043.030) (-1038.327) [-1039.989] -- 0:00:59
78500 -- [-1040.676] (-1039.749) (-1039.869) (-1047.868) * (-1048.537) (-1046.334) (-1038.477) [-1038.059] -- 0:00:58
79000 -- (-1042.469) [-1040.669] (-1038.307) (-1045.163) * (-1044.541) (-1045.493) (-1038.512) [-1041.530] -- 0:00:58
79500 -- [-1041.679] (-1039.864) (-1040.050) (-1044.126) * (-1042.884) (-1045.156) (-1039.377) [-1039.673] -- 0:00:57
80000 -- (-1038.581) [-1038.784] (-1040.055) (-1043.367) * [-1039.344] (-1041.351) (-1046.594) (-1040.393) -- 0:00:57
Average standard deviation of split frequencies: 0.030388
80500 -- [-1038.854] (-1037.929) (-1037.751) (-1037.728) * [-1040.304] (-1041.542) (-1039.509) (-1041.149) -- 0:00:57
81000 -- (-1040.174) (-1039.729) [-1038.445] (-1039.937) * (-1040.319) [-1040.347] (-1039.369) (-1040.180) -- 0:00:56
81500 -- [-1039.981] (-1039.429) (-1042.965) (-1038.921) * (-1040.165) [-1041.925] (-1038.573) (-1038.911) -- 0:00:56
82000 -- (-1040.976) (-1039.099) [-1041.326] (-1039.035) * (-1040.427) (-1042.175) (-1038.293) [-1039.255] -- 0:00:55
82500 -- (-1039.951) (-1039.912) [-1042.664] (-1038.668) * (-1044.132) (-1041.039) (-1039.311) [-1041.079] -- 0:00:55
83000 -- (-1039.850) [-1038.975] (-1039.332) (-1038.971) * (-1045.337) (-1041.038) (-1040.048) [-1042.866] -- 0:00:55
83500 -- (-1039.722) [-1039.850] (-1040.724) (-1039.313) * (-1041.446) (-1042.981) [-1041.387] (-1042.377) -- 0:00:54
84000 -- (-1039.015) [-1041.754] (-1041.895) (-1039.623) * (-1041.021) (-1041.698) [-1041.699] (-1039.250) -- 0:00:54
84500 -- [-1039.495] (-1040.187) (-1038.234) (-1043.111) * (-1039.762) (-1041.159) [-1041.121] (-1043.005) -- 0:00:54
85000 -- (-1039.486) (-1043.926) [-1038.867] (-1039.561) * [-1041.354] (-1038.212) (-1040.669) (-1043.818) -- 0:00:53
Average standard deviation of split frequencies: 0.026660
85500 -- [-1040.268] (-1040.115) (-1038.978) (-1038.793) * [-1039.548] (-1040.065) (-1039.710) (-1042.395) -- 0:00:53
86000 -- [-1037.973] (-1038.974) (-1040.228) (-1038.535) * [-1038.691] (-1040.059) (-1039.875) (-1041.595) -- 0:00:53
86500 -- (-1039.374) (-1038.361) (-1040.960) [-1038.623] * (-1039.180) [-1039.547] (-1039.921) (-1040.589) -- 0:00:52
87000 -- [-1038.211] (-1039.318) (-1043.966) (-1038.674) * [-1039.927] (-1038.917) (-1043.690) (-1040.860) -- 0:00:52
87500 -- [-1038.168] (-1037.998) (-1038.780) (-1038.680) * (-1038.512) [-1038.839] (-1041.704) (-1038.920) -- 0:01:02
88000 -- (-1039.556) (-1038.701) [-1039.760] (-1038.542) * (-1038.048) [-1038.996] (-1042.873) (-1038.250) -- 0:01:02
88500 -- (-1037.976) [-1038.774] (-1039.263) (-1041.924) * (-1038.547) [-1039.077] (-1040.378) (-1037.922) -- 0:01:01
89000 -- [-1038.576] (-1040.668) (-1037.886) (-1041.113) * (-1039.817) (-1039.869) (-1040.422) [-1040.551] -- 0:01:01
89500 -- (-1039.776) (-1039.010) (-1038.972) [-1040.895] * (-1039.492) [-1043.238] (-1042.855) (-1038.529) -- 0:01:01
90000 -- (-1039.715) (-1038.052) (-1038.946) [-1038.375] * (-1039.212) [-1039.832] (-1040.649) (-1039.997) -- 0:01:00
Average standard deviation of split frequencies: 0.025524
90500 -- (-1038.510) (-1039.894) (-1040.119) [-1038.736] * [-1040.741] (-1042.146) (-1038.971) (-1038.972) -- 0:01:00
91000 -- (-1039.109) (-1042.770) [-1042.128] (-1043.315) * [-1040.504] (-1038.729) (-1039.018) (-1038.546) -- 0:00:59
91500 -- (-1038.173) (-1044.046) [-1041.726] (-1041.051) * (-1038.860) [-1041.840] (-1043.140) (-1039.807) -- 0:00:59
92000 -- (-1040.834) (-1046.715) [-1039.303] (-1039.234) * (-1039.045) (-1042.564) (-1038.853) [-1039.661] -- 0:00:59
92500 -- (-1041.421) (-1045.591) [-1040.963] (-1039.996) * (-1040.344) (-1041.337) (-1041.693) [-1041.056] -- 0:00:58
93000 -- (-1042.255) (-1042.288) (-1039.786) [-1038.607] * (-1042.454) (-1039.565) [-1040.036] (-1043.627) -- 0:00:58
93500 -- [-1042.986] (-1039.678) (-1038.982) (-1038.421) * (-1039.828) (-1038.614) (-1040.093) [-1040.031] -- 0:00:58
94000 -- (-1039.867) (-1039.038) [-1039.246] (-1040.621) * (-1038.098) (-1038.628) [-1038.564] (-1038.743) -- 0:00:57
94500 -- [-1041.342] (-1039.413) (-1041.520) (-1043.220) * (-1039.280) [-1038.680] (-1038.635) (-1041.221) -- 0:00:57
95000 -- (-1042.111) (-1041.627) [-1038.617] (-1040.321) * [-1039.078] (-1038.945) (-1042.749) (-1038.573) -- 0:00:57
Average standard deviation of split frequencies: 0.021746
95500 -- (-1039.482) [-1039.263] (-1038.498) (-1043.296) * (-1038.978) (-1039.790) (-1040.448) [-1039.152] -- 0:00:56
96000 -- [-1046.509] (-1039.082) (-1038.486) (-1043.848) * (-1039.799) [-1037.662] (-1039.000) (-1039.111) -- 0:00:56
96500 -- (-1040.706) (-1038.716) [-1038.591] (-1039.983) * (-1041.053) [-1038.485] (-1043.909) (-1038.478) -- 0:00:56
97000 -- (-1040.016) (-1039.835) (-1039.835) [-1040.166] * (-1040.353) (-1037.756) [-1042.514] (-1038.974) -- 0:00:55
97500 -- (-1043.750) (-1040.479) [-1040.589] (-1041.165) * [-1039.161] (-1042.334) (-1043.070) (-1038.993) -- 0:00:55
98000 -- [-1040.031] (-1041.295) (-1039.360) (-1043.286) * (-1038.682) (-1039.750) [-1040.559] (-1038.948) -- 0:00:55
98500 -- (-1040.617) [-1041.721] (-1040.158) (-1040.393) * (-1038.066) (-1039.783) (-1039.904) [-1037.864] -- 0:00:54
99000 -- [-1040.251] (-1043.645) (-1042.193) (-1039.987) * (-1038.026) [-1041.508] (-1042.050) (-1039.722) -- 0:00:54
99500 -- (-1042.404) (-1045.443) (-1039.961) [-1040.069] * (-1041.917) (-1039.473) (-1042.925) [-1037.830] -- 0:00:54
100000 -- (-1040.940) (-1041.804) (-1038.676) [-1041.102] * (-1043.586) [-1040.018] (-1041.124) (-1039.400) -- 0:00:54
Average standard deviation of split frequencies: 0.026926
100500 -- [-1040.677] (-1040.102) (-1039.514) (-1038.555) * (-1039.854) (-1039.924) (-1039.046) [-1037.830] -- 0:00:53
101000 -- [-1042.571] (-1039.524) (-1039.522) (-1041.386) * (-1039.806) [-1040.940] (-1042.766) (-1037.740) -- 0:00:53
101500 -- (-1042.232) (-1040.467) [-1040.574] (-1041.650) * [-1037.924] (-1038.314) (-1044.166) (-1039.728) -- 0:00:53
102000 -- (-1039.522) (-1041.260) (-1039.047) [-1042.340] * (-1040.106) [-1038.258] (-1042.596) (-1038.733) -- 0:00:52
102500 -- (-1039.042) (-1038.730) [-1041.029] (-1042.915) * (-1041.222) [-1038.457] (-1042.293) (-1040.904) -- 0:00:52
103000 -- (-1038.906) (-1038.631) [-1038.791] (-1039.409) * (-1040.847) (-1038.735) [-1045.178] (-1041.806) -- 0:00:52
103500 -- (-1039.399) (-1039.159) (-1040.247) [-1039.974] * (-1040.547) [-1038.910] (-1038.955) (-1039.936) -- 0:00:51
104000 -- (-1040.846) (-1038.713) [-1040.005] (-1042.793) * (-1042.422) (-1037.572) [-1040.691] (-1040.531) -- 0:01:00
104500 -- (-1041.375) (-1039.401) (-1040.055) [-1038.965] * (-1041.719) [-1037.913] (-1039.212) (-1041.225) -- 0:00:59
105000 -- (-1043.508) [-1039.105] (-1039.845) (-1040.257) * (-1039.889) [-1041.538] (-1040.971) (-1040.160) -- 0:00:59
Average standard deviation of split frequencies: 0.024566
105500 -- [-1041.131] (-1039.011) (-1039.709) (-1040.583) * (-1042.909) (-1041.082) [-1041.150] (-1045.356) -- 0:00:59
106000 -- (-1042.120) [-1038.863] (-1040.224) (-1041.414) * (-1039.498) [-1041.664] (-1043.250) (-1040.140) -- 0:00:59
106500 -- (-1042.713) (-1039.230) [-1040.259] (-1039.457) * (-1038.671) (-1044.016) (-1040.793) [-1040.438] -- 0:00:58
107000 -- (-1041.728) (-1039.217) [-1038.561] (-1038.716) * [-1039.623] (-1040.497) (-1039.718) (-1042.068) -- 0:00:58
107500 -- (-1041.231) (-1039.742) [-1038.399] (-1038.686) * (-1039.428) [-1040.505] (-1041.963) (-1039.717) -- 0:00:58
108000 -- (-1037.655) (-1039.441) (-1039.011) [-1042.012] * (-1041.896) (-1041.673) [-1046.111] (-1043.114) -- 0:00:57
108500 -- [-1038.370] (-1039.898) (-1038.404) (-1039.818) * (-1041.320) (-1041.549) (-1045.165) [-1038.899] -- 0:00:57
109000 -- [-1038.888] (-1041.148) (-1040.455) (-1039.871) * (-1041.825) (-1040.536) [-1042.735] (-1039.399) -- 0:00:57
109500 -- (-1042.391) (-1039.309) (-1039.529) [-1038.095] * (-1041.259) [-1038.646] (-1039.619) (-1040.464) -- 0:00:56
110000 -- (-1041.695) [-1039.023] (-1038.617) (-1038.189) * (-1040.482) [-1038.597] (-1045.496) (-1039.334) -- 0:00:56
Average standard deviation of split frequencies: 0.026836
110500 -- (-1041.521) (-1039.989) (-1039.834) [-1040.024] * (-1040.125) [-1038.578] (-1040.413) (-1039.536) -- 0:00:56
111000 -- (-1041.138) (-1043.895) [-1039.309] (-1039.431) * (-1038.800) [-1039.145] (-1039.218) (-1039.651) -- 0:00:56
111500 -- [-1042.786] (-1039.288) (-1044.428) (-1040.111) * (-1038.760) (-1038.818) (-1041.711) [-1039.646] -- 0:00:55
112000 -- (-1038.794) (-1039.261) [-1042.083] (-1039.947) * (-1038.682) (-1039.961) [-1038.817] (-1039.878) -- 0:00:55
112500 -- (-1038.592) (-1039.483) [-1039.281] (-1039.601) * (-1038.517) (-1042.587) [-1041.016] (-1039.456) -- 0:00:55
113000 -- (-1043.860) (-1040.051) [-1038.960] (-1037.644) * (-1038.506) [-1044.608] (-1042.258) (-1039.516) -- 0:00:54
113500 -- (-1038.275) (-1041.832) (-1041.576) [-1040.456] * (-1038.480) (-1046.520) [-1041.198] (-1041.598) -- 0:00:54
114000 -- (-1043.723) (-1041.635) [-1038.944] (-1043.359) * (-1038.774) [-1040.051] (-1039.850) (-1039.109) -- 0:00:54
114500 -- [-1042.112] (-1046.699) (-1039.507) (-1040.237) * (-1041.281) (-1038.538) [-1043.318] (-1041.241) -- 0:00:54
115000 -- (-1041.756) (-1041.236) [-1038.087] (-1040.712) * (-1038.982) (-1041.245) (-1041.727) [-1039.802] -- 0:00:53
Average standard deviation of split frequencies: 0.028447
115500 -- (-1043.061) [-1038.929] (-1040.496) (-1043.980) * [-1039.257] (-1043.567) (-1040.309) (-1040.190) -- 0:00:53
116000 -- (-1039.873) [-1037.935] (-1039.438) (-1042.138) * (-1038.378) [-1041.935] (-1040.517) (-1038.924) -- 0:00:53
116500 -- [-1041.133] (-1039.601) (-1039.697) (-1049.045) * (-1038.114) [-1038.894] (-1039.155) (-1038.936) -- 0:00:53
117000 -- (-1039.330) (-1038.886) [-1038.697] (-1046.447) * (-1038.000) (-1039.105) [-1041.092] (-1038.040) -- 0:00:52
117500 -- [-1038.525] (-1039.521) (-1044.572) (-1043.005) * (-1039.567) (-1043.898) (-1041.828) [-1037.819] -- 0:00:52
118000 -- (-1039.633) [-1039.274] (-1043.025) (-1044.488) * (-1041.058) (-1040.836) (-1041.440) [-1038.221] -- 0:00:52
118500 -- (-1039.152) [-1042.423] (-1043.223) (-1042.762) * (-1038.569) (-1043.185) (-1041.904) [-1039.715] -- 0:00:52
119000 -- [-1039.832] (-1038.928) (-1039.739) (-1043.268) * [-1040.358] (-1042.788) (-1039.443) (-1040.689) -- 0:00:51
119500 -- [-1042.486] (-1038.667) (-1040.120) (-1044.453) * [-1040.077] (-1039.838) (-1038.213) (-1040.379) -- 0:00:51
120000 -- (-1038.978) (-1040.115) (-1038.209) [-1039.900] * (-1038.727) (-1040.249) (-1040.956) [-1039.970] -- 0:00:51
Average standard deviation of split frequencies: 0.025702
120500 -- (-1040.021) (-1043.584) [-1039.660] (-1044.386) * (-1046.272) [-1039.778] (-1041.921) (-1042.230) -- 0:00:58
121000 -- (-1038.853) (-1039.799) (-1039.917) [-1038.360] * (-1041.938) (-1038.721) (-1041.159) [-1039.728] -- 0:00:58
121500 -- (-1039.157) (-1042.187) [-1039.585] (-1038.651) * (-1041.939) (-1042.448) (-1040.819) [-1039.483] -- 0:00:57
122000 -- (-1038.813) [-1041.785] (-1039.895) (-1038.269) * [-1040.934] (-1039.656) (-1042.142) (-1042.627) -- 0:00:57
122500 -- (-1041.652) (-1039.598) (-1039.409) [-1039.718] * (-1040.368) (-1040.065) (-1039.210) [-1039.965] -- 0:00:57
123000 -- (-1038.106) [-1040.376] (-1039.466) (-1038.000) * (-1039.279) (-1052.282) (-1043.427) [-1041.438] -- 0:00:57
123500 -- (-1038.058) (-1038.270) (-1042.174) [-1038.265] * (-1039.645) [-1045.982] (-1041.291) (-1040.159) -- 0:00:56
124000 -- (-1039.146) (-1039.789) (-1041.844) [-1038.170] * [-1040.545] (-1039.144) (-1047.509) (-1042.388) -- 0:00:56
124500 -- (-1038.768) [-1040.633] (-1043.173) (-1038.359) * (-1039.227) (-1042.056) (-1039.720) [-1038.115] -- 0:00:56
125000 -- [-1038.233] (-1039.864) (-1038.774) (-1039.295) * (-1037.718) [-1040.439] (-1039.650) (-1039.867) -- 0:00:56
Average standard deviation of split frequencies: 0.022804
125500 -- [-1040.999] (-1038.692) (-1039.673) (-1039.377) * [-1039.720] (-1040.524) (-1038.933) (-1041.606) -- 0:00:55
126000 -- [-1039.428] (-1038.941) (-1038.061) (-1038.080) * (-1039.851) [-1041.024] (-1039.482) (-1042.578) -- 0:00:55
126500 -- [-1039.463] (-1040.067) (-1040.218) (-1039.278) * (-1040.469) (-1040.914) [-1039.339] (-1043.953) -- 0:00:55
127000 -- (-1040.595) (-1041.542) [-1039.949] (-1040.071) * (-1041.522) [-1042.235] (-1039.869) (-1039.276) -- 0:00:54
127500 -- (-1043.707) (-1039.806) (-1038.215) [-1039.883] * (-1039.118) (-1043.142) [-1040.997] (-1040.718) -- 0:00:54
128000 -- (-1040.663) (-1038.830) [-1039.198] (-1042.098) * (-1042.003) [-1038.338] (-1038.986) (-1038.853) -- 0:00:54
128500 -- (-1044.142) (-1039.383) [-1039.461] (-1041.538) * (-1040.015) [-1039.957] (-1043.160) (-1040.283) -- 0:00:54
129000 -- (-1041.614) (-1039.359) [-1039.612] (-1040.835) * [-1038.602] (-1038.437) (-1041.508) (-1043.093) -- 0:00:54
129500 -- [-1038.992] (-1042.114) (-1040.688) (-1042.696) * [-1039.263] (-1040.036) (-1041.485) (-1043.903) -- 0:00:53
130000 -- (-1040.163) (-1040.982) [-1041.502] (-1040.182) * (-1041.784) [-1038.349] (-1040.991) (-1042.866) -- 0:00:53
Average standard deviation of split frequencies: 0.022007
130500 -- [-1040.551] (-1042.800) (-1042.326) (-1039.649) * [-1038.817] (-1041.649) (-1041.216) (-1047.624) -- 0:00:53
131000 -- (-1039.814) (-1039.433) (-1040.320) [-1041.157] * [-1041.894] (-1040.490) (-1039.629) (-1038.759) -- 0:00:53
131500 -- (-1040.676) [-1038.000] (-1038.813) (-1040.179) * [-1041.227] (-1039.260) (-1040.960) (-1039.784) -- 0:00:52
132000 -- [-1040.690] (-1037.839) (-1041.669) (-1041.912) * (-1039.436) (-1038.331) [-1041.653] (-1040.164) -- 0:00:52
132500 -- (-1039.354) (-1041.282) [-1039.358] (-1041.999) * (-1039.675) (-1041.405) (-1041.182) [-1038.443] -- 0:00:52
133000 -- (-1040.688) (-1041.577) [-1038.181] (-1041.752) * (-1042.033) (-1044.897) (-1038.791) [-1039.078] -- 0:00:52
133500 -- (-1042.176) [-1041.546] (-1040.956) (-1038.941) * (-1043.939) (-1040.718) (-1040.566) [-1041.151] -- 0:00:51
134000 -- (-1043.525) [-1042.259] (-1042.559) (-1038.924) * (-1046.592) [-1039.795] (-1038.939) (-1038.669) -- 0:00:58
134500 -- [-1037.972] (-1038.530) (-1040.652) (-1041.032) * (-1038.619) (-1040.780) [-1039.194] (-1038.667) -- 0:00:57
135000 -- (-1038.531) (-1038.255) (-1040.743) [-1041.499] * [-1039.104] (-1039.708) (-1040.453) (-1040.321) -- 0:00:57
Average standard deviation of split frequencies: 0.020137
135500 -- (-1038.531) (-1037.958) (-1038.227) [-1039.782] * (-1040.035) (-1041.379) (-1044.152) [-1038.905] -- 0:00:57
136000 -- (-1040.557) (-1038.404) [-1039.932] (-1039.930) * (-1041.895) (-1041.115) (-1041.041) [-1040.053] -- 0:00:57
136500 -- [-1038.515] (-1038.714) (-1038.581) (-1039.249) * [-1042.056] (-1039.799) (-1040.052) (-1040.480) -- 0:00:56
137000 -- (-1038.259) [-1039.521] (-1038.581) (-1040.905) * (-1038.219) [-1038.511] (-1039.507) (-1043.019) -- 0:00:56
137500 -- (-1039.604) (-1040.974) (-1042.248) [-1043.020] * (-1044.708) [-1040.468] (-1039.350) (-1042.971) -- 0:00:56
138000 -- [-1042.586] (-1039.030) (-1041.808) (-1039.059) * [-1038.280] (-1040.463) (-1039.320) (-1041.312) -- 0:00:56
138500 -- (-1043.182) (-1037.918) (-1039.922) [-1041.337] * [-1038.491] (-1038.055) (-1039.202) (-1040.390) -- 0:00:55
139000 -- (-1038.159) (-1040.524) (-1040.305) [-1039.998] * (-1041.521) [-1039.497] (-1040.755) (-1041.355) -- 0:00:55
139500 -- (-1038.261) [-1042.682] (-1041.828) (-1042.528) * (-1040.391) (-1040.322) (-1039.360) [-1040.127] -- 0:00:55
140000 -- (-1038.252) [-1041.500] (-1042.424) (-1044.181) * [-1039.383] (-1040.016) (-1040.629) (-1043.408) -- 0:00:55
Average standard deviation of split frequencies: 0.019755
140500 -- (-1040.134) (-1041.956) (-1041.772) [-1040.852] * (-1046.483) [-1038.104] (-1039.907) (-1041.311) -- 0:00:55
141000 -- (-1039.722) (-1043.755) (-1042.190) [-1037.971] * (-1041.156) [-1040.545] (-1040.555) (-1039.775) -- 0:00:54
141500 -- (-1042.014) [-1044.362] (-1039.493) (-1038.141) * (-1043.127) [-1039.708] (-1043.550) (-1039.146) -- 0:00:54
142000 -- (-1038.552) [-1038.380] (-1041.156) (-1038.647) * (-1041.557) (-1039.668) (-1044.698) [-1038.275] -- 0:00:54
142500 -- (-1041.273) (-1041.696) (-1038.122) [-1038.343] * (-1039.407) (-1041.054) (-1039.083) [-1038.409] -- 0:00:54
143000 -- (-1039.530) [-1038.615] (-1041.477) (-1037.848) * (-1039.715) (-1041.630) [-1038.227] (-1039.391) -- 0:00:53
143500 -- (-1041.502) (-1042.080) [-1041.798] (-1037.738) * (-1039.523) (-1040.969) [-1049.868] (-1040.058) -- 0:00:53
144000 -- (-1038.631) (-1046.143) (-1041.682) [-1037.738] * [-1038.620] (-1039.635) (-1039.584) (-1038.915) -- 0:00:53
144500 -- (-1037.735) [-1038.803] (-1038.861) (-1041.721) * (-1041.041) [-1040.149] (-1041.847) (-1041.328) -- 0:00:53
145000 -- (-1037.888) (-1039.713) (-1049.094) [-1038.111] * (-1037.695) (-1038.941) [-1041.135] (-1039.507) -- 0:00:53
Average standard deviation of split frequencies: 0.018353
145500 -- [-1038.514] (-1041.369) (-1044.091) (-1039.047) * (-1040.853) [-1041.149] (-1037.998) (-1041.483) -- 0:00:52
146000 -- [-1040.704] (-1042.828) (-1040.956) (-1039.028) * (-1038.738) (-1039.531) [-1039.946] (-1038.735) -- 0:00:52
146500 -- (-1038.112) (-1044.146) [-1039.750] (-1038.954) * (-1041.617) (-1038.378) (-1038.144) [-1039.283] -- 0:00:52
147000 -- [-1038.331] (-1042.673) (-1041.838) (-1037.627) * (-1040.260) (-1041.096) [-1038.846] (-1041.249) -- 0:00:52
147500 -- [-1037.981] (-1038.804) (-1040.592) (-1037.617) * (-1040.162) [-1039.147] (-1038.017) (-1041.162) -- 0:00:57
148000 -- (-1042.526) (-1040.187) [-1040.228] (-1039.695) * [-1039.244] (-1039.542) (-1039.126) (-1040.685) -- 0:00:57
148500 -- (-1038.054) (-1038.306) (-1041.813) [-1037.835] * (-1039.987) [-1039.544] (-1041.223) (-1040.268) -- 0:00:57
149000 -- (-1040.024) [-1040.947] (-1043.445) (-1038.447) * (-1039.068) [-1040.394] (-1038.428) (-1040.336) -- 0:00:57
149500 -- (-1038.909) (-1039.735) [-1043.114] (-1038.548) * (-1039.073) [-1040.380] (-1038.421) (-1042.195) -- 0:00:56
150000 -- (-1042.415) (-1041.976) [-1041.374] (-1039.489) * (-1041.650) (-1038.420) [-1038.494] (-1040.862) -- 0:00:56
Average standard deviation of split frequencies: 0.017291
150500 -- (-1041.773) [-1038.711] (-1040.338) (-1039.278) * (-1040.235) (-1039.070) [-1039.300] (-1041.162) -- 0:00:56
151000 -- [-1041.640] (-1038.604) (-1039.268) (-1041.542) * [-1040.941] (-1038.493) (-1043.062) (-1041.460) -- 0:00:56
151500 -- [-1040.537] (-1038.562) (-1039.867) (-1040.829) * (-1041.770) [-1042.042] (-1044.525) (-1043.135) -- 0:00:56
152000 -- (-1040.748) (-1038.692) [-1038.852] (-1043.428) * (-1038.877) [-1040.519] (-1038.657) (-1044.438) -- 0:00:55
152500 -- (-1042.650) [-1040.066] (-1041.583) (-1041.557) * [-1041.413] (-1039.378) (-1038.374) (-1043.387) -- 0:00:55
153000 -- (-1040.891) (-1040.696) [-1041.031] (-1040.518) * [-1039.259] (-1039.741) (-1038.029) (-1044.943) -- 0:00:55
153500 -- (-1040.424) [-1039.274] (-1039.353) (-1040.175) * [-1039.622] (-1039.832) (-1039.058) (-1039.985) -- 0:00:55
154000 -- (-1039.428) (-1046.467) [-1038.280] (-1039.304) * (-1040.319) (-1040.115) [-1037.800] (-1038.571) -- 0:00:54
154500 -- [-1040.838] (-1040.204) (-1042.085) (-1046.948) * (-1039.330) (-1038.735) [-1039.280] (-1038.978) -- 0:00:54
155000 -- (-1040.567) (-1042.290) [-1045.108] (-1038.976) * (-1039.127) [-1038.526] (-1040.237) (-1037.671) -- 0:00:54
Average standard deviation of split frequencies: 0.017459
155500 -- (-1041.265) [-1039.895] (-1044.200) (-1038.219) * (-1039.787) (-1043.662) (-1040.529) [-1037.668] -- 0:00:54
156000 -- (-1039.141) (-1041.253) [-1038.449] (-1042.600) * (-1040.269) [-1039.004] (-1038.806) (-1037.912) -- 0:00:54
156500 -- [-1039.096] (-1041.044) (-1040.312) (-1041.376) * (-1039.364) (-1040.153) (-1042.891) [-1041.195] -- 0:00:53
157000 -- [-1039.607] (-1040.853) (-1039.219) (-1040.755) * (-1040.099) [-1040.710] (-1041.523) (-1041.677) -- 0:00:53
157500 -- (-1037.874) (-1038.378) [-1040.521] (-1040.126) * (-1040.303) (-1039.648) (-1038.508) [-1038.851] -- 0:00:53
158000 -- (-1040.041) (-1039.829) (-1045.622) [-1039.251] * (-1042.096) (-1040.633) (-1040.904) [-1040.953] -- 0:00:53
158500 -- [-1040.388] (-1039.247) (-1038.961) (-1039.683) * (-1041.417) [-1040.969] (-1040.671) (-1038.567) -- 0:00:53
159000 -- (-1040.609) (-1039.069) [-1038.305] (-1039.606) * (-1041.908) (-1041.630) (-1042.096) [-1038.040] -- 0:00:52
159500 -- [-1038.563] (-1039.544) (-1039.569) (-1039.705) * (-1040.624) (-1039.066) [-1039.010] (-1038.637) -- 0:00:52
160000 -- (-1040.537) (-1038.019) (-1044.342) [-1039.133] * (-1040.615) (-1038.817) [-1038.967] (-1038.398) -- 0:00:52
Average standard deviation of split frequencies: 0.017278
160500 -- (-1039.376) (-1037.879) (-1041.643) [-1039.960] * (-1042.505) (-1041.545) [-1038.257] (-1039.934) -- 0:00:52
161000 -- (-1041.847) (-1040.492) [-1041.593] (-1040.486) * (-1042.311) [-1039.830] (-1038.835) (-1039.059) -- 0:00:52
161500 -- (-1038.804) (-1039.929) (-1041.560) [-1039.801] * (-1038.323) (-1038.059) (-1038.578) [-1039.022] -- 0:00:51
162000 -- (-1040.100) (-1041.747) (-1038.486) [-1039.094] * [-1038.550] (-1038.370) (-1039.930) (-1038.175) -- 0:00:51
162500 -- [-1039.056] (-1043.693) (-1041.705) (-1039.555) * (-1041.217) (-1039.992) [-1039.820] (-1037.899) -- 0:00:51
163000 -- (-1041.571) (-1041.586) [-1043.139] (-1040.276) * (-1042.276) (-1039.040) (-1041.041) [-1037.639] -- 0:00:56
163500 -- (-1039.211) (-1039.000) (-1040.661) [-1039.444] * (-1045.069) (-1039.349) [-1040.812] (-1038.595) -- 0:00:56
164000 -- (-1039.209) (-1042.048) (-1043.819) [-1040.646] * [-1039.733] (-1039.441) (-1039.287) (-1041.735) -- 0:00:56
164500 -- (-1038.736) (-1039.409) (-1040.825) [-1039.646] * (-1041.013) [-1038.853] (-1040.342) (-1039.628) -- 0:00:55
165000 -- (-1039.940) (-1038.885) (-1038.165) [-1039.300] * (-1040.286) [-1038.646] (-1042.430) (-1039.551) -- 0:00:55
Average standard deviation of split frequencies: 0.018932
165500 -- [-1040.337] (-1040.106) (-1041.621) (-1037.691) * [-1042.216] (-1040.558) (-1042.132) (-1039.850) -- 0:00:55
166000 -- [-1039.492] (-1046.461) (-1041.800) (-1039.446) * (-1038.912) (-1038.454) (-1039.517) [-1039.963] -- 0:00:55
166500 -- (-1046.385) (-1039.801) (-1041.869) [-1038.331] * (-1038.569) (-1040.065) [-1038.062] (-1040.446) -- 0:00:55
167000 -- (-1040.682) [-1038.716] (-1038.915) (-1038.277) * (-1040.150) (-1040.480) [-1044.642] (-1041.000) -- 0:00:54
167500 -- (-1039.084) (-1038.145) (-1041.487) [-1039.608] * (-1039.347) [-1040.702] (-1043.002) (-1039.299) -- 0:00:54
168000 -- (-1041.947) [-1038.627] (-1041.642) (-1039.132) * (-1041.710) (-1039.911) [-1040.478] (-1039.299) -- 0:00:54
168500 -- (-1041.703) (-1040.538) [-1039.114] (-1039.796) * (-1043.937) (-1039.519) [-1039.658] (-1040.169) -- 0:00:54
169000 -- (-1042.426) [-1040.688] (-1040.009) (-1038.347) * (-1040.606) (-1042.783) [-1040.597] (-1040.427) -- 0:00:54
169500 -- [-1042.420] (-1039.678) (-1041.778) (-1044.532) * (-1040.177) (-1043.190) (-1040.509) [-1039.728] -- 0:00:53
170000 -- (-1042.095) [-1041.968] (-1045.804) (-1042.538) * (-1038.131) (-1039.458) [-1040.258] (-1040.548) -- 0:00:53
Average standard deviation of split frequencies: 0.019181
170500 -- (-1044.569) (-1041.619) [-1040.962] (-1039.660) * (-1042.299) (-1039.599) (-1039.531) [-1040.013] -- 0:00:53
171000 -- (-1047.408) (-1042.016) [-1040.690] (-1042.651) * (-1039.910) [-1038.127] (-1039.904) (-1041.093) -- 0:00:53
171500 -- (-1040.991) [-1039.897] (-1039.683) (-1041.849) * [-1038.567] (-1038.592) (-1040.819) (-1040.402) -- 0:00:53
172000 -- (-1040.829) [-1039.859] (-1039.156) (-1040.582) * (-1041.993) (-1042.556) (-1043.062) [-1039.602] -- 0:00:52
172500 -- (-1038.209) [-1039.881] (-1040.771) (-1039.402) * [-1038.714] (-1040.896) (-1038.479) (-1045.154) -- 0:00:52
173000 -- [-1039.228] (-1040.389) (-1040.202) (-1041.004) * (-1039.008) [-1039.940] (-1038.245) (-1046.494) -- 0:00:52
173500 -- [-1038.632] (-1041.826) (-1040.700) (-1039.596) * (-1039.388) (-1038.767) [-1040.190] (-1047.826) -- 0:00:52
174000 -- (-1038.092) (-1041.002) [-1039.850] (-1045.720) * (-1040.978) [-1038.527] (-1040.421) (-1040.689) -- 0:00:52
174500 -- [-1038.408] (-1039.559) (-1037.893) (-1040.031) * (-1038.237) [-1038.631] (-1040.989) (-1042.366) -- 0:00:52
175000 -- (-1038.548) [-1038.096] (-1039.007) (-1040.296) * [-1038.008] (-1038.326) (-1042.698) (-1038.358) -- 0:00:51
Average standard deviation of split frequencies: 0.019493
175500 -- (-1038.705) [-1038.075] (-1038.624) (-1040.321) * (-1037.837) (-1040.742) (-1041.977) [-1038.484] -- 0:00:51
176000 -- (-1039.366) [-1038.410] (-1038.859) (-1038.894) * (-1042.795) (-1041.003) (-1043.901) [-1041.480] -- 0:00:51
176500 -- [-1040.261] (-1040.327) (-1038.264) (-1040.014) * (-1041.489) [-1041.834] (-1040.349) (-1038.675) -- 0:00:51
177000 -- (-1039.157) [-1040.043] (-1040.323) (-1040.814) * (-1041.473) (-1040.837) (-1039.358) [-1039.874] -- 0:00:51
177500 -- (-1038.091) (-1041.230) [-1038.333] (-1040.828) * (-1040.537) (-1039.944) [-1039.931] (-1045.688) -- 0:00:50
178000 -- (-1038.190) (-1040.688) (-1039.696) [-1041.251] * (-1041.866) (-1037.935) [-1037.953] (-1041.620) -- 0:00:50
178500 -- (-1038.284) (-1037.799) (-1044.850) [-1039.633] * [-1044.721] (-1041.771) (-1040.389) (-1043.997) -- 0:00:55
179000 -- (-1040.053) (-1040.710) (-1038.896) [-1041.480] * (-1041.276) (-1039.810) (-1044.396) [-1038.489] -- 0:00:55
179500 -- (-1039.019) (-1039.717) (-1040.769) [-1038.098] * (-1039.303) (-1039.436) [-1042.095] (-1043.751) -- 0:00:54
180000 -- [-1038.521] (-1041.633) (-1040.606) (-1039.444) * (-1040.569) (-1039.163) [-1039.483] (-1042.276) -- 0:00:54
Average standard deviation of split frequencies: 0.020050
180500 -- [-1038.595] (-1039.611) (-1040.069) (-1039.856) * [-1040.448] (-1040.392) (-1039.405) (-1038.770) -- 0:00:54
181000 -- (-1042.294) (-1038.922) [-1038.032] (-1042.135) * (-1040.992) (-1040.462) (-1042.669) [-1039.667] -- 0:00:54
181500 -- (-1041.422) (-1041.233) [-1038.426] (-1040.367) * (-1042.492) [-1040.518] (-1038.077) (-1039.048) -- 0:00:54
182000 -- [-1040.387] (-1039.151) (-1039.172) (-1047.524) * (-1044.025) (-1039.858) (-1039.912) [-1038.380] -- 0:00:53
182500 -- [-1040.815] (-1039.085) (-1038.276) (-1042.175) * (-1043.411) (-1044.285) (-1039.461) [-1040.118] -- 0:00:53
183000 -- [-1042.865] (-1038.665) (-1037.814) (-1040.369) * [-1041.341] (-1039.694) (-1039.404) (-1040.353) -- 0:00:53
183500 -- [-1042.467] (-1038.660) (-1039.006) (-1039.677) * (-1041.073) (-1041.614) [-1040.716] (-1039.021) -- 0:00:53
184000 -- [-1040.004] (-1040.239) (-1038.011) (-1039.376) * (-1040.874) (-1040.410) (-1039.448) [-1040.143] -- 0:00:53
184500 -- (-1041.790) [-1040.098] (-1040.878) (-1038.549) * (-1040.542) [-1040.714] (-1041.645) (-1038.437) -- 0:00:53
185000 -- (-1041.512) [-1039.626] (-1039.621) (-1041.963) * [-1041.439] (-1039.853) (-1038.806) (-1039.487) -- 0:00:52
Average standard deviation of split frequencies: 0.018942
185500 -- (-1042.382) (-1042.472) (-1038.782) [-1039.564] * [-1045.733] (-1038.216) (-1043.562) (-1038.546) -- 0:00:52
186000 -- (-1040.957) (-1047.629) (-1043.365) [-1037.749] * (-1042.889) [-1039.200] (-1039.615) (-1038.605) -- 0:00:52
186500 -- (-1039.399) (-1042.242) (-1041.435) [-1039.844] * (-1041.402) (-1039.544) [-1039.736] (-1042.612) -- 0:00:52
187000 -- [-1039.944] (-1041.917) (-1039.813) (-1040.194) * (-1039.784) (-1039.490) (-1038.449) [-1039.963] -- 0:00:52
187500 -- (-1039.505) (-1042.155) (-1039.191) [-1040.387] * (-1039.466) [-1039.230] (-1037.999) (-1038.473) -- 0:00:52
188000 -- (-1041.836) (-1045.927) (-1040.499) [-1039.644] * (-1042.027) (-1041.430) [-1039.739] (-1039.374) -- 0:00:51
188500 -- (-1042.120) (-1044.284) [-1038.706] (-1038.861) * (-1040.951) [-1043.933] (-1039.603) (-1041.199) -- 0:00:51
189000 -- [-1040.155] (-1041.381) (-1038.967) (-1038.646) * (-1039.623) [-1039.883] (-1041.179) (-1038.489) -- 0:00:51
189500 -- (-1040.106) (-1039.528) [-1040.685] (-1038.313) * [-1040.731] (-1040.256) (-1044.193) (-1038.527) -- 0:00:51
190000 -- (-1038.460) (-1040.815) (-1042.069) [-1043.163] * [-1041.479] (-1039.388) (-1041.172) (-1038.075) -- 0:00:51
Average standard deviation of split frequencies: 0.019389
190500 -- (-1039.927) (-1041.442) (-1041.966) [-1041.611] * (-1038.974) [-1039.575] (-1040.331) (-1038.400) -- 0:00:50
191000 -- (-1041.007) [-1042.767] (-1042.659) (-1041.722) * [-1040.244] (-1038.048) (-1038.809) (-1041.172) -- 0:00:50
191500 -- (-1040.305) [-1038.332] (-1039.164) (-1040.292) * (-1040.378) (-1038.045) [-1039.230] (-1041.535) -- 0:00:50
192000 -- [-1042.600] (-1038.358) (-1040.417) (-1041.646) * (-1039.530) [-1038.814] (-1042.758) (-1041.166) -- 0:00:50
192500 -- (-1042.918) (-1039.637) [-1038.096] (-1037.576) * [-1040.426] (-1044.403) (-1039.795) (-1041.611) -- 0:00:50
193000 -- (-1038.883) (-1038.132) [-1039.496] (-1039.460) * (-1040.895) [-1039.729] (-1038.855) (-1039.986) -- 0:00:50
193500 -- (-1042.181) [-1038.735] (-1038.189) (-1040.037) * [-1047.907] (-1040.763) (-1042.144) (-1039.411) -- 0:00:50
194000 -- [-1039.816] (-1038.053) (-1039.842) (-1040.309) * (-1047.578) (-1042.629) [-1038.313] (-1041.136) -- 0:00:49
194500 -- (-1041.694) (-1041.315) (-1038.755) [-1039.128] * (-1040.169) (-1040.595) [-1038.550] (-1041.197) -- 0:00:49
195000 -- (-1039.334) [-1038.476] (-1039.995) (-1039.956) * (-1041.762) [-1044.901] (-1039.354) (-1038.998) -- 0:00:53
Average standard deviation of split frequencies: 0.017722
195500 -- (-1038.411) (-1037.973) (-1044.977) [-1039.329] * (-1039.270) [-1041.961] (-1038.888) (-1039.654) -- 0:00:53
196000 -- (-1042.602) [-1039.760] (-1039.620) (-1038.815) * (-1039.031) (-1042.923) [-1042.528] (-1040.101) -- 0:00:53
196500 -- (-1041.907) (-1039.936) [-1038.180] (-1041.680) * (-1039.753) [-1041.508] (-1039.226) (-1040.000) -- 0:00:53
197000 -- (-1044.745) (-1040.598) (-1040.276) [-1041.760] * [-1042.050] (-1039.401) (-1039.439) (-1038.874) -- 0:00:52
197500 -- (-1049.680) (-1038.911) (-1039.556) [-1039.715] * (-1039.124) (-1039.228) (-1039.357) [-1040.243] -- 0:00:52
198000 -- (-1041.135) (-1042.060) (-1038.657) [-1041.584] * (-1037.893) (-1040.028) (-1039.379) [-1040.046] -- 0:00:52
198500 -- (-1039.237) [-1042.122] (-1038.805) (-1038.874) * (-1037.888) (-1039.177) [-1039.376] (-1039.146) -- 0:00:52
199000 -- (-1040.594) (-1040.716) [-1039.597] (-1039.355) * (-1038.521) (-1039.610) [-1038.877] (-1038.713) -- 0:00:52
199500 -- [-1040.535] (-1039.286) (-1040.562) (-1038.881) * (-1040.071) (-1038.425) (-1042.979) [-1038.737] -- 0:00:52
200000 -- [-1040.450] (-1047.716) (-1040.285) (-1041.043) * [-1039.271] (-1039.115) (-1039.404) (-1040.446) -- 0:00:51
Average standard deviation of split frequencies: 0.017681
200500 -- [-1039.393] (-1042.248) (-1039.247) (-1040.415) * (-1041.348) (-1039.558) (-1037.990) [-1039.006] -- 0:00:51
201000 -- (-1038.821) (-1040.593) [-1038.714] (-1040.937) * (-1041.419) (-1040.319) [-1040.070] (-1040.888) -- 0:00:51
201500 -- (-1039.312) (-1038.525) [-1038.455] (-1038.082) * [-1042.909] (-1039.893) (-1043.018) (-1040.455) -- 0:00:51
202000 -- (-1040.097) (-1038.558) [-1039.773] (-1038.085) * [-1043.183] (-1038.725) (-1037.861) (-1041.030) -- 0:00:51
202500 -- (-1039.048) (-1039.014) [-1038.849] (-1040.011) * (-1042.102) (-1039.042) [-1039.639] (-1040.001) -- 0:00:51
203000 -- (-1044.313) (-1038.841) (-1041.369) [-1039.899] * (-1044.888) [-1038.258] (-1037.983) (-1046.280) -- 0:00:51
203500 -- (-1043.722) (-1038.556) (-1041.009) [-1039.617] * (-1041.066) (-1040.089) [-1039.991] (-1044.713) -- 0:00:50
204000 -- (-1041.545) (-1039.185) (-1042.212) [-1041.977] * (-1040.995) (-1040.057) [-1038.934] (-1039.819) -- 0:00:50
204500 -- (-1040.244) [-1040.255] (-1044.918) (-1040.485) * (-1040.867) (-1043.601) [-1039.423] (-1041.157) -- 0:00:50
205000 -- [-1041.457] (-1039.102) (-1044.076) (-1038.756) * (-1044.293) (-1039.531) [-1041.707] (-1040.087) -- 0:00:50
Average standard deviation of split frequencies: 0.015891
205500 -- (-1039.099) (-1042.678) [-1041.385] (-1041.249) * (-1040.246) (-1040.585) [-1038.162] (-1045.104) -- 0:00:50
206000 -- (-1044.605) (-1045.516) (-1040.162) [-1038.222] * [-1040.644] (-1038.673) (-1037.839) (-1040.026) -- 0:00:50
206500 -- [-1039.352] (-1040.555) (-1040.507) (-1039.396) * (-1045.213) (-1043.840) (-1038.169) [-1040.775] -- 0:00:49
207000 -- (-1040.219) [-1038.765] (-1043.065) (-1043.506) * (-1045.036) [-1040.893] (-1039.614) (-1046.343) -- 0:00:49
207500 -- (-1041.024) (-1039.053) [-1039.701] (-1043.910) * (-1050.032) [-1038.560] (-1038.169) (-1039.446) -- 0:00:49
208000 -- (-1040.967) [-1039.590] (-1039.993) (-1040.560) * (-1045.343) [-1039.048] (-1038.457) (-1039.843) -- 0:00:49
208500 -- (-1041.267) (-1039.672) (-1041.733) [-1040.016] * (-1043.042) (-1041.680) (-1038.542) [-1039.547] -- 0:00:49
209000 -- (-1039.376) (-1039.730) [-1042.296] (-1039.542) * (-1041.316) (-1040.704) [-1039.393] (-1038.517) -- 0:00:49
209500 -- (-1038.748) [-1039.988] (-1037.949) (-1038.565) * (-1040.196) (-1040.705) (-1040.292) [-1039.102] -- 0:00:49
210000 -- [-1038.448] (-1038.456) (-1039.468) (-1038.379) * [-1040.306] (-1040.802) (-1037.891) (-1041.540) -- 0:00:48
Average standard deviation of split frequencies: 0.014918
210500 -- (-1040.449) (-1039.970) (-1037.726) [-1039.142] * (-1038.494) (-1041.939) (-1038.359) [-1039.440] -- 0:00:48
211000 -- (-1039.806) (-1039.698) [-1042.118] (-1041.489) * (-1043.037) (-1045.130) (-1040.864) [-1039.958] -- 0:00:48
211500 -- (-1041.544) (-1041.490) (-1048.443) [-1042.349] * (-1039.593) (-1037.960) [-1042.288] (-1038.919) -- 0:00:52
212000 -- (-1047.867) (-1041.772) (-1042.476) [-1038.721] * [-1038.347] (-1039.025) (-1038.597) (-1038.698) -- 0:00:52
212500 -- [-1040.518] (-1040.138) (-1043.888) (-1039.516) * (-1039.409) [-1038.474] (-1039.112) (-1041.804) -- 0:00:51
213000 -- (-1042.267) [-1043.142] (-1040.479) (-1037.989) * (-1048.234) [-1040.652] (-1038.608) (-1038.357) -- 0:00:51
213500 -- (-1042.184) [-1040.631] (-1039.042) (-1039.616) * (-1042.264) [-1038.303] (-1042.443) (-1040.757) -- 0:00:51
214000 -- (-1042.782) (-1041.808) [-1038.609] (-1039.970) * (-1042.476) (-1040.136) [-1040.025] (-1039.111) -- 0:00:51
214500 -- (-1039.501) [-1038.588] (-1040.151) (-1040.112) * (-1039.320) (-1038.517) [-1038.189] (-1041.167) -- 0:00:51
215000 -- (-1040.698) [-1038.301] (-1041.542) (-1042.245) * (-1040.140) [-1040.123] (-1038.911) (-1038.510) -- 0:00:51
Average standard deviation of split frequencies: 0.015883
215500 -- (-1041.926) (-1042.827) (-1039.244) [-1045.337] * [-1040.493] (-1040.145) (-1039.362) (-1041.898) -- 0:00:50
216000 -- (-1039.837) (-1038.518) [-1038.749] (-1039.000) * (-1042.722) (-1037.700) (-1039.970) [-1039.071] -- 0:00:50
216500 -- (-1041.008) (-1038.484) [-1038.982] (-1039.514) * (-1039.717) (-1038.337) [-1039.523] (-1039.381) -- 0:00:50
217000 -- (-1041.521) (-1039.732) [-1039.266] (-1039.714) * (-1041.973) [-1040.660] (-1049.585) (-1042.128) -- 0:00:50
217500 -- (-1044.803) (-1041.429) (-1040.791) [-1039.511] * [-1040.232] (-1039.397) (-1041.753) (-1039.511) -- 0:00:50
218000 -- (-1043.280) (-1039.992) [-1040.478] (-1038.087) * (-1041.267) (-1040.000) [-1040.005] (-1041.976) -- 0:00:50
218500 -- (-1040.127) (-1043.076) (-1041.949) [-1038.625] * [-1042.559] (-1038.947) (-1041.507) (-1039.993) -- 0:00:50
219000 -- (-1040.195) (-1039.811) (-1037.722) [-1041.022] * (-1041.053) (-1040.023) (-1043.702) [-1041.910] -- 0:00:49
219500 -- [-1038.725] (-1039.075) (-1038.904) (-1039.364) * (-1040.145) (-1041.097) (-1043.595) [-1040.895] -- 0:00:49
220000 -- [-1039.030] (-1043.995) (-1038.121) (-1038.782) * (-1043.835) (-1040.140) [-1039.130] (-1038.871) -- 0:00:49
Average standard deviation of split frequencies: 0.016497
220500 -- (-1040.648) (-1043.922) [-1039.026] (-1039.103) * [-1039.030] (-1040.380) (-1039.628) (-1041.284) -- 0:00:49
221000 -- [-1039.352] (-1038.994) (-1039.671) (-1040.327) * [-1041.164] (-1038.096) (-1043.023) (-1043.253) -- 0:00:49
221500 -- [-1040.715] (-1038.415) (-1041.970) (-1041.248) * (-1039.028) (-1040.401) [-1042.841] (-1038.794) -- 0:00:49
222000 -- (-1039.558) (-1038.473) (-1041.994) [-1040.131] * (-1039.130) (-1039.316) (-1043.083) [-1042.915] -- 0:00:49
222500 -- (-1039.221) (-1038.833) [-1038.677] (-1041.078) * (-1038.464) [-1038.918] (-1040.020) (-1044.306) -- 0:00:48
223000 -- [-1039.504] (-1038.096) (-1038.484) (-1040.317) * (-1038.246) [-1041.154] (-1040.985) (-1038.597) -- 0:00:48
223500 -- (-1040.432) [-1038.299] (-1038.621) (-1039.401) * (-1037.830) [-1038.194] (-1039.793) (-1042.243) -- 0:00:48
224000 -- (-1038.116) (-1038.518) (-1039.137) [-1039.531] * (-1038.186) [-1041.378] (-1041.935) (-1037.673) -- 0:00:48
224500 -- (-1043.581) (-1039.042) (-1039.844) [-1042.066] * (-1039.155) (-1040.666) [-1038.888] (-1038.342) -- 0:00:48
225000 -- [-1041.029] (-1039.213) (-1039.172) (-1039.384) * (-1038.548) (-1041.141) (-1039.196) [-1038.448] -- 0:00:48
Average standard deviation of split frequencies: 0.018657
225500 -- (-1041.947) (-1039.082) (-1040.084) [-1039.301] * [-1038.626] (-1043.135) (-1040.438) (-1040.369) -- 0:00:48
226000 -- (-1040.187) (-1038.909) [-1039.198] (-1038.786) * (-1037.961) [-1040.249] (-1038.466) (-1038.756) -- 0:00:47
226500 -- (-1038.365) (-1038.239) (-1039.848) [-1039.127] * (-1041.650) (-1043.658) (-1040.962) [-1039.855] -- 0:00:47
227000 -- (-1039.749) (-1037.684) [-1041.127] (-1040.619) * [-1041.139] (-1040.338) (-1040.129) (-1040.136) -- 0:00:47
227500 -- (-1039.737) (-1038.280) [-1040.639] (-1040.565) * (-1040.792) (-1040.230) (-1040.731) [-1039.981] -- 0:00:47
228000 -- (-1038.584) (-1042.220) [-1039.855] (-1041.833) * [-1039.280] (-1039.230) (-1040.675) (-1039.570) -- 0:00:50
228500 -- (-1039.155) (-1041.889) [-1040.055] (-1040.998) * (-1039.852) (-1039.578) [-1039.831] (-1040.157) -- 0:00:50
229000 -- (-1038.648) [-1039.319] (-1039.969) (-1040.986) * (-1038.855) [-1039.164] (-1039.788) (-1043.218) -- 0:00:50
229500 -- (-1039.923) (-1038.938) [-1039.951] (-1039.134) * (-1039.171) [-1039.508] (-1040.650) (-1040.974) -- 0:00:50
230000 -- (-1041.447) (-1040.328) [-1038.600] (-1042.324) * (-1040.114) [-1041.492] (-1040.942) (-1043.606) -- 0:00:50
Average standard deviation of split frequencies: 0.019528
230500 -- (-1041.850) [-1038.723] (-1042.153) (-1040.796) * [-1039.884] (-1040.065) (-1039.310) (-1041.326) -- 0:00:50
231000 -- [-1039.443] (-1039.365) (-1039.503) (-1037.909) * (-1041.314) (-1045.346) [-1038.145] (-1039.516) -- 0:00:49
231500 -- (-1040.741) (-1039.005) (-1040.435) [-1037.909] * [-1039.035] (-1038.639) (-1039.313) (-1038.825) -- 0:00:49
232000 -- (-1041.400) [-1039.366] (-1041.009) (-1040.026) * (-1038.955) (-1038.501) (-1046.875) [-1039.192] -- 0:00:49
232500 -- (-1041.852) (-1047.734) [-1039.739] (-1038.004) * (-1040.265) (-1042.710) [-1044.822] (-1040.404) -- 0:00:49
233000 -- (-1038.031) (-1038.163) (-1039.131) [-1039.775] * [-1043.271] (-1042.776) (-1039.915) (-1043.734) -- 0:00:49
233500 -- [-1038.934] (-1041.309) (-1040.088) (-1041.018) * (-1041.351) (-1043.347) [-1039.341] (-1042.453) -- 0:00:49
234000 -- (-1041.100) (-1040.787) [-1039.869] (-1038.596) * [-1042.760] (-1042.535) (-1039.074) (-1038.946) -- 0:00:49
234500 -- (-1042.056) [-1041.058] (-1044.721) (-1038.319) * (-1040.472) (-1040.444) (-1043.803) [-1042.285] -- 0:00:48
235000 -- (-1042.469) (-1041.372) [-1045.006] (-1038.321) * [-1041.451] (-1038.733) (-1040.985) (-1041.283) -- 0:00:48
Average standard deviation of split frequencies: 0.019870
235500 -- (-1038.781) (-1039.350) (-1041.795) [-1040.769] * (-1043.732) (-1039.378) (-1039.071) [-1040.136] -- 0:00:48
236000 -- [-1039.784] (-1039.051) (-1042.005) (-1041.517) * (-1040.159) (-1040.315) (-1038.167) [-1038.167] -- 0:00:48
236500 -- (-1040.632) (-1039.746) (-1039.547) [-1038.554] * (-1038.765) (-1039.145) [-1040.994] (-1038.217) -- 0:00:48
237000 -- (-1043.309) (-1039.692) (-1042.473) [-1039.925] * (-1039.751) (-1038.667) [-1043.225] (-1039.359) -- 0:00:48
237500 -- (-1041.389) (-1040.595) [-1040.940] (-1044.593) * (-1042.710) (-1038.025) [-1039.578] (-1040.058) -- 0:00:48
238000 -- (-1042.762) [-1040.048] (-1042.510) (-1046.252) * (-1044.371) [-1038.686] (-1039.036) (-1039.636) -- 0:00:48
238500 -- [-1039.345] (-1040.424) (-1039.393) (-1039.351) * (-1043.490) [-1037.915] (-1038.164) (-1038.202) -- 0:00:47
239000 -- [-1038.922] (-1039.730) (-1038.818) (-1040.347) * (-1039.427) (-1038.079) (-1041.179) [-1042.227] -- 0:00:47
239500 -- (-1039.391) [-1039.923] (-1038.734) (-1039.701) * [-1043.035] (-1038.774) (-1040.411) (-1038.914) -- 0:00:47
240000 -- (-1039.338) (-1039.315) (-1038.590) [-1040.301] * (-1043.592) [-1039.126] (-1040.351) (-1039.927) -- 0:00:47
Average standard deviation of split frequencies: 0.019805
240500 -- (-1039.605) [-1039.414] (-1039.744) (-1038.594) * (-1041.214) (-1039.126) [-1040.919] (-1041.055) -- 0:00:47
241000 -- [-1039.429] (-1038.185) (-1039.506) (-1040.067) * (-1039.645) (-1038.341) [-1039.645] (-1038.698) -- 0:00:47
241500 -- (-1040.713) [-1038.602] (-1039.153) (-1039.973) * (-1041.361) [-1042.293] (-1038.687) (-1039.126) -- 0:00:47
242000 -- (-1039.731) [-1038.784] (-1038.612) (-1038.963) * [-1038.198] (-1041.415) (-1040.205) (-1040.938) -- 0:00:46
242500 -- [-1041.094] (-1039.265) (-1039.686) (-1039.342) * (-1041.924) [-1041.416] (-1038.988) (-1046.077) -- 0:00:46
243000 -- (-1038.302) [-1039.232] (-1039.102) (-1043.410) * (-1038.267) (-1039.014) (-1043.723) [-1038.954] -- 0:00:46
243500 -- (-1038.502) (-1038.299) [-1039.729] (-1042.949) * (-1038.166) [-1040.294] (-1043.534) (-1038.124) -- 0:00:46
244000 -- [-1038.591] (-1038.191) (-1038.651) (-1039.785) * [-1041.181] (-1043.010) (-1040.218) (-1043.264) -- 0:00:46
244500 -- (-1041.306) (-1038.135) [-1038.766] (-1037.932) * (-1041.389) (-1041.818) (-1041.342) [-1042.799] -- 0:00:49
245000 -- (-1042.044) [-1039.723] (-1038.953) (-1039.655) * (-1039.623) [-1040.477] (-1041.537) (-1039.656) -- 0:00:49
Average standard deviation of split frequencies: 0.020440
245500 -- (-1042.317) (-1039.510) (-1038.343) [-1039.083] * (-1040.328) [-1043.382] (-1039.807) (-1039.075) -- 0:00:49
246000 -- (-1041.982) (-1039.511) [-1038.789] (-1038.529) * (-1041.573) (-1041.210) (-1040.496) [-1038.597] -- 0:00:49
246500 -- [-1039.696] (-1040.052) (-1041.221) (-1042.623) * (-1042.194) (-1045.051) [-1039.647] (-1038.747) -- 0:00:48
247000 -- (-1040.288) [-1038.898] (-1040.879) (-1041.446) * (-1046.832) (-1038.658) [-1038.777] (-1040.719) -- 0:00:48
247500 -- (-1038.939) (-1038.607) (-1038.953) [-1039.444] * (-1039.499) [-1038.084] (-1040.971) (-1041.623) -- 0:00:48
248000 -- (-1039.245) (-1039.365) (-1041.960) [-1038.448] * [-1039.079] (-1038.880) (-1040.346) (-1040.072) -- 0:00:48
248500 -- [-1039.532] (-1039.725) (-1041.670) (-1038.619) * (-1040.580) [-1042.349] (-1041.492) (-1042.472) -- 0:00:48
249000 -- [-1043.172] (-1039.617) (-1048.500) (-1038.535) * (-1038.547) [-1041.801] (-1039.884) (-1041.567) -- 0:00:48
249500 -- (-1046.306) [-1038.003] (-1042.221) (-1038.294) * (-1041.535) [-1040.380] (-1039.315) (-1038.746) -- 0:00:48
250000 -- (-1042.574) (-1038.603) [-1040.891] (-1040.093) * [-1038.813] (-1038.345) (-1039.096) (-1039.099) -- 0:00:48
Average standard deviation of split frequencies: 0.020269
250500 -- (-1045.334) [-1038.971] (-1040.376) (-1039.669) * (-1039.343) [-1038.927] (-1041.654) (-1040.802) -- 0:00:47
251000 -- (-1042.014) (-1040.170) (-1040.610) [-1040.501] * [-1039.327] (-1041.227) (-1042.468) (-1046.012) -- 0:00:47
251500 -- (-1039.122) [-1038.724] (-1038.412) (-1040.759) * (-1038.421) (-1039.647) (-1045.290) [-1041.133] -- 0:00:47
252000 -- (-1038.565) (-1039.813) [-1039.154] (-1040.235) * (-1041.595) (-1039.648) [-1043.814] (-1041.786) -- 0:00:47
252500 -- (-1038.306) [-1040.979] (-1042.451) (-1040.249) * (-1041.686) (-1038.350) (-1042.127) [-1038.494] -- 0:00:47
253000 -- (-1038.246) (-1039.054) (-1041.495) [-1039.741] * (-1043.323) (-1039.797) [-1039.197] (-1039.603) -- 0:00:47
253500 -- (-1038.255) (-1038.466) [-1045.376] (-1039.623) * (-1038.589) (-1038.542) (-1039.889) [-1039.376] -- 0:00:47
254000 -- (-1041.475) [-1038.174] (-1046.552) (-1043.210) * (-1038.589) (-1039.039) (-1041.526) [-1038.653] -- 0:00:46
254500 -- [-1041.396] (-1039.275) (-1048.376) (-1045.675) * (-1040.243) (-1042.639) (-1039.824) [-1039.280] -- 0:00:46
255000 -- [-1044.431] (-1041.307) (-1040.103) (-1041.253) * (-1039.341) (-1039.224) (-1038.940) [-1040.729] -- 0:00:46
Average standard deviation of split frequencies: 0.019949
255500 -- [-1041.611] (-1039.750) (-1037.647) (-1039.012) * (-1041.980) (-1040.872) [-1038.197] (-1039.453) -- 0:00:46
256000 -- (-1041.158) [-1039.525] (-1038.925) (-1042.605) * (-1043.281) [-1040.048] (-1040.468) (-1040.131) -- 0:00:46
256500 -- (-1042.824) [-1040.347] (-1038.757) (-1038.108) * [-1039.777] (-1039.207) (-1038.734) (-1041.233) -- 0:00:46
257000 -- [-1041.364] (-1038.978) (-1038.651) (-1038.334) * (-1043.259) (-1039.052) (-1040.111) [-1040.326] -- 0:00:46
257500 -- [-1038.318] (-1038.883) (-1039.086) (-1040.084) * (-1047.407) (-1042.896) (-1039.946) [-1040.311] -- 0:00:46
258000 -- (-1038.934) (-1041.450) (-1040.271) [-1039.613] * (-1042.075) [-1040.292] (-1041.084) (-1041.587) -- 0:00:46
258500 -- (-1040.286) [-1040.257] (-1038.373) (-1041.307) * [-1041.082] (-1042.247) (-1038.033) (-1047.242) -- 0:00:45
259000 -- [-1038.760] (-1042.585) (-1038.854) (-1039.714) * (-1041.715) (-1040.255) [-1042.471] (-1042.438) -- 0:00:45
259500 -- (-1040.294) [-1038.229] (-1038.598) (-1039.816) * (-1039.928) (-1041.375) [-1041.542] (-1039.527) -- 0:00:45
260000 -- [-1039.564] (-1039.175) (-1038.552) (-1038.711) * (-1039.363) (-1041.544) [-1043.058] (-1039.266) -- 0:00:45
Average standard deviation of split frequencies: 0.020496
260500 -- [-1042.546] (-1040.942) (-1040.415) (-1038.106) * (-1038.994) (-1043.371) [-1038.982] (-1042.464) -- 0:00:45
261000 -- (-1039.110) (-1039.891) (-1043.222) [-1038.307] * (-1039.200) [-1041.581] (-1039.828) (-1043.544) -- 0:00:48
261500 -- (-1038.956) (-1040.321) (-1040.976) [-1038.930] * (-1043.866) [-1041.502] (-1038.880) (-1039.925) -- 0:00:48
262000 -- (-1040.463) [-1040.770] (-1042.462) (-1042.210) * [-1038.523] (-1040.702) (-1040.421) (-1042.189) -- 0:00:47
262500 -- (-1041.996) (-1041.666) [-1038.072] (-1038.835) * [-1040.341] (-1040.950) (-1040.379) (-1041.919) -- 0:00:47
263000 -- (-1039.056) [-1039.347] (-1039.311) (-1040.816) * (-1040.703) (-1040.595) (-1040.578) [-1037.981] -- 0:00:47
263500 -- (-1038.467) [-1038.826] (-1041.424) (-1037.984) * [-1041.291] (-1045.136) (-1041.120) (-1037.981) -- 0:00:47
264000 -- (-1042.205) (-1041.617) (-1040.477) [-1038.303] * (-1042.874) (-1041.904) (-1041.105) [-1039.954] -- 0:00:47
264500 -- (-1040.682) (-1043.840) [-1039.493] (-1039.551) * (-1041.246) [-1045.736] (-1040.821) (-1040.251) -- 0:00:47
265000 -- (-1039.571) (-1040.515) (-1039.416) [-1039.893] * (-1039.876) [-1047.051] (-1039.563) (-1040.634) -- 0:00:47
Average standard deviation of split frequencies: 0.019593
265500 -- (-1041.825) (-1041.633) [-1038.263] (-1040.235) * (-1040.457) (-1041.197) [-1044.904] (-1039.867) -- 0:00:47
266000 -- (-1042.064) [-1040.045] (-1038.377) (-1041.008) * [-1038.834] (-1042.294) (-1039.200) (-1044.636) -- 0:00:46
266500 -- (-1040.165) (-1040.132) (-1042.393) [-1039.454] * (-1040.649) [-1041.102] (-1041.069) (-1039.415) -- 0:00:46
267000 -- (-1044.038) (-1039.842) [-1040.290] (-1046.946) * (-1040.803) [-1038.712] (-1038.615) (-1038.100) -- 0:00:46
267500 -- (-1038.585) [-1040.607] (-1041.062) (-1040.477) * (-1040.600) [-1039.536] (-1041.320) (-1040.939) -- 0:00:46
268000 -- (-1039.867) (-1040.299) [-1038.760] (-1040.832) * (-1040.633) (-1039.140) [-1039.861] (-1039.059) -- 0:00:46
268500 -- (-1040.313) (-1042.110) (-1040.635) [-1038.104] * [-1040.067] (-1039.463) (-1038.623) (-1038.126) -- 0:00:46
269000 -- (-1044.246) [-1041.731] (-1038.262) (-1038.492) * (-1041.482) [-1040.502] (-1037.774) (-1039.247) -- 0:00:46
269500 -- (-1041.861) (-1043.810) (-1039.497) [-1037.774] * (-1040.626) [-1039.963] (-1039.801) (-1039.332) -- 0:00:46
270000 -- [-1038.844] (-1039.489) (-1040.499) (-1037.768) * (-1039.698) (-1039.215) (-1041.641) [-1038.524] -- 0:00:45
Average standard deviation of split frequencies: 0.019061
270500 -- (-1040.293) [-1037.843] (-1043.529) (-1038.377) * [-1038.442] (-1041.917) (-1040.732) (-1040.565) -- 0:00:45
271000 -- (-1040.587) [-1038.633] (-1040.655) (-1043.699) * (-1037.907) (-1046.158) [-1039.452] (-1038.744) -- 0:00:45
271500 -- (-1038.671) (-1043.078) (-1037.802) [-1039.937] * (-1037.900) (-1042.415) (-1041.971) [-1038.530] -- 0:00:45
272000 -- (-1041.685) (-1042.985) [-1039.258] (-1037.979) * [-1038.208] (-1040.878) (-1045.361) (-1042.212) -- 0:00:45
272500 -- (-1040.849) (-1040.133) (-1039.066) [-1040.743] * (-1038.585) (-1040.650) [-1041.931] (-1040.852) -- 0:00:45
273000 -- (-1042.170) (-1042.581) (-1039.226) [-1041.501] * [-1038.933] (-1040.739) (-1040.551) (-1038.790) -- 0:00:45
273500 -- (-1042.176) (-1042.129) [-1037.803] (-1040.576) * (-1039.002) [-1039.271] (-1041.551) (-1040.296) -- 0:00:45
274000 -- (-1040.162) (-1043.025) (-1038.223) [-1039.452] * (-1038.840) (-1041.398) (-1040.166) [-1038.314] -- 0:00:45
274500 -- (-1043.950) (-1042.425) (-1039.287) [-1038.665] * (-1038.692) (-1041.431) [-1038.779] (-1040.471) -- 0:00:44
275000 -- [-1039.184] (-1040.524) (-1041.613) (-1038.270) * (-1039.940) (-1038.795) [-1039.246] (-1043.558) -- 0:00:44
Average standard deviation of split frequencies: 0.020306
275500 -- [-1041.749] (-1041.990) (-1038.777) (-1038.302) * (-1041.159) [-1038.219] (-1040.948) (-1042.920) -- 0:00:44
276000 -- (-1039.538) (-1043.127) (-1038.815) [-1040.575] * [-1038.642] (-1043.885) (-1040.502) (-1044.505) -- 0:00:44
276500 -- (-1039.527) (-1040.761) [-1038.726] (-1041.252) * (-1037.968) (-1045.218) (-1042.476) [-1046.914] -- 0:00:44
277000 -- [-1039.622] (-1041.278) (-1040.352) (-1040.837) * (-1037.734) (-1040.368) [-1040.847] (-1041.221) -- 0:00:44
277500 -- (-1040.851) (-1040.631) (-1038.943) [-1042.697] * (-1039.343) (-1039.069) [-1041.726] (-1041.448) -- 0:00:46
278000 -- (-1040.910) (-1039.603) (-1041.323) [-1039.156] * (-1039.526) (-1041.291) [-1040.009] (-1040.467) -- 0:00:46
278500 -- (-1037.939) [-1048.465] (-1040.659) (-1038.289) * (-1041.277) (-1041.123) [-1038.827] (-1039.865) -- 0:00:46
279000 -- (-1040.034) (-1043.747) [-1039.734] (-1038.577) * (-1039.956) (-1039.710) (-1038.899) [-1040.179] -- 0:00:46
279500 -- [-1038.616] (-1042.350) (-1039.625) (-1040.643) * (-1039.592) (-1039.610) [-1038.836] (-1037.758) -- 0:00:46
280000 -- (-1039.221) (-1041.239) [-1039.844] (-1038.788) * (-1040.133) (-1039.339) [-1038.890] (-1038.703) -- 0:00:46
Average standard deviation of split frequencies: 0.019875
280500 -- (-1038.627) (-1040.189) [-1040.236] (-1038.039) * (-1041.640) (-1040.635) [-1040.815] (-1038.631) -- 0:00:46
281000 -- (-1039.487) (-1038.344) (-1040.237) [-1039.395] * [-1041.326] (-1038.010) (-1038.319) (-1038.176) -- 0:00:46
281500 -- (-1039.588) [-1038.134] (-1041.215) (-1038.661) * (-1039.971) (-1038.623) (-1038.111) [-1040.724] -- 0:00:45
282000 -- (-1038.055) (-1037.994) (-1040.820) [-1039.358] * (-1041.650) (-1038.158) (-1040.087) [-1046.257] -- 0:00:45
282500 -- [-1038.521] (-1037.790) (-1040.839) (-1038.804) * (-1041.120) (-1041.912) [-1043.013] (-1042.774) -- 0:00:45
283000 -- [-1041.144] (-1048.476) (-1042.950) (-1038.609) * (-1041.194) (-1040.140) (-1040.634) [-1039.568] -- 0:00:45
283500 -- (-1041.490) (-1039.836) [-1038.970] (-1039.095) * (-1040.227) (-1042.855) (-1040.331) [-1039.568] -- 0:00:45
284000 -- (-1041.779) (-1039.382) [-1039.109] (-1037.967) * [-1039.501] (-1038.961) (-1039.675) (-1039.899) -- 0:00:45
284500 -- [-1040.290] (-1041.190) (-1038.049) (-1040.876) * (-1043.080) (-1044.465) (-1038.901) [-1039.380] -- 0:00:45
285000 -- (-1039.945) [-1040.277] (-1041.155) (-1038.424) * (-1041.216) (-1040.132) (-1040.746) [-1042.010] -- 0:00:45
Average standard deviation of split frequencies: 0.019230
285500 -- (-1038.138) [-1040.477] (-1040.588) (-1038.468) * (-1040.489) [-1038.274] (-1040.430) (-1041.293) -- 0:00:45
286000 -- (-1041.098) [-1040.605] (-1042.462) (-1039.553) * (-1038.914) (-1037.979) (-1038.374) [-1039.015] -- 0:00:44
286500 -- (-1040.193) (-1039.795) (-1040.524) [-1042.633] * (-1043.255) [-1040.729] (-1039.237) (-1038.415) -- 0:00:44
287000 -- (-1043.695) (-1038.304) (-1042.394) [-1039.190] * (-1039.086) [-1038.655] (-1039.432) (-1044.487) -- 0:00:44
287500 -- (-1039.313) (-1039.745) [-1037.933] (-1039.305) * (-1046.588) (-1038.700) (-1040.741) [-1039.829] -- 0:00:44
288000 -- (-1038.354) (-1039.461) [-1037.859] (-1039.572) * (-1038.706) [-1038.914] (-1043.459) (-1041.342) -- 0:00:44
288500 -- [-1038.648] (-1039.679) (-1039.190) (-1041.483) * [-1040.655] (-1041.886) (-1039.278) (-1042.299) -- 0:00:44
289000 -- (-1038.760) (-1039.078) [-1040.853] (-1038.027) * [-1040.541] (-1045.744) (-1040.721) (-1043.958) -- 0:00:44
289500 -- (-1039.449) (-1038.621) [-1042.716] (-1037.955) * (-1040.115) (-1041.908) [-1041.645] (-1041.609) -- 0:00:44
290000 -- [-1039.028] (-1040.920) (-1043.007) (-1041.433) * (-1040.067) (-1042.779) [-1039.841] (-1044.443) -- 0:00:44
Average standard deviation of split frequencies: 0.017299
290500 -- [-1039.459] (-1039.278) (-1044.450) (-1040.711) * (-1042.304) [-1039.643] (-1041.939) (-1038.960) -- 0:00:43
291000 -- [-1038.716] (-1039.608) (-1045.268) (-1040.261) * [-1039.016] (-1038.104) (-1042.875) (-1037.968) -- 0:00:43
291500 -- (-1040.317) (-1039.544) (-1043.964) [-1040.942] * [-1038.152] (-1039.808) (-1041.038) (-1039.855) -- 0:00:43
292000 -- [-1039.117] (-1038.788) (-1046.721) (-1038.012) * [-1038.094] (-1039.900) (-1039.485) (-1042.824) -- 0:00:43
292500 -- [-1037.856] (-1040.123) (-1040.036) (-1039.421) * (-1039.921) (-1041.158) (-1039.123) [-1041.339] -- 0:00:43
293000 -- (-1042.163) (-1040.222) [-1040.706] (-1039.418) * (-1038.764) [-1040.573] (-1039.375) (-1041.578) -- 0:00:43
293500 -- (-1040.832) [-1038.841] (-1038.625) (-1039.106) * (-1039.421) (-1039.850) (-1039.530) [-1041.539] -- 0:00:43
294000 -- (-1040.265) [-1038.555] (-1039.177) (-1040.185) * [-1039.847] (-1042.887) (-1040.029) (-1038.022) -- 0:00:45
294500 -- [-1038.294] (-1038.910) (-1042.721) (-1040.092) * (-1042.463) (-1043.723) (-1043.570) [-1042.547] -- 0:00:45
295000 -- (-1039.631) (-1039.001) [-1041.508] (-1038.483) * (-1041.809) (-1040.821) (-1044.902) [-1041.224] -- 0:00:45
Average standard deviation of split frequencies: 0.018138
295500 -- (-1044.388) (-1040.082) (-1042.686) [-1038.599] * (-1038.820) (-1039.779) (-1039.983) [-1037.837] -- 0:00:45
296000 -- [-1038.984] (-1039.403) (-1040.924) (-1038.482) * (-1037.988) (-1045.095) (-1039.080) [-1043.391] -- 0:00:45
296500 -- (-1040.440) (-1043.978) (-1039.728) [-1038.336] * (-1038.993) (-1038.574) [-1040.403] (-1044.297) -- 0:00:45
297000 -- (-1039.730) (-1037.892) (-1039.935) [-1040.985] * [-1038.560] (-1038.871) (-1043.698) (-1043.714) -- 0:00:44
297500 -- (-1039.971) (-1040.164) (-1039.872) [-1040.672] * (-1038.474) [-1046.467] (-1042.868) (-1039.752) -- 0:00:44
298000 -- (-1037.801) (-1043.734) (-1039.064) [-1042.127] * (-1038.630) [-1040.320] (-1040.299) (-1041.785) -- 0:00:44
298500 -- (-1039.185) [-1041.111] (-1038.746) (-1039.397) * (-1037.994) [-1039.338] (-1039.919) (-1041.660) -- 0:00:44
299000 -- [-1040.205] (-1042.925) (-1038.275) (-1040.851) * [-1039.023] (-1039.754) (-1039.610) (-1038.552) -- 0:00:44
299500 -- [-1038.488] (-1041.991) (-1038.649) (-1038.432) * [-1038.334] (-1042.235) (-1038.350) (-1039.960) -- 0:00:44
300000 -- [-1043.666] (-1041.167) (-1038.681) (-1041.689) * [-1044.601] (-1041.459) (-1038.091) (-1043.383) -- 0:00:44
Average standard deviation of split frequencies: 0.017412
300500 -- (-1039.693) (-1038.780) (-1041.022) [-1041.441] * [-1040.697] (-1043.296) (-1042.232) (-1040.651) -- 0:00:44
301000 -- [-1040.714] (-1040.412) (-1043.234) (-1043.682) * [-1038.260] (-1043.331) (-1038.084) (-1040.815) -- 0:00:44
301500 -- (-1040.466) (-1040.170) (-1042.174) [-1042.004] * (-1040.724) (-1043.653) [-1037.911] (-1040.576) -- 0:00:44
302000 -- (-1043.163) (-1041.697) [-1039.136] (-1039.412) * [-1043.798] (-1041.125) (-1041.356) (-1041.814) -- 0:00:43
302500 -- (-1039.531) (-1041.511) (-1039.057) [-1039.421] * (-1047.409) (-1042.792) [-1039.943] (-1040.758) -- 0:00:43
303000 -- (-1040.715) (-1039.241) [-1039.152] (-1042.470) * [-1043.930] (-1041.804) (-1040.963) (-1038.008) -- 0:00:43
303500 -- [-1038.406] (-1039.173) (-1039.488) (-1041.631) * [-1041.337] (-1038.793) (-1040.955) (-1038.121) -- 0:00:43
304000 -- (-1040.526) (-1040.945) [-1039.215] (-1038.709) * (-1041.286) (-1038.402) (-1042.845) [-1039.634] -- 0:00:43
304500 -- (-1038.254) [-1041.530] (-1038.704) (-1039.405) * (-1041.483) (-1038.978) (-1039.753) [-1040.601] -- 0:00:43
305000 -- (-1038.776) (-1039.890) [-1039.928] (-1041.893) * (-1039.461) [-1039.437] (-1038.616) (-1038.644) -- 0:00:43
Average standard deviation of split frequencies: 0.018081
305500 -- (-1041.198) (-1039.327) [-1038.612] (-1041.778) * (-1039.744) (-1046.570) [-1039.143] (-1039.335) -- 0:00:43
306000 -- (-1037.934) (-1038.495) [-1043.714] (-1048.496) * (-1040.033) [-1040.928] (-1040.500) (-1040.996) -- 0:00:43
306500 -- [-1038.740] (-1038.836) (-1039.290) (-1045.869) * (-1041.196) (-1039.150) [-1038.642] (-1041.211) -- 0:00:42
307000 -- (-1037.807) [-1041.075] (-1039.856) (-1040.809) * (-1040.416) (-1039.201) [-1044.362] (-1038.997) -- 0:00:42
307500 -- (-1040.715) (-1040.106) [-1039.685] (-1039.211) * (-1039.595) [-1040.513] (-1040.163) (-1042.166) -- 0:00:42
308000 -- [-1040.851] (-1039.756) (-1039.285) (-1041.053) * (-1040.510) (-1039.870) [-1042.208] (-1041.958) -- 0:00:42
308500 -- [-1039.567] (-1040.255) (-1039.674) (-1041.407) * (-1042.132) (-1039.010) (-1041.911) [-1037.894] -- 0:00:42
309000 -- (-1038.761) (-1039.849) (-1042.698) [-1039.825] * (-1039.324) (-1039.496) [-1038.154] (-1039.965) -- 0:00:42
309500 -- (-1041.178) (-1039.068) (-1044.845) [-1044.404] * (-1039.354) [-1039.850] (-1039.428) (-1038.955) -- 0:00:42
310000 -- (-1038.852) (-1043.706) (-1039.290) [-1040.233] * (-1040.276) (-1040.116) [-1039.400] (-1042.001) -- 0:00:42
Average standard deviation of split frequencies: 0.018368
310500 -- (-1041.140) (-1038.987) (-1040.739) [-1040.618] * (-1039.131) [-1038.703] (-1044.991) (-1039.636) -- 0:00:44
311000 -- (-1040.518) (-1039.127) [-1037.786] (-1039.061) * [-1039.830] (-1038.267) (-1039.006) (-1043.657) -- 0:00:44
311500 -- (-1040.330) (-1040.603) (-1038.561) [-1038.676] * [-1038.513] (-1039.202) (-1037.959) (-1038.112) -- 0:00:44
312000 -- (-1039.041) (-1040.165) [-1040.054] (-1040.273) * [-1041.985] (-1039.038) (-1039.438) (-1039.531) -- 0:00:44
312500 -- [-1042.519] (-1039.583) (-1039.626) (-1039.317) * (-1041.358) [-1040.571] (-1042.207) (-1039.471) -- 0:00:44
313000 -- (-1039.030) (-1040.489) (-1040.356) [-1042.385] * (-1039.168) (-1038.439) [-1038.069] (-1039.903) -- 0:00:43
313500 -- (-1041.609) [-1045.138] (-1041.527) (-1041.852) * (-1039.530) (-1041.059) (-1041.348) [-1039.472] -- 0:00:43
314000 -- (-1041.480) (-1042.854) [-1040.977] (-1039.845) * (-1039.612) (-1041.892) (-1042.130) [-1041.649] -- 0:00:43
314500 -- (-1041.618) [-1040.267] (-1040.306) (-1040.072) * (-1039.440) (-1040.363) [-1038.691] (-1040.002) -- 0:00:43
315000 -- (-1042.536) (-1039.672) [-1039.948] (-1038.471) * [-1039.782] (-1040.947) (-1040.808) (-1038.467) -- 0:00:43
Average standard deviation of split frequencies: 0.018564
315500 -- (-1046.610) [-1040.918] (-1039.392) (-1038.568) * (-1040.607) [-1040.320] (-1039.563) (-1041.106) -- 0:00:43
316000 -- (-1042.379) (-1040.658) (-1037.850) [-1038.917] * [-1040.188] (-1038.197) (-1040.587) (-1039.907) -- 0:00:43
316500 -- (-1038.186) (-1038.126) (-1038.081) [-1040.621] * [-1041.049] (-1039.836) (-1038.402) (-1044.312) -- 0:00:43
317000 -- [-1038.345] (-1039.355) (-1038.471) (-1041.380) * (-1039.356) [-1044.053] (-1039.581) (-1041.753) -- 0:00:43
317500 -- (-1045.228) (-1038.536) [-1040.327] (-1038.568) * (-1042.245) (-1039.757) [-1042.298] (-1040.574) -- 0:00:42
318000 -- [-1043.089] (-1039.290) (-1045.258) (-1041.961) * (-1041.500) (-1037.678) (-1041.281) [-1040.503] -- 0:00:42
318500 -- (-1042.336) (-1039.478) [-1043.206] (-1044.287) * (-1039.068) (-1039.711) (-1041.471) [-1037.830] -- 0:00:42
319000 -- (-1041.357) (-1039.904) [-1040.726] (-1042.881) * (-1040.050) (-1043.027) [-1040.575] (-1039.113) -- 0:00:42
319500 -- [-1040.063] (-1039.755) (-1044.233) (-1041.917) * [-1039.872] (-1042.743) (-1041.253) (-1039.122) -- 0:00:42
320000 -- [-1038.322] (-1038.843) (-1042.717) (-1041.101) * (-1039.482) [-1039.037] (-1041.250) (-1038.625) -- 0:00:42
Average standard deviation of split frequencies: 0.018703
320500 -- (-1040.548) (-1039.466) [-1039.832] (-1040.539) * (-1041.347) (-1038.724) [-1039.365] (-1038.305) -- 0:00:42
321000 -- [-1038.771] (-1040.390) (-1039.465) (-1039.679) * (-1041.563) (-1039.478) [-1039.115] (-1041.718) -- 0:00:42
321500 -- (-1038.265) (-1038.560) [-1038.690] (-1038.659) * (-1041.710) (-1040.698) [-1038.867] (-1042.993) -- 0:00:42
322000 -- (-1038.107) [-1038.702] (-1038.124) (-1039.963) * (-1038.306) (-1038.698) [-1039.879] (-1041.552) -- 0:00:42
322500 -- (-1039.148) (-1039.261) [-1039.669] (-1044.050) * [-1039.653] (-1040.250) (-1043.127) (-1045.309) -- 0:00:42
323000 -- (-1040.362) [-1041.838] (-1038.554) (-1045.504) * (-1041.272) (-1040.335) [-1038.526] (-1042.224) -- 0:00:41
323500 -- (-1040.122) (-1040.211) (-1039.996) [-1046.524] * (-1040.413) (-1038.907) (-1039.019) [-1041.429] -- 0:00:41
324000 -- (-1039.060) [-1042.923] (-1038.734) (-1039.593) * (-1039.326) (-1040.113) [-1038.653] (-1044.580) -- 0:00:41
324500 -- (-1039.241) (-1040.550) [-1038.334] (-1038.298) * [-1038.222] (-1038.936) (-1038.993) (-1037.984) -- 0:00:41
325000 -- (-1039.509) (-1037.891) (-1040.050) [-1040.982] * (-1038.399) (-1039.290) (-1039.276) [-1041.077] -- 0:00:41
Average standard deviation of split frequencies: 0.018718
325500 -- (-1038.540) [-1037.911] (-1043.365) (-1040.536) * (-1041.328) (-1038.767) [-1039.333] (-1040.964) -- 0:00:41
326000 -- (-1039.608) [-1037.905] (-1038.348) (-1043.151) * (-1038.754) (-1038.424) (-1042.318) [-1038.688] -- 0:00:41
326500 -- (-1041.602) (-1038.369) (-1041.331) [-1041.645] * (-1040.857) (-1038.238) (-1038.608) [-1038.583] -- 0:00:43
327000 -- (-1039.709) (-1039.199) (-1046.162) [-1040.013] * (-1040.079) [-1038.923] (-1044.701) (-1040.408) -- 0:00:43
327500 -- (-1039.215) [-1038.747] (-1044.248) (-1038.173) * (-1039.193) [-1040.841] (-1042.254) (-1038.671) -- 0:00:43
328000 -- (-1044.391) (-1043.305) (-1041.558) [-1040.375] * [-1039.310] (-1040.329) (-1041.317) (-1038.315) -- 0:00:43
328500 -- (-1039.602) (-1039.329) [-1038.135] (-1040.047) * (-1039.911) [-1040.012] (-1039.351) (-1038.586) -- 0:00:42
329000 -- (-1040.731) (-1038.479) [-1038.235] (-1042.375) * (-1039.363) (-1041.137) [-1038.357] (-1040.852) -- 0:00:42
329500 -- (-1042.582) (-1041.078) [-1038.835] (-1041.923) * [-1039.874] (-1041.926) (-1038.502) (-1040.217) -- 0:00:42
330000 -- (-1046.479) [-1040.891] (-1038.181) (-1041.358) * [-1038.362] (-1041.753) (-1038.620) (-1040.324) -- 0:00:42
Average standard deviation of split frequencies: 0.018375
330500 -- (-1040.056) (-1040.097) [-1038.417] (-1040.097) * [-1038.144] (-1041.943) (-1040.677) (-1043.312) -- 0:00:42
331000 -- (-1045.012) (-1041.458) (-1042.913) [-1038.965] * [-1037.614] (-1040.949) (-1039.886) (-1039.712) -- 0:00:42
331500 -- [-1040.588] (-1040.710) (-1041.322) (-1040.464) * [-1039.444] (-1047.083) (-1042.688) (-1038.939) -- 0:00:42
332000 -- (-1038.844) (-1040.160) [-1038.662] (-1041.017) * [-1038.543] (-1039.692) (-1041.449) (-1039.560) -- 0:00:42
332500 -- (-1040.393) [-1038.422] (-1039.726) (-1041.607) * (-1037.723) (-1039.573) [-1040.050] (-1038.137) -- 0:00:42
333000 -- [-1042.337] (-1039.204) (-1041.087) (-1041.471) * [-1040.624] (-1037.667) (-1039.154) (-1042.833) -- 0:00:42
333500 -- (-1038.280) (-1039.826) (-1041.060) [-1041.423] * (-1039.538) [-1038.455] (-1038.641) (-1040.043) -- 0:00:41
334000 -- (-1039.532) [-1040.038] (-1041.281) (-1042.447) * (-1038.630) (-1040.268) [-1042.394] (-1039.255) -- 0:00:41
334500 -- (-1039.552) (-1044.463) [-1040.655] (-1041.740) * (-1043.824) [-1039.690] (-1040.351) (-1041.966) -- 0:00:41
335000 -- (-1040.604) (-1040.533) [-1041.885] (-1042.949) * (-1041.758) (-1038.292) [-1039.340] (-1043.390) -- 0:00:41
Average standard deviation of split frequencies: 0.018395
335500 -- (-1040.891) (-1040.026) (-1040.477) [-1040.456] * (-1040.130) (-1038.992) [-1040.156] (-1042.017) -- 0:00:41
336000 -- [-1039.907] (-1040.868) (-1041.059) (-1038.154) * (-1043.031) (-1038.460) [-1040.726] (-1042.654) -- 0:00:41
336500 -- [-1043.827] (-1040.220) (-1041.310) (-1043.939) * [-1041.263] (-1038.034) (-1045.096) (-1038.323) -- 0:00:41
337000 -- (-1040.513) (-1040.739) [-1040.353] (-1045.777) * (-1038.137) [-1038.424] (-1043.924) (-1040.012) -- 0:00:41
337500 -- [-1042.277] (-1039.989) (-1039.726) (-1042.528) * (-1037.939) (-1039.009) (-1041.231) [-1040.101] -- 0:00:41
338000 -- [-1039.943] (-1043.195) (-1038.678) (-1041.072) * (-1037.986) (-1041.274) [-1044.058] (-1037.995) -- 0:00:41
338500 -- [-1037.823] (-1043.898) (-1039.781) (-1038.869) * (-1043.206) (-1038.508) [-1037.723] (-1037.977) -- 0:00:41
339000 -- [-1038.737] (-1040.838) (-1046.246) (-1038.004) * (-1044.724) (-1038.607) [-1037.663] (-1041.154) -- 0:00:40
339500 -- (-1039.642) [-1038.580] (-1043.454) (-1039.230) * [-1039.370] (-1041.666) (-1041.193) (-1039.649) -- 0:00:40
340000 -- (-1041.459) (-1039.064) [-1040.028] (-1038.934) * (-1044.240) [-1040.446] (-1038.944) (-1040.100) -- 0:00:40
Average standard deviation of split frequencies: 0.017989
340500 -- (-1041.232) (-1042.254) (-1050.745) [-1039.130] * (-1040.018) (-1039.320) (-1040.347) [-1038.992] -- 0:00:40
341000 -- (-1038.886) [-1038.849] (-1043.624) (-1038.346) * (-1040.432) (-1038.954) (-1040.454) [-1040.020] -- 0:00:40
341500 -- (-1038.194) [-1041.096] (-1044.442) (-1038.173) * [-1042.117] (-1041.127) (-1039.834) (-1038.142) -- 0:00:40
342000 -- (-1042.028) [-1038.623] (-1039.259) (-1040.071) * (-1042.041) (-1042.882) (-1040.185) [-1038.565] -- 0:00:40
342500 -- [-1042.996] (-1041.073) (-1042.979) (-1040.865) * (-1040.042) (-1039.621) (-1038.760) [-1037.966] -- 0:00:40
343000 -- (-1041.360) (-1039.333) (-1045.861) [-1038.833] * [-1040.445] (-1040.637) (-1039.356) (-1037.995) -- 0:00:40
343500 -- (-1039.408) (-1042.672) [-1042.287] (-1039.804) * (-1040.420) (-1039.148) [-1042.636] (-1042.341) -- 0:00:42
344000 -- [-1040.185] (-1039.852) (-1041.487) (-1041.260) * (-1041.094) [-1039.090] (-1042.159) (-1042.208) -- 0:00:41
344500 -- (-1039.096) [-1041.489] (-1040.949) (-1039.874) * (-1041.869) [-1039.249] (-1042.053) (-1042.206) -- 0:00:41
345000 -- [-1039.461] (-1041.168) (-1039.608) (-1038.979) * (-1041.805) (-1038.328) (-1043.067) [-1045.059] -- 0:00:41
Average standard deviation of split frequencies: 0.017182
345500 -- (-1039.328) (-1040.073) (-1040.307) [-1038.636] * [-1038.834] (-1037.974) (-1041.763) (-1040.609) -- 0:00:41
346000 -- [-1039.472] (-1038.728) (-1042.800) (-1040.455) * (-1038.649) [-1040.707] (-1040.117) (-1039.212) -- 0:00:41
346500 -- [-1045.163] (-1038.384) (-1043.308) (-1040.526) * [-1039.301] (-1039.418) (-1038.605) (-1041.340) -- 0:00:41
347000 -- [-1040.152] (-1038.637) (-1043.273) (-1040.049) * (-1037.862) (-1040.601) [-1039.102] (-1040.078) -- 0:00:41
347500 -- [-1041.062] (-1039.894) (-1042.408) (-1041.848) * (-1037.834) (-1040.541) [-1038.919] (-1039.703) -- 0:00:41
348000 -- (-1046.598) [-1038.857] (-1041.002) (-1041.441) * (-1037.855) (-1038.701) [-1041.763] (-1037.820) -- 0:00:41
348500 -- (-1040.324) (-1039.853) (-1039.787) [-1038.843] * (-1040.181) (-1039.570) (-1039.680) [-1040.897] -- 0:00:41
349000 -- (-1040.265) (-1038.324) [-1041.312] (-1038.756) * (-1040.729) [-1040.849] (-1039.171) (-1039.611) -- 0:00:41
349500 -- (-1038.366) [-1039.353] (-1041.639) (-1040.126) * (-1040.545) (-1039.616) (-1038.407) [-1040.917] -- 0:00:40
350000 -- [-1043.136] (-1041.277) (-1041.555) (-1043.215) * (-1040.408) (-1038.418) [-1038.223] (-1038.698) -- 0:00:40
Average standard deviation of split frequencies: 0.015982
350500 -- (-1040.304) (-1042.158) [-1041.655] (-1042.930) * (-1042.171) (-1042.190) (-1040.009) [-1039.221] -- 0:00:40
351000 -- (-1039.156) (-1040.021) [-1040.230] (-1041.239) * (-1041.998) (-1041.874) (-1040.676) [-1039.995] -- 0:00:40
351500 -- (-1041.665) [-1040.497] (-1042.075) (-1039.490) * (-1039.912) (-1040.888) (-1039.461) [-1040.251] -- 0:00:40
352000 -- (-1040.969) (-1038.924) (-1039.973) [-1040.621] * (-1041.757) (-1043.381) (-1042.410) [-1039.312] -- 0:00:40
352500 -- (-1042.190) (-1049.105) [-1039.353] (-1044.900) * (-1041.294) [-1038.992] (-1039.490) (-1040.185) -- 0:00:40
353000 -- [-1041.483] (-1046.515) (-1038.493) (-1039.369) * (-1044.589) (-1043.375) (-1040.272) [-1039.674] -- 0:00:40
353500 -- (-1042.059) (-1040.832) (-1038.124) [-1037.775] * (-1041.009) (-1041.879) (-1042.383) [-1040.494] -- 0:00:40
354000 -- (-1042.915) (-1041.334) [-1037.996] (-1039.273) * (-1040.411) [-1039.120] (-1042.000) (-1041.259) -- 0:00:40
354500 -- (-1040.839) (-1039.459) (-1038.016) [-1037.923] * (-1037.951) [-1039.811] (-1042.463) (-1039.861) -- 0:00:40
355000 -- (-1039.640) [-1040.063] (-1041.918) (-1039.963) * (-1038.601) [-1040.967] (-1040.385) (-1039.639) -- 0:00:39
Average standard deviation of split frequencies: 0.016046
355500 -- (-1039.217) (-1042.549) (-1038.531) [-1042.333] * [-1039.388] (-1042.448) (-1040.489) (-1041.587) -- 0:00:39
356000 -- [-1040.350] (-1041.815) (-1040.327) (-1039.417) * (-1041.974) (-1039.639) [-1044.176] (-1041.987) -- 0:00:39
356500 -- (-1041.259) [-1041.696] (-1039.813) (-1038.301) * (-1040.505) (-1040.528) [-1040.068] (-1040.467) -- 0:00:39
357000 -- (-1040.393) [-1040.374] (-1041.410) (-1040.774) * [-1041.144] (-1040.865) (-1043.099) (-1040.377) -- 0:00:39
357500 -- (-1039.524) (-1038.722) (-1042.290) [-1041.016] * (-1038.096) [-1039.322] (-1043.640) (-1039.556) -- 0:00:39
358000 -- (-1038.269) [-1040.259] (-1038.231) (-1038.289) * (-1040.337) (-1041.036) [-1039.978] (-1038.455) -- 0:00:39
358500 -- (-1038.555) [-1039.659] (-1039.009) (-1039.538) * (-1040.835) [-1038.955] (-1037.653) (-1038.811) -- 0:00:39
359000 -- (-1042.822) (-1044.098) [-1042.356] (-1040.390) * (-1042.762) [-1038.956] (-1038.739) (-1041.226) -- 0:00:39
359500 -- (-1040.392) (-1053.762) (-1041.156) [-1039.534] * (-1040.849) (-1041.381) (-1039.680) [-1039.519] -- 0:00:40
360000 -- (-1039.043) (-1039.465) (-1041.496) [-1039.012] * [-1040.508] (-1038.661) (-1038.846) (-1038.729) -- 0:00:40
Average standard deviation of split frequencies: 0.016175
360500 -- (-1038.091) (-1041.271) (-1038.160) [-1040.195] * (-1038.576) [-1040.541] (-1038.297) (-1040.728) -- 0:00:40
361000 -- [-1037.762] (-1039.614) (-1041.236) (-1043.419) * (-1038.766) (-1043.008) (-1039.610) [-1038.778] -- 0:00:40
361500 -- (-1039.296) (-1045.398) [-1040.214] (-1042.034) * (-1038.734) (-1042.625) (-1039.168) [-1038.868] -- 0:00:40
362000 -- (-1043.471) [-1046.306] (-1040.560) (-1039.345) * [-1041.393] (-1041.196) (-1037.911) (-1038.924) -- 0:00:40
362500 -- [-1040.594] (-1045.119) (-1039.501) (-1040.602) * (-1041.571) (-1042.113) [-1038.437] (-1044.959) -- 0:00:40
363000 -- [-1039.604] (-1043.606) (-1041.054) (-1043.789) * [-1039.954] (-1040.308) (-1038.438) (-1038.725) -- 0:00:40
363500 -- [-1038.583] (-1040.118) (-1044.743) (-1042.855) * (-1040.693) (-1043.258) (-1039.106) [-1039.168] -- 0:00:40
364000 -- (-1041.627) [-1039.482] (-1044.344) (-1037.883) * (-1039.270) [-1039.365] (-1038.941) (-1041.070) -- 0:00:40
364500 -- (-1039.586) (-1041.502) [-1040.900] (-1038.215) * (-1044.391) [-1039.079] (-1038.709) (-1041.318) -- 0:00:40
365000 -- (-1041.403) (-1038.783) (-1043.016) [-1039.160] * (-1042.479) [-1038.428] (-1039.443) (-1040.863) -- 0:00:40
Average standard deviation of split frequencies: 0.015153
365500 -- (-1039.872) [-1038.344] (-1040.132) (-1040.527) * (-1042.800) (-1039.846) (-1039.277) [-1038.904] -- 0:00:39
366000 -- [-1040.276] (-1038.339) (-1041.380) (-1039.691) * (-1040.447) (-1038.854) [-1039.475] (-1038.450) -- 0:00:39
366500 -- [-1039.179] (-1039.492) (-1039.311) (-1040.207) * (-1038.527) [-1042.919] (-1041.006) (-1038.460) -- 0:00:39
367000 -- [-1041.203] (-1040.107) (-1038.361) (-1039.661) * (-1039.977) (-1038.778) (-1039.253) [-1038.552] -- 0:00:39
367500 -- (-1041.255) (-1039.821) [-1040.889] (-1039.158) * (-1040.002) (-1038.658) (-1039.164) [-1039.688] -- 0:00:39
368000 -- (-1040.782) (-1038.829) [-1040.086] (-1040.260) * (-1037.625) [-1039.894] (-1041.689) (-1040.287) -- 0:00:39
368500 -- (-1039.387) (-1038.573) (-1038.697) [-1044.708] * (-1037.625) [-1039.564] (-1042.777) (-1043.877) -- 0:00:39
369000 -- [-1041.314] (-1039.451) (-1038.995) (-1039.230) * (-1037.967) (-1040.378) [-1039.623] (-1038.808) -- 0:00:39
369500 -- (-1042.712) [-1039.435] (-1038.249) (-1039.477) * (-1039.360) (-1039.570) [-1039.786] (-1038.537) -- 0:00:39
370000 -- (-1048.851) [-1043.006] (-1038.370) (-1039.488) * (-1039.320) [-1039.285] (-1040.436) (-1038.794) -- 0:00:39
Average standard deviation of split frequencies: 0.015023
370500 -- (-1042.771) (-1041.250) (-1039.178) [-1039.926] * (-1038.368) [-1039.284] (-1045.486) (-1038.953) -- 0:00:39
371000 -- (-1041.770) (-1042.589) [-1038.670] (-1038.464) * (-1038.241) [-1038.644] (-1045.366) (-1039.311) -- 0:00:38
371500 -- (-1046.082) (-1039.860) [-1039.582] (-1039.703) * [-1038.978] (-1038.469) (-1045.265) (-1046.298) -- 0:00:38
372000 -- [-1041.651] (-1038.654) (-1038.220) (-1040.981) * (-1042.060) (-1044.347) (-1044.447) [-1043.165] -- 0:00:38
372500 -- (-1039.698) (-1040.200) [-1038.677] (-1043.292) * [-1038.763] (-1040.173) (-1038.669) (-1039.873) -- 0:00:38
373000 -- [-1039.495] (-1039.655) (-1038.956) (-1039.142) * [-1042.850] (-1039.957) (-1039.683) (-1043.619) -- 0:00:38
373500 -- (-1038.992) (-1037.934) (-1041.154) [-1039.490] * (-1041.132) [-1040.282] (-1038.890) (-1039.969) -- 0:00:38
374000 -- (-1038.885) (-1039.417) [-1038.871] (-1040.413) * (-1039.847) (-1040.165) [-1039.634] (-1042.245) -- 0:00:38
374500 -- (-1039.755) (-1039.475) [-1038.111] (-1041.192) * (-1039.755) (-1043.318) [-1041.054] (-1038.653) -- 0:00:38
375000 -- [-1040.504] (-1041.387) (-1038.824) (-1040.529) * (-1038.411) (-1042.612) (-1040.212) [-1038.322] -- 0:00:38
Average standard deviation of split frequencies: 0.013717
375500 -- (-1038.655) (-1040.404) [-1038.659] (-1039.892) * [-1039.306] (-1040.319) (-1040.023) (-1038.704) -- 0:00:39
376000 -- (-1039.624) (-1038.954) (-1038.874) [-1040.350] * (-1039.888) (-1039.949) (-1041.078) [-1038.094] -- 0:00:39
376500 -- (-1038.843) (-1038.532) (-1041.080) [-1042.310] * (-1038.967) (-1041.339) (-1043.356) [-1037.881] -- 0:00:39
377000 -- (-1039.045) (-1039.043) (-1042.278) [-1038.505] * (-1038.872) (-1039.103) (-1040.459) [-1038.157] -- 0:00:39
377500 -- (-1039.058) (-1039.697) [-1040.208] (-1038.425) * (-1039.736) [-1037.729] (-1039.020) (-1038.683) -- 0:00:39
378000 -- (-1039.923) (-1038.416) [-1040.377] (-1041.110) * (-1040.063) (-1040.195) (-1038.856) [-1040.574] -- 0:00:39
378500 -- (-1041.882) [-1038.072] (-1043.952) (-1038.723) * (-1040.824) (-1039.558) [-1040.354] (-1041.271) -- 0:00:39
379000 -- (-1038.995) (-1038.586) [-1040.349] (-1038.513) * (-1041.956) [-1041.025] (-1041.914) (-1040.122) -- 0:00:39
379500 -- (-1038.532) [-1040.260] (-1038.522) (-1038.752) * (-1043.531) (-1042.307) (-1039.004) [-1040.063] -- 0:00:39
380000 -- [-1040.888] (-1039.788) (-1038.593) (-1039.241) * [-1039.410] (-1040.173) (-1042.586) (-1039.087) -- 0:00:39
Average standard deviation of split frequencies: 0.013768
380500 -- (-1039.332) [-1042.414] (-1043.566) (-1039.934) * (-1041.739) [-1039.421] (-1039.768) (-1040.620) -- 0:00:39
381000 -- (-1044.821) [-1040.559] (-1038.800) (-1038.650) * (-1041.766) (-1037.816) [-1038.812] (-1044.179) -- 0:00:38
381500 -- (-1039.165) [-1040.300] (-1040.061) (-1039.733) * [-1041.810] (-1040.789) (-1044.548) (-1040.287) -- 0:00:38
382000 -- (-1038.634) (-1038.830) (-1038.980) [-1039.658] * [-1041.227] (-1040.490) (-1042.300) (-1038.717) -- 0:00:38
382500 -- (-1042.518) (-1038.708) [-1039.136] (-1041.891) * (-1041.568) (-1038.748) [-1040.923] (-1038.815) -- 0:00:38
383000 -- [-1038.213] (-1042.965) (-1041.035) (-1048.014) * (-1041.729) (-1039.221) [-1040.338] (-1040.661) -- 0:00:38
383500 -- [-1038.230] (-1039.600) (-1040.264) (-1040.176) * (-1040.650) (-1039.026) (-1039.450) [-1038.521] -- 0:00:38
384000 -- (-1038.071) (-1042.854) [-1040.760] (-1043.133) * (-1038.867) (-1039.329) (-1038.928) [-1039.036] -- 0:00:38
384500 -- [-1038.426] (-1040.525) (-1039.421) (-1041.084) * (-1038.896) (-1042.005) [-1038.802] (-1043.470) -- 0:00:38
385000 -- (-1042.966) (-1040.601) (-1041.455) [-1039.512] * (-1042.067) (-1041.685) [-1043.793] (-1040.171) -- 0:00:38
Average standard deviation of split frequencies: 0.013937
385500 -- (-1042.762) [-1038.540] (-1039.834) (-1039.932) * [-1040.740] (-1041.795) (-1041.178) (-1039.656) -- 0:00:38
386000 -- (-1042.659) (-1038.322) (-1042.773) [-1047.407] * [-1040.096] (-1039.775) (-1040.638) (-1037.768) -- 0:00:38
386500 -- (-1045.221) [-1042.725] (-1039.861) (-1042.013) * [-1038.893] (-1039.915) (-1040.445) (-1037.775) -- 0:00:38
387000 -- (-1043.914) (-1043.225) [-1039.759] (-1039.751) * (-1038.466) [-1040.663] (-1041.770) (-1041.972) -- 0:00:38
387500 -- [-1044.954] (-1038.680) (-1039.421) (-1038.753) * (-1039.524) [-1039.979] (-1039.716) (-1044.281) -- 0:00:37
388000 -- (-1044.171) (-1041.524) (-1039.665) [-1041.897] * (-1041.202) (-1040.757) [-1042.989] (-1040.555) -- 0:00:37
388500 -- (-1040.486) (-1041.695) [-1039.807] (-1041.241) * (-1044.719) (-1043.062) [-1038.967] (-1039.753) -- 0:00:37
389000 -- [-1038.524] (-1042.662) (-1039.871) (-1042.156) * (-1046.424) [-1040.117] (-1039.550) (-1038.841) -- 0:00:37
389500 -- (-1037.792) (-1041.421) [-1039.125] (-1039.897) * (-1040.556) [-1039.685] (-1041.370) (-1038.438) -- 0:00:37
390000 -- (-1037.875) [-1038.768] (-1040.200) (-1038.638) * (-1039.123) [-1039.615] (-1038.434) (-1038.821) -- 0:00:37
Average standard deviation of split frequencies: 0.013952
390500 -- (-1041.452) [-1040.608] (-1038.988) (-1040.452) * [-1039.906] (-1038.949) (-1040.314) (-1042.063) -- 0:00:37
391000 -- (-1038.939) [-1040.952] (-1039.373) (-1041.343) * [-1041.120] (-1039.435) (-1038.824) (-1040.206) -- 0:00:37
391500 -- (-1040.097) [-1039.024] (-1039.033) (-1039.251) * [-1043.329] (-1040.258) (-1038.498) (-1042.464) -- 0:00:38
392000 -- (-1046.085) (-1038.159) [-1038.078] (-1040.120) * (-1041.101) [-1039.496] (-1041.138) (-1040.054) -- 0:00:38
392500 -- [-1039.489] (-1040.642) (-1043.363) (-1040.280) * [-1038.522] (-1041.163) (-1041.194) (-1040.744) -- 0:00:38
393000 -- [-1040.409] (-1039.346) (-1041.270) (-1039.702) * [-1038.667] (-1043.659) (-1039.654) (-1039.011) -- 0:00:38
393500 -- (-1039.220) [-1040.439] (-1038.328) (-1040.274) * (-1038.375) (-1041.281) [-1039.629] (-1041.648) -- 0:00:38
394000 -- (-1040.125) (-1040.439) [-1038.674] (-1043.279) * (-1040.534) [-1039.884] (-1039.290) (-1039.733) -- 0:00:38
394500 -- (-1039.148) (-1039.709) [-1042.178] (-1042.420) * (-1039.519) (-1041.028) [-1041.239] (-1039.679) -- 0:00:38
395000 -- [-1039.841] (-1041.089) (-1040.185) (-1038.929) * [-1043.607] (-1044.862) (-1040.004) (-1039.756) -- 0:00:38
Average standard deviation of split frequencies: 0.013392
395500 -- [-1039.854] (-1041.875) (-1038.831) (-1042.099) * (-1042.399) (-1041.301) [-1039.033] (-1038.470) -- 0:00:38
396000 -- (-1040.522) (-1039.508) [-1040.596] (-1042.400) * [-1040.416] (-1041.200) (-1038.683) (-1037.585) -- 0:00:38
396500 -- (-1041.456) (-1041.837) (-1041.998) [-1037.973] * (-1041.096) (-1037.742) (-1038.943) [-1039.217] -- 0:00:38
397000 -- (-1041.033) [-1038.962] (-1039.064) (-1039.822) * (-1039.331) [-1039.426] (-1038.884) (-1039.155) -- 0:00:37
397500 -- (-1042.296) [-1038.630] (-1039.808) (-1040.796) * (-1039.746) [-1041.724] (-1039.995) (-1039.196) -- 0:00:37
398000 -- (-1041.605) (-1039.801) [-1039.023] (-1042.108) * (-1038.613) (-1038.999) (-1040.215) [-1038.002] -- 0:00:37
398500 -- (-1037.905) [-1039.583] (-1039.752) (-1038.317) * (-1040.571) (-1039.739) (-1041.017) [-1037.892] -- 0:00:37
399000 -- (-1038.398) (-1037.814) [-1038.486] (-1038.430) * (-1041.512) (-1042.347) (-1040.764) [-1038.409] -- 0:00:37
399500 -- (-1040.596) (-1038.782) (-1041.643) [-1038.262] * (-1038.969) (-1040.136) (-1038.349) [-1039.472] -- 0:00:37
400000 -- (-1041.041) (-1040.240) (-1040.308) [-1038.494] * (-1039.001) [-1039.901] (-1038.775) (-1039.716) -- 0:00:37
Average standard deviation of split frequencies: 0.013236
400500 -- (-1039.937) [-1040.131] (-1039.367) (-1041.433) * [-1040.141] (-1042.648) (-1038.795) (-1039.397) -- 0:00:37
401000 -- (-1041.148) [-1041.271] (-1040.448) (-1041.200) * [-1039.203] (-1039.763) (-1038.667) (-1038.570) -- 0:00:37
401500 -- (-1040.989) (-1038.216) [-1039.939] (-1042.533) * (-1040.067) (-1041.234) [-1040.075] (-1039.130) -- 0:00:37
402000 -- (-1040.558) [-1039.153] (-1043.654) (-1042.315) * [-1038.781] (-1039.572) (-1040.973) (-1039.272) -- 0:00:37
402500 -- (-1040.159) (-1039.093) [-1040.016] (-1040.538) * (-1039.995) (-1041.846) [-1039.130] (-1039.051) -- 0:00:37
403000 -- (-1039.735) [-1041.375] (-1038.997) (-1040.665) * (-1038.890) (-1039.220) [-1038.089] (-1040.019) -- 0:00:37
403500 -- (-1039.189) (-1039.975) (-1038.161) [-1040.585] * [-1041.490] (-1038.928) (-1042.491) (-1039.164) -- 0:00:36
404000 -- [-1039.487] (-1040.532) (-1038.857) (-1039.966) * [-1044.396] (-1040.348) (-1047.629) (-1039.130) -- 0:00:36
404500 -- (-1038.960) (-1038.423) (-1038.194) [-1042.153] * (-1039.991) (-1041.211) [-1039.488] (-1039.167) -- 0:00:36
405000 -- (-1040.194) (-1041.779) (-1039.134) [-1039.644] * (-1041.458) (-1040.521) (-1040.843) [-1041.145] -- 0:00:36
Average standard deviation of split frequencies: 0.012917
405500 -- (-1040.667) (-1041.332) (-1038.641) [-1039.261] * (-1041.710) [-1039.354] (-1039.891) (-1040.113) -- 0:00:36
406000 -- (-1040.116) [-1038.993] (-1046.295) (-1040.237) * (-1039.135) [-1040.501] (-1038.220) (-1040.000) -- 0:00:36
406500 -- [-1037.863] (-1039.921) (-1041.406) (-1043.424) * (-1039.252) (-1041.169) [-1039.764] (-1042.474) -- 0:00:36
407000 -- (-1039.890) [-1043.138] (-1042.335) (-1049.630) * [-1039.249] (-1040.046) (-1044.497) (-1044.327) -- 0:00:36
407500 -- (-1042.420) (-1039.359) [-1040.851] (-1045.196) * (-1038.533) (-1041.160) [-1040.839] (-1040.198) -- 0:00:37
408000 -- (-1040.455) [-1038.720] (-1040.753) (-1038.898) * (-1040.670) (-1041.481) (-1042.333) [-1040.433] -- 0:00:37
408500 -- (-1045.021) (-1039.429) [-1042.033] (-1038.797) * (-1040.837) [-1039.984] (-1047.365) (-1040.374) -- 0:00:37
409000 -- (-1042.254) [-1038.742] (-1040.623) (-1038.909) * (-1038.906) (-1040.966) (-1043.480) [-1043.508] -- 0:00:37
409500 -- [-1039.529] (-1044.093) (-1039.186) (-1040.004) * (-1039.782) (-1041.452) (-1040.203) [-1041.136] -- 0:00:37
410000 -- [-1040.295] (-1038.675) (-1040.395) (-1037.990) * (-1039.836) (-1040.200) [-1040.592] (-1042.090) -- 0:00:37
Average standard deviation of split frequencies: 0.012627
410500 -- [-1041.268] (-1039.124) (-1039.848) (-1042.922) * [-1039.382] (-1040.698) (-1043.887) (-1041.983) -- 0:00:37
411000 -- (-1042.378) [-1038.923] (-1040.913) (-1039.460) * (-1042.786) (-1038.927) (-1041.382) [-1039.736] -- 0:00:37
411500 -- (-1040.625) (-1042.943) [-1040.367] (-1038.196) * [-1038.213] (-1040.301) (-1041.619) (-1039.576) -- 0:00:37
412000 -- [-1044.673] (-1039.568) (-1039.561) (-1037.828) * (-1038.840) (-1041.027) [-1042.483] (-1039.397) -- 0:00:37
412500 -- (-1042.764) (-1040.807) (-1040.048) [-1041.091] * (-1040.898) (-1038.099) [-1039.924] (-1041.317) -- 0:00:37
413000 -- [-1039.029] (-1038.393) (-1039.526) (-1039.838) * [-1039.426] (-1038.179) (-1040.071) (-1042.971) -- 0:00:36
413500 -- [-1039.293] (-1039.879) (-1040.045) (-1041.910) * (-1038.938) (-1038.837) [-1041.056] (-1047.713) -- 0:00:36
414000 -- (-1041.267) [-1041.167] (-1038.144) (-1044.533) * [-1038.048] (-1041.446) (-1039.237) (-1043.526) -- 0:00:36
414500 -- (-1041.956) (-1038.350) (-1038.719) [-1039.280] * [-1038.739] (-1041.435) (-1039.829) (-1038.119) -- 0:00:36
415000 -- [-1038.157] (-1039.815) (-1039.757) (-1038.836) * (-1040.164) (-1039.726) (-1039.551) [-1038.655] -- 0:00:36
Average standard deviation of split frequencies: 0.011119
415500 -- (-1042.186) (-1039.050) [-1040.770] (-1041.490) * (-1041.788) [-1038.598] (-1045.431) (-1039.185) -- 0:00:36
416000 -- [-1038.365] (-1040.543) (-1039.391) (-1038.437) * [-1037.914] (-1037.763) (-1041.953) (-1038.711) -- 0:00:36
416500 -- (-1041.335) (-1040.149) [-1040.486] (-1039.419) * [-1038.627] (-1039.171) (-1041.307) (-1043.256) -- 0:00:36
417000 -- (-1039.036) [-1040.195] (-1038.538) (-1043.604) * [-1039.242] (-1039.393) (-1040.002) (-1040.984) -- 0:00:36
417500 -- [-1040.417] (-1043.188) (-1040.953) (-1042.600) * (-1041.224) [-1040.979] (-1041.481) (-1041.926) -- 0:00:36
418000 -- [-1039.955] (-1042.759) (-1038.711) (-1041.321) * (-1040.141) (-1038.709) (-1040.698) [-1039.849] -- 0:00:36
418500 -- (-1039.715) (-1038.873) [-1040.426] (-1040.440) * (-1040.017) [-1041.110] (-1042.855) (-1038.494) -- 0:00:36
419000 -- [-1039.404] (-1043.976) (-1038.988) (-1040.475) * (-1039.720) (-1039.424) [-1039.782] (-1040.920) -- 0:00:36
419500 -- (-1039.720) [-1042.987] (-1039.075) (-1038.172) * (-1040.859) [-1038.953] (-1042.536) (-1041.403) -- 0:00:35
420000 -- (-1040.807) (-1041.590) [-1038.055] (-1043.084) * [-1039.510] (-1038.822) (-1043.500) (-1042.412) -- 0:00:35
Average standard deviation of split frequencies: 0.010996
420500 -- (-1037.769) (-1042.365) [-1037.912] (-1040.519) * (-1039.879) (-1038.318) [-1039.780] (-1042.301) -- 0:00:35
421000 -- [-1042.809] (-1041.970) (-1039.577) (-1040.105) * (-1040.947) (-1038.793) (-1038.492) [-1039.798] -- 0:00:35
421500 -- (-1039.348) (-1046.273) [-1041.702] (-1039.110) * (-1043.660) (-1042.880) (-1038.567) [-1038.910] -- 0:00:35
422000 -- (-1038.968) (-1044.739) (-1044.034) [-1038.469] * (-1043.198) (-1041.446) [-1040.496] (-1039.330) -- 0:00:35
422500 -- [-1038.619] (-1043.273) (-1040.925) (-1041.361) * (-1041.551) (-1040.068) (-1037.845) [-1038.618] -- 0:00:35
423000 -- (-1042.348) [-1040.780] (-1040.432) (-1038.649) * (-1043.227) (-1040.412) [-1039.457] (-1039.294) -- 0:00:35
423500 -- (-1038.896) [-1040.861] (-1039.081) (-1039.687) * [-1038.113] (-1039.566) (-1039.191) (-1039.843) -- 0:00:36
424000 -- (-1040.187) [-1041.391] (-1041.864) (-1039.625) * (-1039.200) (-1038.299) [-1039.880] (-1041.741) -- 0:00:36
424500 -- (-1040.483) (-1038.169) [-1041.474] (-1042.951) * (-1041.307) (-1038.140) [-1039.481] (-1038.751) -- 0:00:36
425000 -- (-1039.362) (-1038.800) (-1039.303) [-1038.164] * (-1040.247) [-1038.395] (-1039.854) (-1039.147) -- 0:00:36
Average standard deviation of split frequencies: 0.009752
425500 -- (-1038.412) (-1038.453) (-1041.176) [-1041.174] * (-1043.703) [-1038.400] (-1040.712) (-1039.117) -- 0:00:36
426000 -- (-1039.252) (-1040.208) (-1038.882) [-1039.782] * (-1040.382) [-1038.804] (-1041.787) (-1040.877) -- 0:00:36
426500 -- (-1041.836) (-1040.023) [-1038.068] (-1038.592) * (-1038.628) [-1038.704] (-1042.372) (-1042.501) -- 0:00:36
427000 -- [-1038.675] (-1040.323) (-1038.929) (-1040.471) * (-1038.997) (-1037.988) (-1043.231) [-1038.316] -- 0:00:36
427500 -- (-1038.804) [-1041.097] (-1041.170) (-1039.822) * [-1039.149] (-1038.429) (-1039.267) (-1042.599) -- 0:00:36
428000 -- (-1040.854) (-1042.610) [-1039.894] (-1040.105) * [-1038.531] (-1041.322) (-1042.154) (-1041.699) -- 0:00:36
428500 -- [-1038.597] (-1044.492) (-1038.470) (-1041.053) * (-1042.157) (-1040.436) [-1041.934] (-1040.616) -- 0:00:36
429000 -- (-1038.816) (-1045.412) (-1039.102) [-1038.356] * [-1039.947] (-1039.924) (-1039.158) (-1042.051) -- 0:00:35
429500 -- [-1040.694] (-1038.580) (-1039.046) (-1041.555) * (-1037.986) [-1038.768] (-1039.013) (-1038.812) -- 0:00:35
430000 -- [-1039.843] (-1040.274) (-1042.556) (-1040.002) * (-1039.908) (-1038.652) (-1039.731) [-1037.808] -- 0:00:35
Average standard deviation of split frequencies: 0.009988
430500 -- (-1037.847) (-1039.353) [-1038.400] (-1037.826) * (-1039.022) (-1040.600) [-1037.725] (-1038.248) -- 0:00:35
431000 -- (-1038.454) [-1038.951] (-1037.529) (-1039.231) * (-1039.483) (-1041.390) [-1039.651] (-1039.659) -- 0:00:35
431500 -- (-1041.699) (-1037.992) [-1038.513] (-1039.077) * (-1038.270) [-1042.975] (-1043.212) (-1040.135) -- 0:00:35
432000 -- (-1039.726) (-1037.734) (-1041.311) [-1038.666] * [-1039.326] (-1043.983) (-1040.332) (-1048.330) -- 0:00:35
432500 -- (-1039.425) (-1039.143) [-1042.645] (-1039.121) * (-1047.163) (-1041.633) [-1038.183] (-1038.470) -- 0:00:35
433000 -- (-1038.268) (-1039.450) (-1038.875) [-1038.614] * (-1039.393) (-1041.829) (-1042.407) [-1039.065] -- 0:00:35
433500 -- (-1038.606) (-1040.496) [-1041.367] (-1038.485) * (-1041.051) [-1039.109] (-1039.538) (-1042.105) -- 0:00:35
434000 -- (-1039.489) [-1043.699] (-1040.960) (-1040.528) * (-1038.531) (-1039.014) (-1039.569) [-1039.513] -- 0:00:35
434500 -- [-1040.428] (-1043.803) (-1041.211) (-1041.766) * (-1038.022) (-1042.231) (-1040.560) [-1039.736] -- 0:00:35
435000 -- (-1040.263) (-1042.389) [-1038.389] (-1041.947) * [-1038.172] (-1040.098) (-1040.433) (-1039.314) -- 0:00:35
Average standard deviation of split frequencies: 0.008395
435500 -- (-1038.859) (-1038.640) (-1039.468) [-1038.804] * [-1042.086] (-1040.185) (-1039.383) (-1040.761) -- 0:00:34
436000 -- (-1040.178) [-1038.607] (-1040.359) (-1039.438) * (-1041.685) [-1042.669] (-1040.505) (-1043.141) -- 0:00:34
436500 -- (-1039.842) (-1039.330) (-1040.556) [-1041.274] * [-1039.462] (-1041.894) (-1039.583) (-1038.418) -- 0:00:34
437000 -- (-1039.665) (-1037.679) [-1040.873] (-1041.836) * [-1039.110] (-1041.548) (-1038.929) (-1038.895) -- 0:00:34
437500 -- (-1041.625) (-1038.507) (-1038.813) [-1039.063] * (-1041.873) (-1040.970) (-1042.571) [-1039.107] -- 0:00:34
438000 -- [-1038.948] (-1042.379) (-1041.518) (-1038.176) * (-1041.351) (-1040.762) (-1039.006) [-1040.543] -- 0:00:34
438500 -- [-1038.122] (-1040.523) (-1039.154) (-1041.834) * [-1039.935] (-1040.785) (-1040.223) (-1038.684) -- 0:00:34
439000 -- (-1043.015) (-1049.162) (-1039.678) [-1039.242] * [-1039.985] (-1038.405) (-1040.315) (-1042.376) -- 0:00:35
439500 -- (-1040.998) [-1039.655] (-1038.815) (-1041.228) * [-1039.404] (-1042.429) (-1040.284) (-1039.978) -- 0:00:35
440000 -- (-1039.724) [-1039.314] (-1038.816) (-1042.101) * (-1043.314) [-1040.356] (-1040.239) (-1039.815) -- 0:00:35
Average standard deviation of split frequencies: 0.007866
440500 -- [-1045.122] (-1039.645) (-1040.345) (-1041.882) * (-1044.103) (-1041.999) (-1040.906) [-1039.092] -- 0:00:35
441000 -- [-1038.746] (-1043.221) (-1039.835) (-1041.543) * (-1040.182) (-1039.172) (-1038.918) [-1040.679] -- 0:00:35
441500 -- [-1038.654] (-1039.941) (-1047.153) (-1039.571) * (-1038.318) (-1038.642) [-1040.488] (-1039.579) -- 0:00:35
442000 -- (-1039.306) (-1039.275) [-1040.610] (-1040.452) * [-1038.432] (-1039.910) (-1039.122) (-1042.866) -- 0:00:35
442500 -- [-1038.332] (-1039.097) (-1038.444) (-1044.632) * [-1039.350] (-1041.783) (-1043.061) (-1043.689) -- 0:00:35
443000 -- (-1039.401) [-1041.279] (-1039.345) (-1040.025) * (-1039.668) (-1043.196) [-1039.248] (-1039.610) -- 0:00:35
443500 -- (-1038.895) [-1039.559] (-1044.296) (-1039.713) * (-1038.522) (-1040.179) [-1043.165] (-1040.682) -- 0:00:35
444000 -- (-1041.078) [-1040.034] (-1038.080) (-1038.383) * [-1038.800] (-1040.567) (-1042.371) (-1039.000) -- 0:00:35
444500 -- (-1038.710) (-1039.363) (-1039.430) [-1040.847] * [-1040.658] (-1041.344) (-1043.011) (-1040.754) -- 0:00:34
445000 -- (-1040.923) [-1041.680] (-1041.512) (-1039.933) * (-1038.563) [-1043.644] (-1042.135) (-1041.549) -- 0:00:34
Average standard deviation of split frequencies: 0.007772
445500 -- (-1043.036) (-1043.584) [-1040.641] (-1040.949) * (-1037.728) (-1042.107) (-1040.455) [-1043.214] -- 0:00:34
446000 -- [-1041.362] (-1042.544) (-1046.009) (-1041.230) * [-1037.738] (-1041.829) (-1039.566) (-1039.644) -- 0:00:34
446500 -- [-1040.504] (-1039.214) (-1039.655) (-1039.648) * [-1038.977] (-1040.306) (-1042.013) (-1038.770) -- 0:00:34
447000 -- [-1038.795] (-1038.640) (-1038.849) (-1042.984) * (-1040.257) (-1040.611) [-1038.908] (-1040.208) -- 0:00:34
447500 -- (-1045.285) [-1040.012] (-1042.476) (-1038.431) * (-1039.152) (-1041.594) (-1038.727) [-1039.550] -- 0:00:34
448000 -- (-1038.715) [-1042.602] (-1038.424) (-1038.810) * (-1043.734) (-1041.594) (-1042.271) [-1039.402] -- 0:00:34
448500 -- (-1037.970) (-1042.555) (-1040.549) [-1038.944] * (-1042.447) (-1042.543) (-1047.821) [-1039.360] -- 0:00:34
449000 -- (-1038.049) (-1041.879) [-1038.580] (-1041.634) * (-1044.493) (-1043.731) (-1039.028) [-1040.660] -- 0:00:34
449500 -- (-1039.120) (-1045.214) [-1037.773] (-1040.379) * [-1037.835] (-1040.725) (-1039.723) (-1040.231) -- 0:00:34
450000 -- (-1038.847) (-1040.064) (-1037.775) [-1038.848] * (-1041.490) [-1041.748] (-1039.070) (-1045.130) -- 0:00:34
Average standard deviation of split frequencies: 0.007584
450500 -- [-1039.612] (-1043.034) (-1038.141) (-1038.589) * (-1039.842) (-1039.353) [-1038.353] (-1044.891) -- 0:00:34
451000 -- (-1039.369) (-1039.961) [-1038.299] (-1040.972) * [-1038.867] (-1038.986) (-1038.414) (-1042.475) -- 0:00:34
451500 -- (-1038.195) (-1039.187) (-1042.094) [-1038.570] * (-1039.936) (-1039.965) (-1038.839) [-1038.569] -- 0:00:34
452000 -- [-1043.491] (-1038.024) (-1043.368) (-1039.078) * (-1041.023) (-1041.323) [-1041.988] (-1039.510) -- 0:00:33
452500 -- (-1039.144) [-1039.133] (-1040.688) (-1044.423) * (-1040.620) [-1038.640] (-1040.552) (-1042.120) -- 0:00:33
453000 -- (-1039.141) (-1042.126) [-1042.331] (-1042.038) * (-1043.246) (-1038.775) (-1038.525) [-1040.717] -- 0:00:33
453500 -- (-1041.137) (-1040.521) (-1039.279) [-1040.859] * (-1039.789) [-1039.876] (-1038.179) (-1044.010) -- 0:00:33
454000 -- (-1042.572) [-1037.935] (-1038.430) (-1040.165) * (-1042.601) (-1040.329) [-1038.942] (-1042.059) -- 0:00:33
454500 -- (-1046.512) (-1039.312) [-1038.413] (-1041.841) * (-1040.379) (-1041.780) [-1042.385] (-1043.226) -- 0:00:33
455000 -- [-1040.418] (-1041.591) (-1040.230) (-1038.209) * (-1039.484) (-1038.754) [-1038.799] (-1038.015) -- 0:00:34
Average standard deviation of split frequencies: 0.007115
455500 -- (-1041.359) (-1041.832) (-1043.217) [-1038.548] * [-1039.588] (-1039.383) (-1039.473) (-1039.445) -- 0:00:34
456000 -- (-1038.082) [-1038.409] (-1039.428) (-1040.384) * (-1040.822) (-1042.322) (-1039.615) [-1038.393] -- 0:00:34
456500 -- (-1040.204) [-1041.943] (-1038.035) (-1043.551) * (-1040.181) (-1038.180) (-1040.757) [-1039.408] -- 0:00:34
457000 -- [-1039.085] (-1040.314) (-1037.819) (-1041.012) * (-1042.158) (-1039.734) [-1038.328] (-1041.062) -- 0:00:34
457500 -- [-1042.862] (-1039.608) (-1041.139) (-1043.857) * (-1045.370) (-1039.992) [-1038.552] (-1042.632) -- 0:00:34
458000 -- (-1040.657) (-1040.223) (-1040.453) [-1039.277] * (-1042.714) (-1038.846) [-1040.418] (-1039.333) -- 0:00:34
458500 -- (-1038.207) (-1039.183) [-1044.666] (-1038.371) * (-1045.654) (-1037.966) (-1045.228) [-1039.405] -- 0:00:34
459000 -- [-1041.001] (-1041.850) (-1045.164) (-1039.726) * (-1039.745) [-1038.902] (-1043.511) (-1038.017) -- 0:00:34
459500 -- (-1038.995) (-1040.099) [-1038.172] (-1039.579) * (-1046.229) (-1042.326) (-1045.753) [-1039.542] -- 0:00:34
460000 -- (-1040.071) (-1041.472) (-1038.219) [-1039.494] * [-1042.920] (-1040.305) (-1040.155) (-1038.134) -- 0:00:34
Average standard deviation of split frequencies: 0.008050
460500 -- [-1039.005] (-1042.944) (-1039.583) (-1041.154) * (-1040.211) [-1039.543] (-1038.796) (-1039.059) -- 0:00:33
461000 -- (-1044.700) (-1039.139) [-1040.309] (-1038.882) * (-1040.090) (-1038.425) [-1037.963] (-1039.425) -- 0:00:33
461500 -- [-1040.917] (-1039.685) (-1038.906) (-1038.650) * [-1038.208] (-1038.952) (-1039.471) (-1039.815) -- 0:00:33
462000 -- (-1039.788) [-1038.044] (-1041.056) (-1041.559) * [-1038.512] (-1038.949) (-1038.145) (-1038.818) -- 0:00:33
462500 -- [-1043.856] (-1040.192) (-1041.755) (-1039.882) * (-1040.182) (-1039.341) (-1038.155) [-1041.762] -- 0:00:33
463000 -- (-1042.830) (-1040.433) (-1038.117) [-1040.314] * (-1039.172) (-1044.890) (-1037.925) [-1039.482] -- 0:00:33
463500 -- [-1038.455] (-1042.728) (-1038.144) (-1038.967) * (-1041.523) (-1040.634) (-1038.962) [-1041.694] -- 0:00:33
464000 -- [-1038.766] (-1038.976) (-1038.189) (-1039.489) * [-1042.356] (-1042.865) (-1039.083) (-1037.993) -- 0:00:33
464500 -- (-1038.766) [-1038.726] (-1038.967) (-1040.015) * (-1043.278) (-1044.429) [-1038.195] (-1038.765) -- 0:00:33
465000 -- (-1038.903) [-1038.295] (-1039.753) (-1041.488) * (-1042.853) [-1037.743] (-1038.116) (-1041.167) -- 0:00:33
Average standard deviation of split frequencies: 0.007553
465500 -- (-1039.842) (-1044.518) (-1039.144) [-1041.778] * (-1043.319) (-1038.115) [-1040.037] (-1039.682) -- 0:00:33
466000 -- [-1041.493] (-1045.070) (-1041.505) (-1040.663) * (-1041.880) (-1039.826) [-1045.838] (-1039.556) -- 0:00:33
466500 -- (-1038.459) (-1047.897) (-1041.785) [-1041.228] * (-1040.717) [-1041.311] (-1042.819) (-1039.909) -- 0:00:33
467000 -- [-1039.195] (-1041.108) (-1042.392) (-1039.440) * [-1038.667] (-1041.424) (-1039.116) (-1040.445) -- 0:00:33
467500 -- (-1041.570) (-1040.211) [-1039.167] (-1040.761) * [-1039.917] (-1040.180) (-1042.460) (-1040.590) -- 0:00:33
468000 -- (-1039.114) (-1040.189) [-1037.918] (-1040.318) * (-1039.308) [-1040.407] (-1041.697) (-1038.380) -- 0:00:32
468500 -- (-1041.171) [-1040.310] (-1040.023) (-1042.575) * (-1038.300) (-1045.831) (-1040.885) [-1040.190] -- 0:00:32
469000 -- [-1040.645] (-1039.165) (-1042.339) (-1039.485) * (-1038.187) (-1040.808) (-1038.795) [-1041.407] -- 0:00:32
469500 -- (-1038.865) (-1039.037) [-1042.489] (-1039.151) * (-1038.142) [-1042.015] (-1039.254) (-1041.386) -- 0:00:32
470000 -- (-1040.443) [-1039.295] (-1041.462) (-1039.319) * (-1037.982) (-1043.660) [-1040.244] (-1041.118) -- 0:00:32
Average standard deviation of split frequencies: 0.007412
470500 -- [-1040.837] (-1038.065) (-1041.332) (-1041.442) * [-1038.142] (-1038.500) (-1038.946) (-1040.352) -- 0:00:32
471000 -- (-1040.046) [-1037.826] (-1038.365) (-1038.915) * [-1038.456] (-1039.292) (-1040.655) (-1039.053) -- 0:00:33
471500 -- [-1039.554] (-1043.317) (-1039.407) (-1039.831) * (-1039.472) (-1039.150) (-1038.078) [-1038.869] -- 0:00:33
472000 -- (-1038.591) (-1038.959) (-1040.082) [-1039.480] * (-1043.160) [-1040.244] (-1038.631) (-1040.090) -- 0:00:33
472500 -- [-1038.006] (-1039.210) (-1041.862) (-1041.646) * (-1041.251) (-1038.463) [-1037.997] (-1039.667) -- 0:00:33
473000 -- [-1037.946] (-1042.112) (-1038.881) (-1040.469) * (-1044.215) (-1038.391) [-1040.129] (-1037.757) -- 0:00:33
473500 -- (-1038.367) [-1039.002] (-1039.183) (-1041.581) * (-1039.990) [-1040.291] (-1038.987) (-1038.453) -- 0:00:33
474000 -- (-1043.691) (-1038.746) (-1040.361) [-1040.542] * [-1038.303] (-1040.079) (-1040.195) (-1037.820) -- 0:00:33
474500 -- (-1042.647) (-1040.498) [-1043.250] (-1041.615) * (-1039.522) (-1039.032) (-1040.072) [-1038.105] -- 0:00:33
475000 -- (-1039.845) [-1043.139] (-1038.685) (-1038.175) * (-1040.395) [-1039.554] (-1042.091) (-1039.022) -- 0:00:33
Average standard deviation of split frequencies: 0.007989
475500 -- (-1038.525) [-1042.165] (-1038.975) (-1038.185) * (-1039.319) (-1038.850) (-1040.085) [-1039.612] -- 0:00:33
476000 -- (-1041.080) (-1043.981) (-1039.587) [-1038.641] * (-1039.954) [-1039.287] (-1041.422) (-1039.720) -- 0:00:33
476500 -- [-1039.803] (-1041.872) (-1040.666) (-1039.274) * [-1039.361] (-1040.254) (-1038.606) (-1039.574) -- 0:00:32
477000 -- (-1042.168) (-1041.181) (-1039.966) [-1041.276] * (-1043.231) (-1041.290) [-1042.620] (-1038.031) -- 0:00:32
477500 -- (-1039.646) [-1038.189] (-1040.174) (-1039.933) * [-1042.325] (-1040.913) (-1042.795) (-1039.281) -- 0:00:32
478000 -- (-1041.651) [-1039.217] (-1040.316) (-1040.539) * [-1040.274] (-1041.383) (-1048.717) (-1039.799) -- 0:00:32
478500 -- (-1042.511) (-1041.523) [-1039.011] (-1040.925) * [-1042.293] (-1041.200) (-1040.131) (-1047.174) -- 0:00:32
479000 -- [-1039.365] (-1040.545) (-1040.110) (-1040.477) * [-1040.252] (-1039.320) (-1038.860) (-1043.764) -- 0:00:32
479500 -- (-1038.619) [-1039.253] (-1043.747) (-1038.727) * [-1043.765] (-1045.085) (-1042.165) (-1040.047) -- 0:00:32
480000 -- (-1042.663) (-1040.250) (-1045.299) [-1040.527] * (-1042.724) (-1042.996) [-1039.244] (-1038.656) -- 0:00:32
Average standard deviation of split frequencies: 0.008892
480500 -- [-1038.958] (-1038.793) (-1039.464) (-1039.147) * [-1038.792] (-1040.722) (-1041.424) (-1039.177) -- 0:00:32
481000 -- (-1038.502) [-1039.211] (-1044.599) (-1038.906) * (-1039.568) (-1038.252) (-1038.703) [-1039.573] -- 0:00:32
481500 -- [-1038.033] (-1038.476) (-1039.414) (-1042.874) * (-1038.923) [-1038.464] (-1040.136) (-1039.997) -- 0:00:32
482000 -- (-1038.329) [-1039.142] (-1039.551) (-1039.551) * (-1040.543) [-1039.366] (-1040.388) (-1041.354) -- 0:00:32
482500 -- [-1039.017] (-1040.463) (-1042.050) (-1043.313) * (-1041.229) (-1039.431) (-1044.078) [-1038.266] -- 0:00:32
483000 -- (-1040.472) (-1040.029) [-1041.435] (-1043.608) * (-1039.623) (-1040.527) (-1040.187) [-1039.512] -- 0:00:32
483500 -- [-1042.402] (-1039.507) (-1040.806) (-1039.879) * (-1042.979) [-1041.108] (-1040.155) (-1038.814) -- 0:00:32
484000 -- (-1041.149) (-1039.150) (-1041.982) [-1040.698] * (-1044.127) [-1038.071] (-1041.677) (-1040.336) -- 0:00:31
484500 -- (-1040.038) [-1039.457] (-1040.825) (-1039.905) * [-1039.342] (-1041.210) (-1038.988) (-1040.785) -- 0:00:31
485000 -- (-1040.516) (-1039.244) (-1038.996) [-1038.879] * [-1042.722] (-1038.949) (-1040.341) (-1039.199) -- 0:00:32
Average standard deviation of split frequencies: 0.008471
485500 -- (-1040.823) (-1040.220) (-1040.704) [-1038.425] * [-1038.625] (-1039.929) (-1039.603) (-1038.540) -- 0:00:32
486000 -- [-1047.308] (-1042.962) (-1040.265) (-1043.385) * (-1038.936) (-1040.620) [-1040.139] (-1039.901) -- 0:00:32
486500 -- [-1039.999] (-1038.726) (-1040.049) (-1042.990) * (-1038.047) [-1039.205] (-1044.436) (-1039.116) -- 0:00:32
487000 -- (-1041.400) (-1038.033) (-1038.608) [-1041.522] * (-1040.102) (-1041.180) (-1038.905) [-1039.903] -- 0:00:32
487500 -- [-1040.857] (-1038.229) (-1040.305) (-1038.223) * [-1041.077] (-1039.436) (-1038.263) (-1039.181) -- 0:00:32
488000 -- (-1040.503) (-1039.471) (-1044.524) [-1038.446] * (-1038.773) [-1038.848] (-1042.053) (-1039.200) -- 0:00:32
488500 -- (-1039.824) (-1040.934) (-1039.995) [-1038.647] * (-1044.906) (-1040.641) (-1042.244) [-1040.184] -- 0:00:32
489000 -- (-1040.144) (-1039.758) (-1039.306) [-1039.499] * [-1041.139] (-1040.500) (-1040.506) (-1040.290) -- 0:00:32
489500 -- (-1038.685) [-1038.673] (-1038.494) (-1039.346) * [-1037.974] (-1040.845) (-1039.408) (-1039.393) -- 0:00:32
490000 -- [-1040.717] (-1038.099) (-1038.124) (-1037.841) * [-1040.016] (-1042.464) (-1038.611) (-1038.440) -- 0:00:32
Average standard deviation of split frequencies: 0.007942
490500 -- [-1039.164] (-1041.725) (-1038.208) (-1037.841) * [-1038.630] (-1038.404) (-1038.540) (-1039.214) -- 0:00:32
491000 -- (-1038.900) [-1041.014] (-1038.845) (-1039.928) * [-1041.386] (-1037.864) (-1039.526) (-1038.127) -- 0:00:32
491500 -- (-1040.885) (-1039.509) (-1043.766) [-1041.812] * (-1041.921) (-1039.127) (-1042.251) [-1039.159] -- 0:00:32
492000 -- (-1040.001) [-1040.191] (-1038.881) (-1041.842) * (-1040.817) (-1041.421) [-1039.287] (-1039.517) -- 0:00:32
492500 -- [-1039.692] (-1050.367) (-1040.108) (-1043.921) * [-1040.364] (-1043.301) (-1039.422) (-1040.442) -- 0:00:31
493000 -- [-1038.845] (-1039.556) (-1040.020) (-1040.409) * (-1040.526) (-1040.952) [-1041.827] (-1038.836) -- 0:00:31
493500 -- (-1039.326) [-1038.854] (-1039.168) (-1041.420) * (-1041.682) [-1038.540] (-1047.199) (-1040.069) -- 0:00:31
494000 -- (-1039.451) [-1039.448] (-1038.991) (-1042.575) * (-1038.217) (-1038.651) [-1040.656] (-1041.165) -- 0:00:31
494500 -- [-1038.369] (-1039.632) (-1038.758) (-1039.140) * [-1040.038] (-1041.006) (-1041.046) (-1040.993) -- 0:00:31
495000 -- (-1038.175) (-1042.204) (-1039.523) [-1039.203] * [-1039.877] (-1038.962) (-1041.301) (-1041.305) -- 0:00:31
Average standard deviation of split frequencies: 0.007730
495500 -- (-1038.983) (-1038.846) (-1039.343) [-1039.927] * [-1042.201] (-1039.861) (-1038.967) (-1038.735) -- 0:00:31
496000 -- (-1038.117) (-1040.182) (-1041.057) [-1042.631] * (-1040.384) (-1038.312) (-1038.580) [-1042.307] -- 0:00:31
496500 -- (-1040.309) (-1043.494) [-1040.104] (-1037.909) * [-1038.799] (-1039.934) (-1042.879) (-1045.848) -- 0:00:31
497000 -- [-1038.410] (-1042.441) (-1040.617) (-1041.138) * [-1041.399] (-1038.909) (-1038.560) (-1038.655) -- 0:00:31
497500 -- [-1040.413] (-1044.160) (-1040.125) (-1039.956) * [-1042.731] (-1040.488) (-1039.830) (-1039.795) -- 0:00:31
498000 -- (-1040.516) (-1041.295) [-1039.730] (-1041.066) * [-1042.613] (-1042.995) (-1040.539) (-1041.628) -- 0:00:32
498500 -- (-1039.574) (-1042.708) (-1040.795) [-1044.665] * (-1042.033) (-1041.909) (-1039.183) [-1040.706] -- 0:00:32
499000 -- (-1042.527) [-1039.532] (-1040.865) (-1038.187) * (-1040.855) (-1038.812) [-1041.366] (-1042.783) -- 0:00:32
499500 -- (-1040.436) (-1039.272) [-1039.474] (-1039.115) * (-1040.391) (-1039.653) (-1038.672) [-1040.288] -- 0:00:32
500000 -- [-1038.886] (-1041.294) (-1042.727) (-1043.154) * [-1039.154] (-1039.670) (-1038.158) (-1041.191) -- 0:00:32
Average standard deviation of split frequencies: 0.007156
500500 -- [-1038.225] (-1039.165) (-1039.626) (-1041.990) * (-1040.372) (-1041.612) [-1040.897] (-1039.385) -- 0:00:31
501000 -- (-1039.335) (-1039.188) (-1039.172) [-1041.964] * (-1039.593) (-1041.149) (-1039.883) [-1037.667] -- 0:00:31
501500 -- (-1040.837) [-1039.925] (-1040.986) (-1040.485) * [-1038.769] (-1045.547) (-1041.215) (-1039.577) -- 0:00:31
502000 -- [-1039.948] (-1037.999) (-1039.119) (-1039.769) * (-1039.065) (-1040.158) [-1038.914] (-1037.847) -- 0:00:31
502500 -- [-1040.363] (-1038.176) (-1039.983) (-1038.318) * (-1038.380) (-1042.179) (-1038.401) [-1041.344] -- 0:00:31
503000 -- (-1039.618) (-1039.666) [-1038.620] (-1040.740) * [-1040.328] (-1042.307) (-1038.541) (-1041.477) -- 0:00:31
503500 -- (-1039.803) (-1042.128) [-1040.618] (-1042.502) * (-1039.264) [-1041.855] (-1038.507) (-1040.269) -- 0:00:31
504000 -- [-1039.526] (-1041.081) (-1042.642) (-1042.903) * (-1040.570) (-1042.272) [-1038.244] (-1041.004) -- 0:00:31
504500 -- [-1038.938] (-1041.688) (-1042.324) (-1044.921) * [-1039.688] (-1041.741) (-1038.601) (-1038.675) -- 0:00:31
505000 -- (-1041.066) [-1039.246] (-1044.911) (-1040.428) * [-1038.525] (-1040.386) (-1039.278) (-1040.009) -- 0:00:31
Average standard deviation of split frequencies: 0.006521
505500 -- [-1040.120] (-1040.296) (-1038.382) (-1043.510) * (-1039.164) (-1040.498) (-1039.129) [-1040.122] -- 0:00:31
506000 -- [-1041.488] (-1040.494) (-1041.169) (-1043.417) * (-1042.599) [-1042.472] (-1038.397) (-1040.199) -- 0:00:31
506500 -- (-1042.053) [-1038.052] (-1039.566) (-1041.216) * (-1041.546) (-1044.349) (-1039.666) [-1039.228] -- 0:00:31
507000 -- (-1040.380) (-1039.593) (-1037.736) [-1039.883] * (-1040.377) (-1043.543) (-1043.244) [-1039.129] -- 0:00:31
507500 -- (-1040.852) [-1038.146] (-1039.493) (-1040.696) * (-1037.836) (-1039.685) (-1039.541) [-1039.424] -- 0:00:31
508000 -- (-1038.076) (-1037.816) [-1038.979] (-1042.596) * [-1040.300] (-1041.920) (-1043.183) (-1038.549) -- 0:00:30
508500 -- [-1039.146] (-1039.369) (-1038.236) (-1041.681) * (-1046.004) [-1042.988] (-1041.966) (-1038.291) -- 0:00:30
509000 -- (-1042.878) (-1042.039) [-1039.648] (-1039.815) * (-1045.831) [-1042.550] (-1040.453) (-1042.318) -- 0:00:30
509500 -- [-1040.089] (-1040.978) (-1043.008) (-1042.803) * (-1043.681) [-1041.138] (-1039.509) (-1041.883) -- 0:00:30
510000 -- (-1041.901) (-1038.049) [-1042.840] (-1045.982) * (-1040.454) [-1039.641] (-1038.827) (-1038.655) -- 0:00:30
Average standard deviation of split frequencies: 0.006339
510500 -- (-1040.758) [-1038.489] (-1046.153) (-1045.692) * (-1044.808) (-1042.673) (-1040.338) [-1040.089] -- 0:00:31
511000 -- (-1038.717) [-1040.380] (-1040.686) (-1039.445) * [-1039.223] (-1039.814) (-1038.967) (-1038.442) -- 0:00:31
511500 -- (-1038.665) [-1040.543] (-1039.514) (-1038.597) * (-1039.672) (-1039.023) [-1039.448] (-1040.249) -- 0:00:31
512000 -- (-1039.896) [-1039.206] (-1039.309) (-1039.106) * (-1038.529) (-1039.618) [-1041.473] (-1040.645) -- 0:00:31
512500 -- (-1045.415) [-1039.186] (-1039.277) (-1039.641) * (-1038.347) [-1038.890] (-1040.433) (-1038.555) -- 0:00:31
513000 -- (-1046.011) (-1039.678) (-1042.464) [-1037.760] * (-1038.483) (-1039.727) [-1042.169] (-1040.238) -- 0:00:31
513500 -- (-1045.173) (-1038.242) (-1039.957) [-1039.397] * (-1040.112) (-1041.252) (-1040.644) [-1039.109] -- 0:00:31
514000 -- (-1044.498) (-1040.158) [-1039.610] (-1042.251) * (-1038.862) [-1042.704] (-1040.434) (-1039.243) -- 0:00:31
514500 -- (-1040.679) [-1039.007] (-1039.647) (-1038.976) * (-1042.068) (-1043.512) (-1038.783) [-1039.182] -- 0:00:31
515000 -- (-1044.198) (-1037.965) (-1039.275) [-1038.872] * (-1039.407) (-1040.255) [-1040.155] (-1038.856) -- 0:00:31
Average standard deviation of split frequencies: 0.006030
515500 -- (-1045.294) (-1040.323) (-1043.216) [-1039.029] * (-1039.097) (-1039.614) (-1039.988) [-1039.368] -- 0:00:31
516000 -- (-1040.903) (-1038.526) [-1040.431] (-1039.729) * (-1039.186) [-1040.009] (-1040.944) (-1039.248) -- 0:00:30
516500 -- [-1041.268] (-1038.911) (-1039.993) (-1039.385) * (-1038.106) (-1038.579) (-1042.440) [-1039.021] -- 0:00:30
517000 -- (-1043.156) (-1038.027) [-1039.366] (-1038.192) * (-1038.368) (-1038.695) (-1041.268) [-1039.292] -- 0:00:30
517500 -- (-1039.634) (-1040.151) (-1041.530) [-1039.383] * (-1041.388) (-1039.862) (-1038.461) [-1038.595] -- 0:00:30
518000 -- (-1039.888) [-1042.010] (-1041.635) (-1045.144) * (-1040.362) (-1038.582) (-1042.166) [-1039.507] -- 0:00:30
518500 -- (-1046.438) (-1043.243) [-1040.711] (-1038.810) * (-1039.210) [-1038.299] (-1042.492) (-1039.303) -- 0:00:30
519000 -- (-1043.613) (-1043.750) [-1039.856] (-1041.712) * [-1039.207] (-1038.010) (-1040.105) (-1037.775) -- 0:00:30
519500 -- (-1038.434) (-1045.452) [-1039.624] (-1039.532) * [-1040.787] (-1041.286) (-1039.663) (-1039.011) -- 0:00:30
520000 -- (-1041.808) (-1042.965) [-1040.378] (-1041.010) * (-1041.192) [-1041.285] (-1044.471) (-1042.205) -- 0:00:30
Average standard deviation of split frequencies: 0.006519
520500 -- (-1039.122) [-1044.070] (-1038.364) (-1038.664) * (-1043.024) [-1040.904] (-1040.874) (-1041.162) -- 0:00:30
521000 -- (-1038.042) (-1040.664) (-1041.822) [-1039.261] * (-1040.712) (-1044.139) [-1040.513] (-1039.517) -- 0:00:30
521500 -- [-1040.026] (-1038.915) (-1038.756) (-1043.911) * (-1039.448) (-1039.500) [-1038.135] (-1040.086) -- 0:00:30
522000 -- (-1040.859) (-1039.338) (-1041.504) [-1042.861] * (-1038.961) (-1038.520) [-1037.932] (-1040.118) -- 0:00:30
522500 -- (-1045.494) [-1038.725] (-1041.166) (-1040.777) * [-1039.622] (-1039.488) (-1039.650) (-1038.672) -- 0:00:30
523000 -- [-1044.993] (-1038.528) (-1040.432) (-1037.698) * [-1041.588] (-1039.545) (-1039.379) (-1039.820) -- 0:00:30
523500 -- (-1040.633) (-1037.831) [-1041.422] (-1038.172) * [-1038.243] (-1038.096) (-1041.671) (-1038.427) -- 0:00:30
524000 -- [-1044.033] (-1039.741) (-1039.605) (-1040.270) * (-1038.313) [-1038.310] (-1040.674) (-1041.978) -- 0:00:29
524500 -- [-1038.451] (-1038.465) (-1040.240) (-1038.409) * (-1041.509) [-1038.319] (-1041.631) (-1040.018) -- 0:00:30
525000 -- (-1039.918) (-1039.067) (-1042.129) [-1040.215] * [-1038.001] (-1037.996) (-1039.403) (-1038.750) -- 0:00:30
Average standard deviation of split frequencies: 0.006214
525500 -- (-1038.708) (-1043.332) (-1042.984) [-1038.779] * (-1038.029) [-1038.499] (-1042.609) (-1040.463) -- 0:00:30
526000 -- [-1038.664] (-1045.286) (-1043.583) (-1038.503) * (-1038.607) (-1039.671) (-1040.578) [-1041.128] -- 0:00:30
526500 -- (-1042.420) (-1041.647) (-1040.457) [-1039.613] * [-1040.030] (-1039.410) (-1043.616) (-1039.526) -- 0:00:30
527000 -- (-1040.366) [-1041.406] (-1039.908) (-1039.127) * (-1038.451) [-1038.622] (-1044.716) (-1039.477) -- 0:00:30
527500 -- [-1039.142] (-1042.951) (-1039.133) (-1038.005) * [-1038.411] (-1039.037) (-1039.966) (-1039.426) -- 0:00:30
528000 -- (-1040.884) [-1042.274] (-1038.238) (-1038.512) * (-1038.000) (-1040.328) [-1044.639] (-1039.566) -- 0:00:30
528500 -- (-1038.764) [-1040.812] (-1040.249) (-1039.017) * (-1039.866) (-1041.226) [-1038.021] (-1039.096) -- 0:00:30
529000 -- (-1040.621) [-1038.958] (-1040.505) (-1038.215) * [-1038.693] (-1040.246) (-1039.425) (-1040.619) -- 0:00:30
529500 -- (-1039.940) [-1040.435] (-1040.008) (-1039.391) * [-1039.439] (-1042.548) (-1040.557) (-1042.698) -- 0:00:30
530000 -- (-1038.900) (-1038.021) [-1038.169] (-1039.203) * (-1043.193) (-1040.972) (-1041.238) [-1042.366] -- 0:00:30
Average standard deviation of split frequencies: 0.006455
530500 -- (-1041.205) (-1038.712) [-1038.843] (-1039.879) * (-1039.383) (-1039.237) (-1038.223) [-1038.102] -- 0:00:30
531000 -- (-1040.285) (-1040.793) (-1039.247) [-1038.205] * (-1037.845) (-1039.308) (-1037.707) [-1039.174] -- 0:00:30
531500 -- (-1040.672) (-1041.229) [-1039.785] (-1038.286) * (-1040.887) [-1040.809] (-1039.478) (-1039.860) -- 0:00:29
532000 -- [-1038.725] (-1039.848) (-1041.015) (-1038.381) * (-1040.408) [-1039.836] (-1038.744) (-1042.719) -- 0:00:29
532500 -- (-1038.289) (-1043.209) (-1038.257) [-1038.534] * (-1039.610) [-1039.639] (-1038.808) (-1039.265) -- 0:00:29
533000 -- [-1038.512] (-1042.796) (-1039.503) (-1038.692) * (-1039.171) (-1040.105) [-1038.514] (-1038.295) -- 0:00:29
533500 -- (-1038.084) (-1043.013) (-1040.342) [-1038.821] * (-1038.819) (-1038.661) (-1039.343) [-1038.526] -- 0:00:29
534000 -- (-1038.088) (-1041.091) [-1038.679] (-1038.728) * (-1038.382) (-1038.442) (-1037.673) [-1038.616] -- 0:00:29
534500 -- (-1043.231) [-1038.504] (-1040.422) (-1041.737) * (-1038.620) [-1038.764] (-1039.906) (-1038.680) -- 0:00:29
535000 -- [-1038.921] (-1039.124) (-1042.977) (-1039.728) * [-1044.998] (-1038.374) (-1038.747) (-1045.635) -- 0:00:29
Average standard deviation of split frequencies: 0.006274
535500 -- [-1038.468] (-1039.701) (-1042.243) (-1038.516) * (-1047.463) [-1041.372] (-1038.458) (-1043.196) -- 0:00:29
536000 -- [-1038.168] (-1038.090) (-1039.965) (-1042.123) * (-1039.950) [-1039.875] (-1038.598) (-1039.244) -- 0:00:29
536500 -- (-1040.428) (-1041.965) (-1042.194) [-1039.113] * (-1040.627) (-1039.646) [-1039.276] (-1040.100) -- 0:00:29
537000 -- [-1041.570] (-1038.644) (-1042.002) (-1040.065) * [-1039.195] (-1043.068) (-1039.652) (-1044.237) -- 0:00:29
537500 -- (-1043.821) [-1038.542] (-1040.006) (-1041.312) * (-1038.661) [-1040.188] (-1039.191) (-1041.401) -- 0:00:29
538000 -- (-1041.721) [-1039.765] (-1040.376) (-1040.672) * (-1038.046) [-1038.782] (-1041.502) (-1046.246) -- 0:00:29
538500 -- (-1043.685) (-1039.177) [-1041.095] (-1040.188) * (-1038.241) (-1040.833) (-1045.889) [-1041.222] -- 0:00:29
539000 -- (-1040.250) (-1038.740) (-1043.603) [-1039.710] * (-1038.561) (-1040.450) [-1039.501] (-1039.371) -- 0:00:29
539500 -- (-1040.859) [-1042.130] (-1041.717) (-1039.630) * [-1038.648] (-1041.880) (-1040.816) (-1043.809) -- 0:00:29
540000 -- (-1039.605) (-1042.130) [-1040.964] (-1042.448) * (-1040.618) [-1039.857] (-1042.717) (-1044.717) -- 0:00:29
Average standard deviation of split frequencies: 0.006975
540500 -- (-1038.257) (-1039.883) (-1038.545) [-1044.118] * (-1043.321) (-1041.175) (-1039.529) [-1044.763] -- 0:00:29
541000 -- [-1040.289] (-1038.684) (-1043.759) (-1043.264) * (-1045.386) [-1038.651] (-1039.519) (-1045.954) -- 0:00:29
541500 -- (-1041.366) (-1038.847) (-1040.818) [-1041.473] * (-1042.518) (-1039.460) (-1039.250) [-1039.867] -- 0:00:29
542000 -- [-1040.390] (-1038.916) (-1040.533) (-1039.363) * (-1042.145) (-1039.285) (-1037.906) [-1038.523] -- 0:00:29
542500 -- (-1040.220) [-1040.552] (-1040.729) (-1040.292) * (-1040.013) [-1040.136] (-1041.111) (-1040.638) -- 0:00:29
543000 -- (-1038.302) (-1041.225) (-1043.729) [-1039.031] * (-1039.753) (-1042.040) [-1040.449] (-1038.172) -- 0:00:29
543500 -- (-1040.195) [-1038.234] (-1039.370) (-1040.395) * (-1039.883) (-1038.910) [-1038.653] (-1041.950) -- 0:00:29
544000 -- (-1042.627) (-1038.905) [-1040.784] (-1038.330) * (-1040.173) (-1039.232) (-1041.844) [-1038.083] -- 0:00:29
544500 -- (-1039.662) (-1039.827) [-1041.265] (-1038.754) * (-1039.618) (-1038.541) (-1042.448) [-1038.184] -- 0:00:29
545000 -- [-1039.042] (-1042.071) (-1039.171) (-1038.564) * [-1040.810] (-1038.947) (-1041.544) (-1038.647) -- 0:00:29
Average standard deviation of split frequencies: 0.006734
545500 -- [-1038.935] (-1037.692) (-1040.813) (-1045.568) * (-1039.361) [-1040.099] (-1040.985) (-1039.268) -- 0:00:29
546000 -- [-1040.544] (-1037.764) (-1039.023) (-1041.450) * [-1042.008] (-1040.386) (-1039.460) (-1045.536) -- 0:00:29
546500 -- (-1039.930) (-1038.008) [-1041.019] (-1038.660) * (-1039.110) (-1038.968) [-1040.563] (-1041.348) -- 0:00:29
547000 -- (-1039.627) (-1038.059) [-1038.769] (-1038.944) * [-1038.398] (-1040.937) (-1040.130) (-1042.824) -- 0:00:28
547500 -- (-1040.083) (-1042.271) (-1039.501) [-1038.578] * (-1038.727) [-1037.834] (-1039.407) (-1038.779) -- 0:00:28
548000 -- (-1041.411) (-1046.111) [-1040.427] (-1038.682) * (-1040.829) (-1038.052) [-1041.248] (-1039.696) -- 0:00:28
548500 -- (-1040.112) (-1040.813) [-1043.920] (-1040.325) * (-1039.819) [-1039.433] (-1038.581) (-1038.749) -- 0:00:28
549000 -- (-1040.492) (-1039.691) (-1041.629) [-1040.320] * (-1037.947) [-1041.699] (-1038.636) (-1039.694) -- 0:00:28
549500 -- (-1041.203) [-1040.378] (-1042.686) (-1042.956) * (-1038.039) (-1039.422) [-1040.117] (-1039.964) -- 0:00:28
550000 -- [-1039.832] (-1045.345) (-1043.785) (-1039.400) * (-1041.884) [-1039.400] (-1041.066) (-1042.187) -- 0:00:28
Average standard deviation of split frequencies: 0.007476
550500 -- (-1039.778) (-1039.715) [-1041.178] (-1040.090) * (-1040.143) (-1040.910) [-1038.326] (-1043.262) -- 0:00:28
551000 -- (-1038.880) (-1045.740) [-1040.014] (-1038.250) * (-1045.405) (-1039.013) [-1038.893] (-1043.007) -- 0:00:28
551500 -- [-1040.546] (-1040.811) (-1038.318) (-1039.417) * (-1043.691) [-1041.429] (-1044.206) (-1047.378) -- 0:00:28
552000 -- (-1043.966) [-1039.430] (-1040.286) (-1045.329) * (-1042.727) (-1040.837) [-1044.698] (-1042.374) -- 0:00:28
552500 -- (-1039.535) (-1042.673) (-1039.346) [-1040.581] * (-1038.710) (-1040.078) (-1041.606) [-1043.319] -- 0:00:28
553000 -- (-1040.317) (-1042.083) (-1042.008) [-1039.356] * [-1038.823] (-1038.358) (-1041.088) (-1041.681) -- 0:00:28
553500 -- (-1039.870) [-1039.846] (-1043.547) (-1044.673) * (-1040.290) (-1039.065) (-1044.338) [-1037.988] -- 0:00:28
554000 -- (-1040.692) (-1038.579) [-1037.976] (-1039.843) * [-1038.459] (-1040.271) (-1044.220) (-1037.710) -- 0:00:28
554500 -- (-1040.619) (-1038.782) (-1038.057) [-1040.573] * (-1040.050) (-1039.006) (-1046.632) [-1039.911] -- 0:00:28
555000 -- (-1039.754) (-1040.435) [-1040.247] (-1038.211) * (-1040.103) (-1039.397) [-1044.253] (-1043.123) -- 0:00:28
Average standard deviation of split frequencies: 0.007122
555500 -- (-1039.399) (-1040.054) [-1043.132] (-1039.593) * (-1041.706) (-1039.855) (-1040.798) [-1040.146] -- 0:00:28
556000 -- (-1042.189) (-1041.140) [-1040.293] (-1038.631) * (-1042.394) (-1038.842) (-1039.419) [-1041.746] -- 0:00:27
556500 -- (-1041.008) [-1039.839] (-1039.890) (-1038.335) * (-1038.876) (-1037.777) (-1039.499) [-1038.400] -- 0:00:28
557000 -- [-1038.974] (-1041.565) (-1039.890) (-1038.118) * [-1039.367] (-1037.826) (-1040.510) (-1038.587) -- 0:00:28
557500 -- (-1038.828) (-1038.585) [-1040.443] (-1039.425) * (-1041.407) [-1038.216] (-1040.834) (-1040.881) -- 0:00:28
558000 -- (-1039.041) (-1038.514) [-1038.463] (-1041.006) * (-1039.889) (-1038.859) [-1041.298] (-1039.628) -- 0:00:28
558500 -- [-1042.986] (-1040.382) (-1038.462) (-1040.445) * [-1038.883] (-1038.161) (-1043.564) (-1039.506) -- 0:00:28
559000 -- (-1039.681) (-1040.250) [-1038.222] (-1042.670) * [-1038.319] (-1040.187) (-1041.561) (-1043.016) -- 0:00:28
559500 -- (-1040.122) [-1042.185] (-1039.362) (-1045.616) * (-1040.377) [-1040.896] (-1042.514) (-1044.244) -- 0:00:28
560000 -- (-1037.736) (-1041.896) (-1038.588) [-1039.470] * (-1038.473) (-1038.334) (-1042.395) [-1042.141] -- 0:00:28
Average standard deviation of split frequencies: 0.006895
560500 -- (-1040.164) [-1043.024] (-1043.403) (-1038.313) * (-1040.463) (-1045.501) [-1039.437] (-1041.956) -- 0:00:28
561000 -- [-1040.537] (-1039.149) (-1042.595) (-1041.310) * (-1040.381) (-1044.361) [-1038.989] (-1045.002) -- 0:00:28
561500 -- (-1039.583) (-1043.473) [-1040.522] (-1040.186) * [-1039.268] (-1044.243) (-1042.146) (-1041.581) -- 0:00:28
562000 -- (-1047.180) [-1037.984] (-1038.169) (-1038.601) * [-1039.634] (-1042.977) (-1041.983) (-1043.101) -- 0:00:28
562500 -- (-1046.262) (-1037.984) (-1038.837) [-1038.822] * (-1040.950) (-1042.388) (-1040.586) [-1045.179] -- 0:00:28
563000 -- (-1046.497) (-1039.482) [-1039.793] (-1042.423) * (-1040.584) [-1038.714] (-1039.165) (-1041.338) -- 0:00:27
563500 -- (-1044.886) (-1039.481) (-1043.333) [-1042.733] * (-1039.099) [-1039.426] (-1043.170) (-1040.466) -- 0:00:27
564000 -- (-1042.726) (-1039.432) (-1041.894) [-1039.488] * [-1038.316] (-1040.683) (-1043.152) (-1039.882) -- 0:00:27
564500 -- (-1039.525) (-1039.980) [-1039.514] (-1039.526) * (-1038.166) (-1038.895) [-1039.493] (-1039.705) -- 0:00:27
565000 -- (-1039.023) (-1039.301) [-1041.287] (-1041.817) * (-1038.374) (-1038.902) [-1040.239] (-1038.718) -- 0:00:27
Average standard deviation of split frequencies: 0.008016
565500 -- (-1040.604) [-1040.914] (-1041.355) (-1041.108) * (-1038.046) (-1041.531) (-1044.281) [-1039.234] -- 0:00:27
566000 -- (-1040.753) [-1038.747] (-1038.054) (-1040.361) * (-1039.056) (-1038.538) [-1042.038] (-1044.651) -- 0:00:27
566500 -- (-1040.366) [-1039.097] (-1041.607) (-1040.208) * (-1039.383) (-1039.298) [-1038.216] (-1041.291) -- 0:00:27
567000 -- (-1040.237) [-1038.092] (-1041.022) (-1039.488) * (-1039.447) (-1038.600) [-1042.740] (-1039.453) -- 0:00:27
567500 -- (-1041.562) (-1040.748) (-1039.888) [-1040.343] * (-1040.306) (-1043.125) (-1043.281) [-1039.182] -- 0:00:27
568000 -- (-1040.986) (-1039.623) [-1039.928] (-1038.650) * (-1038.879) [-1042.480] (-1042.681) (-1039.378) -- 0:00:27
568500 -- (-1040.648) (-1041.708) (-1040.486) [-1037.568] * (-1039.850) (-1041.091) (-1040.015) [-1037.860] -- 0:00:27
569000 -- (-1041.606) (-1041.895) (-1043.610) [-1039.402] * [-1038.553] (-1042.902) (-1041.448) (-1038.603) -- 0:00:27
569500 -- (-1045.045) (-1042.520) (-1039.819) [-1040.266] * (-1040.065) [-1040.068] (-1038.767) (-1039.195) -- 0:00:27
570000 -- (-1042.036) (-1039.771) [-1038.663] (-1038.206) * (-1039.059) (-1042.037) (-1040.836) [-1038.449] -- 0:00:27
Average standard deviation of split frequencies: 0.007545
570500 -- (-1041.648) (-1039.805) (-1039.970) [-1039.745] * (-1041.454) (-1040.907) [-1040.736] (-1038.565) -- 0:00:27
571000 -- [-1039.619] (-1042.487) (-1039.691) (-1040.741) * (-1040.217) (-1042.221) [-1040.920] (-1039.921) -- 0:00:27
571500 -- (-1043.619) (-1041.912) (-1037.848) [-1041.269] * (-1039.700) [-1039.446] (-1039.958) (-1039.737) -- 0:00:26
572000 -- (-1041.407) [-1042.504] (-1038.765) (-1042.679) * (-1040.577) (-1038.870) [-1039.200] (-1044.074) -- 0:00:26
572500 -- (-1041.161) (-1040.406) [-1038.160] (-1038.618) * [-1040.760] (-1039.433) (-1043.060) (-1040.896) -- 0:00:27
573000 -- [-1038.307] (-1041.989) (-1038.058) (-1049.109) * (-1039.672) (-1041.390) (-1042.170) [-1043.215] -- 0:00:27
573500 -- [-1040.713] (-1039.907) (-1040.143) (-1041.072) * (-1038.768) (-1041.016) [-1041.870] (-1038.778) -- 0:00:27
574000 -- (-1039.913) (-1039.682) [-1039.489] (-1041.080) * (-1039.907) [-1044.925] (-1037.750) (-1043.208) -- 0:00:27
574500 -- (-1040.328) (-1039.075) [-1042.689] (-1039.865) * (-1039.021) (-1043.667) [-1040.461] (-1042.382) -- 0:00:27
575000 -- (-1040.437) [-1039.773] (-1038.373) (-1043.532) * (-1040.195) (-1042.383) (-1038.232) [-1041.751] -- 0:00:27
Average standard deviation of split frequencies: 0.008951
575500 -- (-1039.875) [-1041.520] (-1046.132) (-1045.559) * (-1039.393) [-1039.139] (-1040.538) (-1040.263) -- 0:00:27
576000 -- (-1041.079) [-1040.837] (-1042.678) (-1039.811) * (-1038.594) [-1038.874] (-1040.534) (-1042.316) -- 0:00:27
576500 -- (-1038.577) (-1040.205) (-1044.160) [-1040.700] * (-1039.403) (-1040.547) [-1039.720] (-1040.151) -- 0:00:27
577000 -- (-1039.722) (-1039.783) (-1044.366) [-1038.137] * [-1039.597] (-1038.354) (-1039.433) (-1039.317) -- 0:00:27
577500 -- [-1039.457] (-1042.182) (-1041.307) (-1038.647) * (-1039.465) (-1037.986) (-1039.027) [-1039.415] -- 0:00:27
578000 -- [-1039.874] (-1038.249) (-1043.756) (-1041.159) * (-1038.727) [-1039.760] (-1046.421) (-1041.667) -- 0:00:27
578500 -- [-1043.142] (-1037.883) (-1039.711) (-1045.115) * (-1040.961) (-1039.452) (-1044.639) [-1038.845] -- 0:00:26
579000 -- (-1044.918) (-1045.968) (-1039.443) [-1039.479] * (-1039.177) (-1043.762) (-1044.277) [-1040.008] -- 0:00:26
579500 -- (-1039.513) [-1038.940] (-1040.713) (-1039.681) * (-1040.148) (-1042.852) [-1040.656] (-1039.548) -- 0:00:26
580000 -- (-1039.115) [-1043.943] (-1042.266) (-1039.615) * (-1046.895) [-1039.501] (-1040.433) (-1041.596) -- 0:00:26
Average standard deviation of split frequencies: 0.006819
580500 -- (-1039.344) (-1039.591) (-1039.475) [-1039.545] * (-1041.932) [-1046.233] (-1038.261) (-1038.968) -- 0:00:26
581000 -- [-1038.457] (-1041.850) (-1039.751) (-1040.167) * [-1039.152] (-1041.220) (-1043.751) (-1039.187) -- 0:00:26
581500 -- (-1038.627) [-1039.800] (-1040.612) (-1039.507) * (-1042.051) (-1038.196) (-1043.286) [-1039.311] -- 0:00:26
582000 -- [-1039.372] (-1039.895) (-1038.921) (-1042.725) * (-1043.139) (-1040.446) (-1046.559) [-1042.232] -- 0:00:26
582500 -- (-1045.272) [-1038.983] (-1040.808) (-1042.489) * (-1039.167) (-1038.981) (-1040.049) [-1041.306] -- 0:00:26
583000 -- (-1042.643) (-1039.734) (-1038.633) [-1041.945] * (-1039.809) [-1038.246] (-1039.715) (-1041.743) -- 0:00:26
583500 -- (-1041.945) [-1039.980] (-1038.152) (-1044.666) * (-1038.318) (-1041.636) [-1041.176] (-1039.337) -- 0:00:26
584000 -- [-1038.349] (-1041.142) (-1039.520) (-1040.486) * [-1038.178] (-1039.142) (-1039.283) (-1042.586) -- 0:00:26
584500 -- (-1038.415) [-1040.855] (-1042.375) (-1039.584) * (-1038.108) [-1039.067] (-1041.004) (-1041.599) -- 0:00:26
585000 -- (-1040.040) (-1039.493) [-1037.949] (-1040.402) * (-1038.791) (-1042.608) (-1039.549) [-1038.791] -- 0:00:26
Average standard deviation of split frequencies: 0.007793
585500 -- (-1038.708) [-1038.413] (-1038.075) (-1040.094) * (-1040.038) (-1038.900) (-1038.990) [-1039.452] -- 0:00:26
586000 -- (-1038.842) [-1042.335] (-1039.212) (-1043.297) * (-1039.167) [-1038.285] (-1048.539) (-1040.113) -- 0:00:26
586500 -- [-1040.341] (-1037.887) (-1038.594) (-1042.861) * [-1039.166] (-1039.325) (-1039.242) (-1038.689) -- 0:00:26
587000 -- (-1038.652) [-1041.170] (-1043.564) (-1040.645) * [-1044.840] (-1039.612) (-1040.171) (-1038.571) -- 0:00:26
587500 -- [-1039.796] (-1038.442) (-1037.985) (-1038.892) * [-1041.107] (-1041.028) (-1038.930) (-1038.805) -- 0:00:25
588000 -- (-1039.963) (-1038.423) (-1045.179) [-1039.088] * [-1038.509] (-1039.621) (-1038.897) (-1038.344) -- 0:00:25
588500 -- (-1039.700) [-1040.182] (-1044.702) (-1039.017) * (-1037.992) [-1039.438] (-1043.871) (-1038.788) -- 0:00:25
589000 -- (-1040.721) (-1039.603) (-1040.936) [-1040.086] * (-1042.547) (-1038.438) [-1041.238] (-1039.181) -- 0:00:26
589500 -- (-1039.491) (-1040.914) (-1043.503) [-1040.712] * [-1041.381] (-1039.926) (-1038.484) (-1038.141) -- 0:00:26
590000 -- [-1040.522] (-1041.649) (-1041.409) (-1039.832) * (-1044.318) (-1042.589) (-1038.853) [-1038.141] -- 0:00:26
Average standard deviation of split frequencies: 0.006917
590500 -- (-1045.558) (-1042.946) (-1042.910) [-1039.133] * [-1039.931] (-1038.422) (-1038.493) (-1038.196) -- 0:00:26
591000 -- (-1043.863) (-1043.249) (-1039.037) [-1039.564] * (-1042.083) (-1039.820) (-1040.736) [-1039.627] -- 0:00:26
591500 -- (-1042.041) (-1042.406) [-1040.052] (-1041.410) * (-1038.323) (-1041.086) (-1039.948) [-1038.803] -- 0:00:26
592000 -- (-1040.070) (-1042.270) (-1040.111) [-1038.563] * (-1039.862) [-1044.350] (-1039.886) (-1040.985) -- 0:00:26
592500 -- (-1041.024) (-1038.957) (-1040.164) [-1038.850] * (-1038.623) (-1041.950) (-1038.718) [-1046.888] -- 0:00:26
593000 -- (-1038.935) (-1039.991) (-1039.371) [-1039.893] * (-1040.838) (-1037.979) [-1040.316] (-1047.991) -- 0:00:26
593500 -- (-1044.016) (-1040.310) (-1039.623) [-1038.870] * (-1041.096) [-1039.272] (-1040.867) (-1038.131) -- 0:00:26
594000 -- [-1041.672] (-1040.065) (-1040.516) (-1038.315) * (-1043.188) (-1043.464) (-1042.660) [-1039.578] -- 0:00:25
594500 -- (-1040.978) [-1039.535] (-1039.927) (-1039.342) * (-1048.914) [-1040.620] (-1050.432) (-1041.404) -- 0:00:25
595000 -- (-1039.086) (-1042.429) [-1038.339] (-1043.376) * (-1046.682) [-1042.841] (-1045.437) (-1039.719) -- 0:00:25
Average standard deviation of split frequencies: 0.007435
595500 -- (-1038.827) (-1038.567) (-1038.701) [-1040.436] * (-1044.529) [-1038.828] (-1042.956) (-1041.457) -- 0:00:25
596000 -- [-1040.563] (-1041.563) (-1039.492) (-1040.894) * [-1039.075] (-1040.273) (-1041.214) (-1039.022) -- 0:00:25
596500 -- (-1041.056) (-1038.691) (-1040.492) [-1038.342] * (-1040.667) (-1039.639) (-1040.036) [-1039.699] -- 0:00:25
597000 -- (-1040.947) [-1041.130] (-1038.889) (-1041.042) * (-1041.075) (-1038.481) (-1038.204) [-1037.888] -- 0:00:25
597500 -- [-1042.421] (-1038.140) (-1038.414) (-1042.429) * (-1039.505) (-1041.474) (-1037.737) [-1039.622] -- 0:00:25
598000 -- (-1038.332) [-1040.929] (-1039.390) (-1040.090) * (-1041.502) (-1038.898) [-1038.546] (-1037.719) -- 0:00:25
598500 -- [-1038.119] (-1039.071) (-1041.372) (-1042.481) * (-1044.344) (-1039.990) (-1038.697) [-1038.697] -- 0:00:25
599000 -- (-1038.048) [-1038.297] (-1039.630) (-1042.011) * (-1041.321) [-1041.522] (-1038.736) (-1037.994) -- 0:00:25
599500 -- [-1038.054] (-1039.087) (-1039.510) (-1040.860) * [-1037.777] (-1041.531) (-1040.430) (-1037.820) -- 0:00:25
600000 -- [-1038.639] (-1039.162) (-1040.117) (-1040.668) * (-1039.705) (-1039.960) (-1043.778) [-1038.595] -- 0:00:25
Average standard deviation of split frequencies: 0.007953
600500 -- (-1038.978) (-1037.945) (-1042.623) [-1039.542] * (-1040.150) [-1041.902] (-1043.180) (-1039.628) -- 0:00:25
601000 -- [-1038.978] (-1038.824) (-1040.026) (-1041.215) * (-1040.099) (-1040.081) [-1043.052] (-1039.233) -- 0:00:25
601500 -- (-1040.263) (-1038.896) [-1040.569] (-1041.354) * (-1038.599) [-1039.459] (-1042.182) (-1039.793) -- 0:00:25
602000 -- (-1042.964) (-1042.402) [-1041.105] (-1039.507) * [-1042.623] (-1045.038) (-1039.907) (-1039.929) -- 0:00:25
602500 -- [-1040.766] (-1040.876) (-1039.768) (-1040.087) * [-1040.479] (-1044.688) (-1040.849) (-1040.305) -- 0:00:25
603000 -- (-1042.633) (-1040.905) [-1038.492] (-1039.962) * (-1038.543) [-1040.661] (-1038.710) (-1042.759) -- 0:00:25
603500 -- (-1038.477) (-1041.084) [-1039.793] (-1040.566) * [-1039.155] (-1039.358) (-1038.710) (-1039.331) -- 0:00:24
604000 -- (-1040.802) (-1041.215) [-1041.086] (-1044.307) * (-1038.323) (-1040.003) (-1037.945) [-1042.148] -- 0:00:24
604500 -- (-1043.270) [-1039.974] (-1040.731) (-1043.948) * (-1040.056) (-1039.204) [-1038.042] (-1038.232) -- 0:00:25
605000 -- (-1043.113) (-1039.593) [-1040.021] (-1039.504) * (-1039.163) (-1040.372) [-1037.970] (-1038.531) -- 0:00:25
Average standard deviation of split frequencies: 0.008298
605500 -- (-1044.416) [-1039.653] (-1038.401) (-1040.352) * (-1042.014) (-1043.260) [-1038.423] (-1041.047) -- 0:00:25
606000 -- (-1040.327) (-1044.569) (-1041.062) [-1039.433] * [-1040.685] (-1042.946) (-1039.838) (-1039.517) -- 0:00:25
606500 -- (-1041.819) [-1040.257] (-1041.157) (-1041.276) * (-1042.615) (-1040.676) [-1039.394] (-1040.987) -- 0:00:25
607000 -- (-1041.851) (-1039.869) [-1039.355] (-1041.165) * (-1039.813) [-1039.487] (-1039.679) (-1044.557) -- 0:00:25
607500 -- (-1039.440) (-1039.076) [-1042.150] (-1039.528) * (-1038.679) (-1039.483) [-1038.483] (-1042.321) -- 0:00:25
608000 -- (-1040.217) (-1038.468) (-1040.951) [-1038.362] * (-1038.827) (-1038.297) (-1038.430) [-1039.398] -- 0:00:25
608500 -- (-1039.222) [-1041.326] (-1046.254) (-1040.248) * [-1039.348] (-1040.075) (-1047.291) (-1040.168) -- 0:00:25
609000 -- (-1040.670) (-1040.477) (-1038.225) [-1038.483] * [-1038.358] (-1040.606) (-1038.689) (-1039.368) -- 0:00:25
609500 -- (-1039.747) (-1042.036) (-1039.682) [-1039.547] * (-1045.657) [-1040.912] (-1041.124) (-1045.384) -- 0:00:24
610000 -- (-1039.886) [-1039.282] (-1041.996) (-1042.996) * (-1041.404) [-1039.721] (-1041.929) (-1040.685) -- 0:00:24
Average standard deviation of split frequencies: 0.008286
610500 -- [-1039.232] (-1041.117) (-1038.281) (-1039.608) * (-1040.695) [-1038.536] (-1041.703) (-1041.255) -- 0:00:24
611000 -- [-1039.450] (-1040.067) (-1038.688) (-1040.351) * (-1040.345) (-1040.524) [-1041.549] (-1044.268) -- 0:00:24
611500 -- [-1039.113] (-1041.736) (-1042.864) (-1039.958) * (-1039.853) (-1038.511) (-1039.293) [-1040.565] -- 0:00:24
612000 -- [-1038.509] (-1039.915) (-1039.199) (-1038.900) * [-1042.325] (-1038.301) (-1041.730) (-1040.275) -- 0:00:24
612500 -- (-1038.897) (-1039.832) [-1042.607] (-1038.881) * (-1044.776) [-1039.028] (-1038.845) (-1038.761) -- 0:00:24
613000 -- (-1039.787) (-1042.376) [-1038.656] (-1039.114) * (-1039.544) [-1039.160] (-1039.378) (-1040.978) -- 0:00:24
613500 -- (-1039.808) (-1039.238) (-1044.425) [-1038.432] * (-1040.310) (-1040.718) (-1039.925) [-1038.850] -- 0:00:24
614000 -- (-1040.931) (-1038.688) [-1039.873] (-1042.041) * (-1040.278) (-1039.339) [-1041.541] (-1043.740) -- 0:00:24
614500 -- (-1039.228) [-1038.708] (-1041.558) (-1041.079) * (-1039.938) (-1038.216) [-1043.614] (-1047.326) -- 0:00:24
615000 -- (-1041.600) [-1038.783] (-1037.847) (-1038.949) * [-1038.930] (-1038.882) (-1042.333) (-1042.800) -- 0:00:24
Average standard deviation of split frequencies: 0.008316
615500 -- [-1039.628] (-1038.456) (-1040.146) (-1040.375) * (-1040.478) (-1040.153) (-1044.238) [-1041.416] -- 0:00:24
616000 -- (-1040.203) (-1041.373) (-1041.563) [-1042.419] * (-1038.562) (-1041.328) [-1044.070] (-1040.837) -- 0:00:24
616500 -- (-1040.414) [-1040.354] (-1041.984) (-1040.611) * (-1038.789) (-1040.789) [-1040.380] (-1038.420) -- 0:00:24
617000 -- (-1042.678) (-1038.784) (-1042.298) [-1039.199] * [-1038.375] (-1039.221) (-1043.708) (-1038.033) -- 0:00:24
617500 -- (-1043.836) (-1039.778) [-1040.937] (-1040.635) * (-1038.795) [-1040.292] (-1041.685) (-1045.065) -- 0:00:24
618000 -- (-1039.558) [-1040.398] (-1041.523) (-1041.402) * (-1038.969) [-1039.371] (-1039.949) (-1042.668) -- 0:00:24
618500 -- [-1039.375] (-1041.145) (-1038.608) (-1041.115) * (-1038.057) (-1040.873) [-1041.013] (-1039.920) -- 0:00:24
619000 -- (-1038.755) (-1037.942) (-1043.793) [-1043.916] * (-1038.020) [-1039.536] (-1046.767) (-1041.614) -- 0:00:24
619500 -- (-1039.040) [-1040.616] (-1040.696) (-1041.265) * (-1041.537) [-1040.244] (-1042.846) (-1041.250) -- 0:00:23
620000 -- (-1038.939) [-1040.344] (-1039.280) (-1040.832) * [-1039.179] (-1037.904) (-1039.897) (-1040.967) -- 0:00:23
Average standard deviation of split frequencies: 0.007899
620500 -- (-1039.138) (-1040.355) (-1039.201) [-1039.570] * [-1039.506] (-1038.392) (-1038.912) (-1040.200) -- 0:00:23
621000 -- (-1040.180) (-1039.270) (-1039.397) [-1040.444] * (-1040.833) (-1040.478) (-1042.789) [-1039.446] -- 0:00:23
621500 -- (-1040.841) (-1048.925) (-1039.078) [-1038.740] * (-1037.831) [-1039.570] (-1043.189) (-1038.594) -- 0:00:24
622000 -- (-1041.184) (-1043.003) (-1043.653) [-1040.077] * (-1037.763) (-1039.311) [-1039.563] (-1038.369) -- 0:00:24
622500 -- (-1040.959) (-1041.484) (-1046.216) [-1040.942] * (-1040.160) (-1039.609) (-1038.516) [-1039.082] -- 0:00:24
623000 -- (-1040.287) [-1038.630] (-1040.705) (-1038.657) * [-1041.458] (-1039.441) (-1037.778) (-1038.470) -- 0:00:24
623500 -- (-1041.804) (-1041.492) [-1039.014] (-1038.993) * (-1038.886) [-1038.297] (-1039.443) (-1038.247) -- 0:00:24
624000 -- (-1041.385) (-1040.860) (-1040.765) [-1039.495] * (-1039.426) [-1039.781] (-1039.974) (-1039.064) -- 0:00:24
624500 -- (-1042.025) (-1040.187) [-1040.096] (-1039.562) * (-1040.859) (-1041.742) [-1038.563] (-1040.056) -- 0:00:24
625000 -- (-1039.710) [-1039.062] (-1042.345) (-1043.872) * (-1040.950) [-1041.341] (-1039.931) (-1039.124) -- 0:00:24
Average standard deviation of split frequencies: 0.007480
625500 -- (-1039.462) [-1038.681] (-1039.586) (-1038.690) * [-1039.992] (-1041.047) (-1039.294) (-1039.015) -- 0:00:23
626000 -- (-1038.608) (-1045.535) (-1041.040) [-1043.216] * (-1039.673) [-1039.209] (-1038.836) (-1042.938) -- 0:00:23
626500 -- (-1038.622) (-1040.068) [-1040.989] (-1038.468) * [-1040.170] (-1038.643) (-1038.312) (-1041.013) -- 0:00:23
627000 -- (-1043.498) (-1044.039) (-1041.341) [-1041.499] * [-1040.792] (-1039.282) (-1039.057) (-1038.760) -- 0:00:23
627500 -- (-1039.708) (-1040.289) [-1039.921] (-1039.677) * (-1041.385) (-1042.463) (-1037.842) [-1038.732] -- 0:00:23
628000 -- (-1038.105) (-1038.601) [-1042.192] (-1039.586) * (-1041.402) [-1045.103] (-1038.819) (-1044.178) -- 0:00:23
628500 -- [-1040.132] (-1040.031) (-1043.072) (-1039.702) * (-1039.896) (-1037.636) (-1040.594) [-1042.093] -- 0:00:23
629000 -- [-1040.315] (-1041.613) (-1042.006) (-1038.422) * (-1041.387) [-1037.764] (-1039.962) (-1041.679) -- 0:00:23
629500 -- (-1039.976) [-1044.267] (-1040.060) (-1038.669) * [-1041.493] (-1038.840) (-1039.618) (-1040.834) -- 0:00:23
630000 -- (-1040.328) (-1044.641) [-1039.589] (-1037.924) * (-1041.652) [-1041.056] (-1039.189) (-1041.820) -- 0:00:23
Average standard deviation of split frequencies: 0.007076
630500 -- (-1038.362) (-1042.550) (-1039.195) [-1038.823] * (-1040.018) (-1039.463) [-1039.526] (-1046.369) -- 0:00:23
631000 -- [-1039.924] (-1040.382) (-1039.521) (-1038.400) * (-1039.604) (-1042.323) [-1041.411] (-1039.698) -- 0:00:23
631500 -- [-1039.573] (-1039.739) (-1040.619) (-1041.959) * [-1039.610] (-1042.446) (-1041.088) (-1043.920) -- 0:00:23
632000 -- (-1039.195) (-1041.802) [-1041.523] (-1039.310) * [-1039.352] (-1040.171) (-1041.875) (-1041.813) -- 0:00:23
632500 -- (-1042.086) [-1040.161] (-1042.452) (-1038.917) * (-1039.180) (-1042.333) (-1044.582) [-1041.002] -- 0:00:23
633000 -- [-1040.351] (-1038.025) (-1040.011) (-1040.066) * (-1038.407) (-1039.927) [-1039.364] (-1039.952) -- 0:00:23
633500 -- [-1039.665] (-1040.303) (-1039.636) (-1041.558) * (-1041.124) (-1039.929) (-1040.897) [-1039.945] -- 0:00:23
634000 -- (-1039.579) [-1040.612] (-1040.744) (-1039.982) * [-1038.244] (-1040.744) (-1042.155) (-1040.972) -- 0:00:23
634500 -- (-1038.714) (-1043.746) (-1041.992) [-1039.457] * (-1040.010) (-1040.834) [-1039.618] (-1044.423) -- 0:00:23
635000 -- (-1041.136) (-1043.681) [-1040.293] (-1038.590) * [-1038.344] (-1039.725) (-1041.550) (-1044.939) -- 0:00:22
Average standard deviation of split frequencies: 0.006770
635500 -- (-1044.968) (-1038.184) (-1039.941) [-1039.483] * (-1041.651) [-1040.615] (-1046.867) (-1045.714) -- 0:00:22
636000 -- [-1045.235] (-1037.955) (-1043.714) (-1038.730) * (-1041.827) (-1040.213) (-1039.054) [-1039.526] -- 0:00:22
636500 -- (-1041.334) [-1042.575] (-1043.730) (-1044.484) * (-1040.413) (-1044.377) (-1041.322) [-1040.232] -- 0:00:22
637000 -- (-1040.195) [-1043.279] (-1041.656) (-1039.296) * (-1041.259) (-1041.669) (-1040.436) [-1040.749] -- 0:00:22
637500 -- (-1039.473) (-1042.296) (-1039.599) [-1039.550] * (-1039.697) (-1040.091) (-1038.851) [-1042.199] -- 0:00:22
638000 -- (-1042.392) [-1039.738] (-1040.668) (-1040.075) * (-1039.730) (-1041.154) (-1038.865) [-1041.892] -- 0:00:23
638500 -- (-1040.856) [-1040.688] (-1038.300) (-1045.874) * (-1042.755) (-1038.684) (-1038.550) [-1039.884] -- 0:00:23
639000 -- [-1039.148] (-1040.477) (-1039.653) (-1041.137) * (-1039.223) (-1039.220) [-1039.841] (-1041.142) -- 0:00:23
639500 -- (-1039.872) (-1044.866) [-1039.425] (-1042.589) * (-1040.017) (-1038.301) (-1040.942) [-1039.791] -- 0:00:23
640000 -- [-1038.675] (-1040.136) (-1038.535) (-1039.958) * (-1039.975) (-1039.706) [-1039.582] (-1039.016) -- 0:00:23
Average standard deviation of split frequencies: 0.006966
640500 -- [-1038.688] (-1039.402) (-1043.352) (-1039.196) * (-1042.558) [-1040.955] (-1043.079) (-1038.973) -- 0:00:23
641000 -- (-1041.933) [-1040.709] (-1043.194) (-1038.723) * [-1041.543] (-1041.008) (-1047.109) (-1044.065) -- 0:00:22
641500 -- (-1042.673) (-1039.901) (-1039.429) [-1040.379] * (-1040.719) [-1042.767] (-1046.203) (-1038.480) -- 0:00:22
642000 -- (-1039.875) (-1040.608) [-1039.146] (-1039.820) * [-1039.913] (-1037.742) (-1043.654) (-1039.502) -- 0:00:22
642500 -- (-1047.613) (-1043.310) [-1038.745] (-1039.718) * [-1039.644] (-1040.378) (-1044.081) (-1038.687) -- 0:00:22
643000 -- [-1043.435] (-1040.072) (-1038.776) (-1040.376) * (-1038.779) (-1046.546) (-1045.098) [-1043.190] -- 0:00:22
643500 -- (-1042.075) [-1040.110] (-1042.596) (-1039.063) * [-1040.544] (-1037.843) (-1044.420) (-1039.180) -- 0:00:22
644000 -- (-1039.745) (-1041.812) (-1041.252) [-1039.543] * (-1040.837) (-1038.020) (-1042.290) [-1040.382] -- 0:00:22
644500 -- [-1039.669] (-1039.716) (-1038.689) (-1038.777) * (-1038.747) (-1038.041) (-1039.636) [-1038.030] -- 0:00:22
645000 -- (-1042.498) (-1040.431) (-1042.027) [-1038.835] * [-1039.878] (-1037.976) (-1039.850) (-1039.485) -- 0:00:22
Average standard deviation of split frequencies: 0.006762
645500 -- (-1039.390) [-1038.543] (-1041.195) (-1038.854) * (-1039.995) (-1042.183) (-1040.855) [-1042.382] -- 0:00:22
646000 -- (-1041.005) (-1039.413) (-1038.287) [-1038.793] * (-1039.191) [-1044.555] (-1039.628) (-1040.909) -- 0:00:22
646500 -- (-1041.411) (-1038.290) (-1043.518) [-1040.088] * [-1039.874] (-1039.644) (-1039.812) (-1038.047) -- 0:00:22
647000 -- (-1049.970) [-1038.177] (-1040.906) (-1043.304) * (-1038.368) [-1040.479] (-1040.447) (-1043.616) -- 0:00:22
647500 -- [-1039.527] (-1040.349) (-1041.079) (-1038.876) * (-1038.820) [-1039.342] (-1042.144) (-1044.517) -- 0:00:22
648000 -- (-1044.041) [-1040.333] (-1041.542) (-1039.097) * [-1038.121] (-1039.420) (-1040.504) (-1041.243) -- 0:00:22
648500 -- (-1041.588) (-1038.778) [-1040.734] (-1042.534) * (-1040.330) [-1039.264] (-1037.742) (-1039.620) -- 0:00:22
649000 -- (-1037.693) (-1038.192) [-1040.879] (-1041.446) * (-1040.203) [-1038.418] (-1039.331) (-1040.033) -- 0:00:22
649500 -- (-1040.029) (-1042.016) [-1040.967] (-1039.466) * [-1038.234] (-1038.605) (-1043.965) (-1040.483) -- 0:00:22
650000 -- (-1038.377) [-1039.489] (-1040.102) (-1037.765) * (-1041.707) (-1038.060) [-1038.587] (-1040.028) -- 0:00:22
Average standard deviation of split frequencies: 0.006837
650500 -- [-1041.543] (-1038.491) (-1041.130) (-1039.266) * (-1041.648) (-1041.869) (-1038.935) [-1039.985] -- 0:00:22
651000 -- [-1039.375] (-1038.476) (-1038.831) (-1038.518) * [-1041.836] (-1043.025) (-1039.192) (-1038.300) -- 0:00:21
651500 -- (-1040.312) [-1040.382] (-1040.447) (-1040.807) * (-1045.528) (-1040.379) (-1042.092) [-1038.909] -- 0:00:21
652000 -- (-1041.194) (-1040.063) [-1038.821] (-1038.753) * (-1038.147) [-1040.913] (-1041.393) (-1039.504) -- 0:00:21
652500 -- (-1040.395) (-1038.197) (-1038.685) [-1038.987] * (-1039.700) (-1041.322) [-1041.129] (-1041.692) -- 0:00:21
653000 -- (-1042.301) (-1039.999) (-1038.175) [-1043.703] * (-1043.053) (-1042.880) (-1040.245) [-1039.358] -- 0:00:21
653500 -- (-1039.735) (-1042.829) [-1039.708] (-1042.789) * (-1045.621) [-1041.948] (-1039.357) (-1040.358) -- 0:00:21
654000 -- [-1042.711] (-1040.365) (-1046.563) (-1042.503) * [-1042.238] (-1040.191) (-1040.281) (-1038.681) -- 0:00:21
654500 -- (-1040.752) (-1039.177) (-1041.698) [-1038.144] * [-1040.238] (-1039.533) (-1039.675) (-1042.090) -- 0:00:22
655000 -- (-1040.567) [-1046.574] (-1040.586) (-1038.439) * [-1038.784] (-1039.139) (-1041.234) (-1041.613) -- 0:00:22
Average standard deviation of split frequencies: 0.007006
655500 -- (-1041.224) [-1039.295] (-1038.512) (-1038.692) * (-1041.382) (-1039.930) (-1039.424) [-1038.694] -- 0:00:22
656000 -- (-1040.563) [-1042.035] (-1038.709) (-1038.235) * (-1039.431) (-1041.343) [-1040.478] (-1042.096) -- 0:00:22
656500 -- (-1040.256) (-1039.343) [-1038.321] (-1039.196) * (-1040.173) [-1039.339] (-1039.422) (-1040.377) -- 0:00:21
657000 -- (-1041.573) (-1037.785) (-1041.939) [-1038.135] * (-1038.619) (-1042.663) (-1038.492) [-1039.268] -- 0:00:21
657500 -- (-1038.440) [-1040.055] (-1040.035) (-1039.796) * (-1040.420) (-1040.719) (-1039.658) [-1040.587] -- 0:00:21
658000 -- [-1038.794] (-1041.229) (-1038.544) (-1039.224) * (-1040.830) [-1038.956] (-1038.650) (-1043.940) -- 0:00:21
658500 -- (-1040.655) (-1043.543) (-1040.704) [-1038.626] * (-1039.466) (-1038.119) (-1043.558) [-1041.448] -- 0:00:21
659000 -- (-1042.311) (-1044.668) [-1038.640] (-1039.532) * (-1038.621) (-1044.083) [-1040.514] (-1038.887) -- 0:00:21
659500 -- (-1038.841) (-1041.369) (-1041.585) [-1039.624] * (-1040.411) [-1038.496] (-1040.424) (-1039.041) -- 0:00:21
660000 -- (-1043.141) (-1039.124) [-1039.712] (-1039.882) * (-1041.083) [-1038.655] (-1040.685) (-1039.238) -- 0:00:21
Average standard deviation of split frequencies: 0.007403
660500 -- (-1043.115) (-1037.858) (-1039.361) [-1037.818] * (-1040.654) (-1041.727) (-1040.467) [-1038.900] -- 0:00:21
661000 -- [-1039.341] (-1039.597) (-1038.914) (-1039.262) * [-1040.477] (-1039.118) (-1039.075) (-1038.924) -- 0:00:21
661500 -- (-1038.208) (-1038.099) (-1039.397) [-1039.351] * [-1038.947] (-1042.821) (-1039.524) (-1038.799) -- 0:00:21
662000 -- (-1039.346) (-1038.589) (-1040.854) [-1039.043] * (-1042.596) [-1040.335] (-1040.298) (-1039.925) -- 0:00:21
662500 -- (-1039.833) (-1039.167) [-1038.152] (-1038.760) * (-1039.337) [-1041.379] (-1043.783) (-1040.853) -- 0:00:21
663000 -- (-1040.892) [-1040.750] (-1039.933) (-1040.212) * (-1039.132) (-1041.789) (-1038.824) [-1041.418] -- 0:00:21
663500 -- [-1041.241] (-1037.966) (-1047.163) (-1040.043) * [-1038.578] (-1040.549) (-1038.490) (-1042.360) -- 0:00:21
664000 -- (-1039.268) [-1039.570] (-1043.868) (-1038.045) * (-1038.736) (-1039.592) (-1040.643) [-1038.502] -- 0:00:21
664500 -- (-1039.199) (-1040.720) [-1037.752] (-1039.865) * (-1040.705) (-1038.039) (-1037.879) [-1038.250] -- 0:00:21
665000 -- (-1038.437) (-1041.386) [-1040.138] (-1040.211) * (-1038.991) (-1038.196) [-1041.352] (-1038.382) -- 0:00:21
Average standard deviation of split frequencies: 0.007432
665500 -- (-1039.814) [-1038.839] (-1041.613) (-1038.059) * (-1039.808) [-1041.305] (-1041.215) (-1040.698) -- 0:00:21
666000 -- (-1037.990) [-1046.607] (-1038.007) (-1043.355) * (-1040.436) [-1038.424] (-1040.908) (-1040.875) -- 0:00:21
666500 -- [-1038.201] (-1038.491) (-1038.587) (-1038.017) * (-1043.203) [-1041.135] (-1041.439) (-1040.418) -- 0:00:21
667000 -- (-1038.201) [-1039.106] (-1043.104) (-1038.837) * (-1041.499) (-1041.024) [-1042.817] (-1040.312) -- 0:00:20
667500 -- (-1042.356) (-1039.182) [-1039.022] (-1039.944) * (-1046.450) (-1042.117) [-1042.469] (-1039.802) -- 0:00:20
668000 -- [-1039.616] (-1037.942) (-1040.353) (-1038.392) * [-1040.906] (-1042.400) (-1040.412) (-1039.833) -- 0:00:20
668500 -- (-1041.951) [-1037.972] (-1039.093) (-1037.826) * [-1038.830] (-1039.260) (-1040.517) (-1038.364) -- 0:00:20
669000 -- (-1038.536) (-1042.317) [-1040.018] (-1038.592) * (-1042.046) (-1040.735) [-1040.039] (-1040.540) -- 0:00:20
669500 -- (-1038.689) (-1042.348) (-1039.216) [-1038.946] * (-1039.383) (-1040.935) [-1041.604] (-1038.795) -- 0:00:20
670000 -- (-1042.903) (-1039.614) (-1043.941) [-1039.503] * [-1040.312] (-1039.027) (-1039.624) (-1041.293) -- 0:00:20
Average standard deviation of split frequencies: 0.007336
670500 -- [-1040.709] (-1039.197) (-1040.008) (-1039.386) * [-1041.743] (-1042.069) (-1042.315) (-1040.907) -- 0:00:20
671000 -- (-1040.142) [-1040.250] (-1041.841) (-1038.500) * (-1041.045) [-1041.986] (-1042.333) (-1043.214) -- 0:00:21
671500 -- [-1041.506] (-1041.853) (-1040.013) (-1038.024) * (-1041.594) [-1041.855] (-1043.551) (-1042.372) -- 0:00:21
672000 -- (-1045.105) (-1040.267) [-1038.257] (-1039.071) * [-1041.825] (-1040.981) (-1041.132) (-1042.765) -- 0:00:20
672500 -- [-1038.522] (-1040.391) (-1038.910) (-1038.558) * (-1042.979) [-1039.953] (-1040.959) (-1041.930) -- 0:00:20
673000 -- (-1038.935) (-1044.726) (-1040.555) [-1039.607] * (-1038.701) (-1039.727) (-1038.219) [-1044.873] -- 0:00:20
673500 -- (-1038.660) (-1040.500) (-1042.041) [-1039.627] * [-1039.574] (-1038.851) (-1038.516) (-1041.239) -- 0:00:20
674000 -- (-1038.961) (-1042.118) (-1041.033) [-1040.854] * (-1038.498) [-1038.222] (-1042.359) (-1041.800) -- 0:00:20
674500 -- (-1038.711) (-1040.326) (-1041.089) [-1044.195] * [-1040.349] (-1040.217) (-1041.121) (-1038.025) -- 0:00:20
675000 -- (-1044.105) [-1039.560] (-1038.066) (-1039.329) * (-1037.995) [-1041.631] (-1040.517) (-1040.614) -- 0:00:20
Average standard deviation of split frequencies: 0.007148
675500 -- (-1043.324) (-1040.112) (-1042.899) [-1040.359] * [-1041.431] (-1041.464) (-1042.339) (-1039.039) -- 0:00:20
676000 -- [-1042.411] (-1046.277) (-1041.233) (-1039.856) * (-1038.101) (-1041.089) [-1040.061] (-1038.977) -- 0:00:20
676500 -- [-1040.348] (-1038.666) (-1038.638) (-1038.926) * (-1039.060) (-1038.557) [-1039.025] (-1038.511) -- 0:00:20
677000 -- (-1040.332) [-1039.903] (-1039.632) (-1038.084) * (-1039.208) (-1040.915) [-1039.645] (-1040.562) -- 0:00:20
677500 -- (-1041.479) (-1039.808) [-1044.740] (-1040.981) * [-1042.017] (-1040.765) (-1045.708) (-1042.145) -- 0:00:20
678000 -- (-1041.331) (-1044.918) (-1042.582) [-1038.990] * (-1047.024) (-1039.788) [-1039.013] (-1040.999) -- 0:00:20
678500 -- (-1041.974) [-1039.614] (-1042.426) (-1041.576) * (-1045.967) (-1041.481) [-1039.180] (-1039.682) -- 0:00:20
679000 -- [-1038.114] (-1040.217) (-1038.298) (-1043.249) * (-1044.846) (-1038.202) [-1039.391] (-1038.838) -- 0:00:20
679500 -- [-1041.915] (-1038.260) (-1038.728) (-1045.673) * [-1039.920] (-1039.543) (-1038.902) (-1038.423) -- 0:00:20
680000 -- [-1039.686] (-1038.564) (-1040.561) (-1042.334) * (-1039.956) (-1040.740) [-1039.535] (-1040.178) -- 0:00:20
Average standard deviation of split frequencies: 0.007358
680500 -- (-1037.710) [-1040.514] (-1038.667) (-1041.665) * (-1042.667) [-1043.415] (-1040.729) (-1040.684) -- 0:00:20
681000 -- (-1039.198) [-1040.765] (-1041.032) (-1042.318) * (-1042.609) (-1041.026) (-1038.104) [-1040.434] -- 0:00:20
681500 -- (-1039.381) (-1037.741) [-1038.910] (-1047.805) * (-1040.935) (-1041.960) [-1037.971] (-1041.759) -- 0:00:20
682000 -- (-1041.747) [-1037.710] (-1042.071) (-1039.859) * [-1040.694] (-1040.881) (-1041.800) (-1038.960) -- 0:00:20
682500 -- (-1039.277) (-1038.322) [-1041.168] (-1042.699) * [-1043.880] (-1040.412) (-1047.567) (-1038.231) -- 0:00:20
683000 -- (-1040.276) (-1039.757) [-1040.292] (-1040.977) * (-1038.253) (-1040.024) (-1038.476) [-1039.483] -- 0:00:19
683500 -- (-1039.494) (-1041.661) [-1038.682] (-1038.945) * [-1038.479] (-1038.422) (-1041.826) (-1041.882) -- 0:00:19
684000 -- [-1045.170] (-1039.327) (-1040.300) (-1039.361) * [-1041.001] (-1039.314) (-1040.836) (-1043.740) -- 0:00:19
684500 -- (-1046.622) [-1039.412] (-1039.181) (-1040.430) * (-1044.911) (-1041.743) [-1038.953] (-1043.455) -- 0:00:19
685000 -- (-1038.158) [-1040.037] (-1038.466) (-1039.755) * [-1041.513] (-1043.489) (-1043.504) (-1042.292) -- 0:00:19
Average standard deviation of split frequencies: 0.006700
685500 -- (-1043.041) [-1040.026] (-1038.543) (-1039.059) * (-1040.313) [-1038.469] (-1041.173) (-1040.925) -- 0:00:19
686000 -- (-1041.090) (-1040.102) (-1038.769) [-1039.523] * (-1041.607) (-1041.626) (-1041.978) [-1040.238] -- 0:00:19
686500 -- [-1040.691] (-1040.973) (-1039.045) (-1039.078) * (-1040.699) (-1039.812) (-1040.535) [-1040.584] -- 0:00:19
687000 -- (-1039.986) (-1041.599) [-1041.288] (-1039.310) * [-1039.193] (-1038.671) (-1044.788) (-1037.875) -- 0:00:19
687500 -- [-1040.580] (-1043.568) (-1041.621) (-1041.375) * (-1042.741) [-1040.001] (-1040.566) (-1039.918) -- 0:00:19
688000 -- (-1038.557) (-1038.733) (-1039.734) [-1041.469] * (-1041.661) (-1040.244) (-1039.087) [-1037.895] -- 0:00:19
688500 -- (-1040.148) [-1039.667] (-1039.970) (-1039.470) * (-1042.185) (-1040.478) [-1042.187] (-1041.380) -- 0:00:19
689000 -- (-1038.345) (-1038.525) (-1041.456) [-1038.911] * [-1040.999] (-1046.521) (-1042.284) (-1045.363) -- 0:00:19
689500 -- [-1038.828] (-1040.684) (-1039.154) (-1038.623) * (-1041.941) [-1038.067] (-1039.375) (-1039.932) -- 0:00:19
690000 -- (-1038.860) [-1041.031] (-1039.673) (-1039.585) * (-1044.339) (-1041.519) (-1039.358) [-1039.721] -- 0:00:19
Average standard deviation of split frequencies: 0.006612
690500 -- (-1038.947) (-1039.712) [-1040.046] (-1040.033) * [-1041.476] (-1039.399) (-1040.287) (-1039.504) -- 0:00:19
691000 -- (-1041.490) (-1038.205) (-1040.145) [-1043.540] * [-1041.460] (-1040.417) (-1044.661) (-1040.910) -- 0:00:19
691500 -- (-1041.128) (-1037.815) [-1039.701] (-1045.158) * (-1043.381) [-1039.205] (-1040.180) (-1041.206) -- 0:00:19
692000 -- (-1038.700) (-1038.256) (-1040.365) [-1040.322] * (-1041.813) (-1041.576) (-1039.059) [-1038.386] -- 0:00:19
692500 -- (-1039.610) [-1039.570] (-1040.000) (-1041.425) * (-1040.473) (-1042.412) [-1039.924] (-1040.188) -- 0:00:19
693000 -- (-1038.247) (-1038.183) (-1040.950) [-1042.298] * (-1043.071) (-1040.313) [-1038.960] (-1037.970) -- 0:00:19
693500 -- (-1041.851) [-1042.143] (-1041.474) (-1043.219) * (-1043.750) [-1040.420] (-1039.353) (-1038.428) -- 0:00:19
694000 -- (-1038.330) (-1039.761) [-1038.488] (-1042.630) * [-1041.234] (-1040.637) (-1041.187) (-1039.748) -- 0:00:19
694500 -- (-1038.327) [-1043.504] (-1040.339) (-1039.851) * (-1040.471) (-1040.562) (-1038.127) [-1039.124] -- 0:00:19
695000 -- [-1040.285] (-1041.398) (-1043.308) (-1038.719) * (-1038.538) [-1039.871] (-1037.810) (-1041.811) -- 0:00:19
Average standard deviation of split frequencies: 0.006561
695500 -- (-1046.080) (-1038.868) [-1041.684] (-1041.512) * (-1040.043) (-1040.159) (-1038.315) [-1039.506] -- 0:00:19
696000 -- [-1041.670] (-1043.244) (-1040.763) (-1044.897) * [-1039.617] (-1041.304) (-1039.219) (-1040.035) -- 0:00:19
696500 -- [-1041.062] (-1040.916) (-1041.765) (-1039.250) * (-1044.872) [-1039.069] (-1039.542) (-1040.550) -- 0:00:19
697000 -- [-1038.634] (-1038.995) (-1044.064) (-1041.469) * (-1039.875) [-1038.267] (-1044.878) (-1041.326) -- 0:00:19
697500 -- (-1041.587) (-1039.828) [-1039.994] (-1041.243) * (-1041.494) [-1038.574] (-1043.989) (-1039.545) -- 0:00:19
698000 -- (-1042.725) (-1039.181) [-1039.735] (-1039.655) * (-1038.784) (-1040.108) (-1039.650) [-1038.827] -- 0:00:19
698500 -- (-1038.317) (-1039.436) [-1040.269] (-1040.929) * [-1041.233] (-1039.413) (-1038.908) (-1039.792) -- 0:00:18
699000 -- [-1038.288] (-1038.424) (-1040.671) (-1043.149) * (-1039.094) [-1041.705] (-1038.906) (-1039.270) -- 0:00:18
699500 -- (-1039.267) [-1038.403] (-1038.733) (-1038.979) * (-1039.114) [-1041.826] (-1041.223) (-1041.764) -- 0:00:18
700000 -- (-1038.556) (-1038.647) [-1041.322] (-1038.482) * (-1043.112) [-1039.753] (-1041.557) (-1039.787) -- 0:00:18
Average standard deviation of split frequencies: 0.006518
700500 -- (-1039.998) (-1042.420) (-1039.125) [-1038.277] * (-1042.026) (-1040.456) (-1039.127) [-1039.115] -- 0:00:18
701000 -- (-1039.066) (-1039.816) (-1039.297) [-1038.150] * (-1039.749) (-1041.287) [-1038.657] (-1041.127) -- 0:00:18
701500 -- [-1042.932] (-1038.483) (-1040.222) (-1042.500) * [-1043.212] (-1042.475) (-1038.211) (-1039.950) -- 0:00:18
702000 -- (-1043.423) [-1039.148] (-1041.279) (-1041.966) * (-1042.629) (-1041.097) (-1038.945) [-1039.252] -- 0:00:18
702500 -- (-1042.931) [-1043.971] (-1042.000) (-1042.513) * (-1039.914) [-1038.802] (-1039.545) (-1038.078) -- 0:00:18
703000 -- [-1037.636] (-1040.144) (-1040.085) (-1039.955) * (-1041.801) (-1040.628) [-1039.405] (-1038.481) -- 0:00:18
703500 -- (-1046.776) [-1040.153] (-1039.408) (-1043.493) * [-1043.169] (-1041.161) (-1038.399) (-1045.289) -- 0:00:18
704000 -- (-1039.881) (-1039.001) [-1041.724] (-1041.292) * [-1040.038] (-1040.539) (-1038.707) (-1041.718) -- 0:00:18
704500 -- (-1039.393) [-1040.823] (-1038.434) (-1038.917) * (-1043.809) [-1040.755] (-1038.574) (-1039.261) -- 0:00:18
705000 -- (-1041.099) (-1040.968) (-1038.444) [-1039.914] * (-1040.707) [-1041.001] (-1040.854) (-1040.845) -- 0:00:18
Average standard deviation of split frequencies: 0.006552
705500 -- (-1039.224) (-1039.826) [-1038.377] (-1039.421) * [-1040.303] (-1041.079) (-1040.906) (-1039.467) -- 0:00:18
706000 -- [-1040.910] (-1038.369) (-1041.667) (-1038.337) * (-1041.207) (-1040.733) [-1038.827] (-1041.115) -- 0:00:18
706500 -- [-1038.276] (-1038.998) (-1037.762) (-1038.194) * [-1038.984] (-1038.399) (-1040.365) (-1041.531) -- 0:00:18
707000 -- (-1039.099) [-1040.293] (-1039.019) (-1037.536) * (-1040.200) (-1038.396) (-1042.382) [-1038.042] -- 0:00:18
707500 -- (-1040.237) (-1039.697) [-1042.432] (-1038.070) * (-1041.212) [-1039.910] (-1040.546) (-1037.907) -- 0:00:18
708000 -- (-1043.670) (-1040.442) (-1040.168) [-1037.845] * [-1040.856] (-1038.937) (-1041.273) (-1038.327) -- 0:00:18
708500 -- (-1042.898) (-1039.941) [-1038.570] (-1038.086) * (-1038.280) (-1043.050) [-1042.131] (-1038.042) -- 0:00:18
709000 -- (-1041.229) [-1040.351] (-1040.192) (-1040.622) * [-1038.159] (-1045.630) (-1037.764) (-1042.476) -- 0:00:18
709500 -- [-1039.739] (-1039.518) (-1040.019) (-1038.846) * (-1041.091) [-1047.004] (-1041.886) (-1038.890) -- 0:00:18
710000 -- (-1040.479) (-1039.892) [-1039.224] (-1040.440) * (-1041.441) [-1039.951] (-1040.502) (-1042.579) -- 0:00:18
Average standard deviation of split frequencies: 0.006177
710500 -- [-1039.767] (-1042.110) (-1041.544) (-1043.166) * [-1040.400] (-1038.648) (-1041.308) (-1040.926) -- 0:00:18
711000 -- (-1039.582) [-1041.037] (-1044.589) (-1040.232) * (-1042.212) [-1039.434] (-1039.028) (-1038.620) -- 0:00:18
711500 -- (-1040.114) (-1039.172) (-1042.425) [-1041.749] * (-1038.969) [-1041.279] (-1041.653) (-1039.962) -- 0:00:18
712000 -- (-1039.071) (-1040.343) [-1040.608] (-1041.191) * (-1038.698) [-1038.124] (-1040.571) (-1039.541) -- 0:00:18
712500 -- (-1040.912) (-1047.126) (-1038.895) [-1040.513] * (-1040.044) (-1038.875) [-1038.361] (-1039.140) -- 0:00:18
713000 -- [-1039.732] (-1043.929) (-1038.895) (-1037.961) * (-1038.343) (-1039.689) (-1039.963) [-1037.940] -- 0:00:18
713500 -- (-1040.914) [-1040.977] (-1040.951) (-1039.227) * [-1039.037] (-1039.875) (-1039.275) (-1038.775) -- 0:00:18
714000 -- (-1039.011) [-1039.543] (-1041.421) (-1040.865) * (-1041.832) (-1038.772) [-1041.207] (-1040.537) -- 0:00:18
714500 -- (-1038.356) (-1038.221) (-1042.574) [-1039.429] * (-1041.616) (-1041.117) (-1040.339) [-1040.021] -- 0:00:17
715000 -- [-1038.795] (-1044.946) (-1041.891) (-1040.355) * (-1040.976) (-1039.524) (-1038.930) [-1039.439] -- 0:00:17
Average standard deviation of split frequencies: 0.006049
715500 -- [-1039.860] (-1040.975) (-1042.379) (-1039.070) * (-1039.243) (-1040.044) [-1039.536] (-1039.686) -- 0:00:17
716000 -- [-1039.901] (-1040.673) (-1038.697) (-1040.755) * [-1038.187] (-1042.151) (-1042.952) (-1040.084) -- 0:00:17
716500 -- (-1040.787) (-1041.179) (-1039.653) [-1038.418] * (-1040.351) (-1041.946) (-1038.824) [-1041.961] -- 0:00:17
717000 -- (-1044.491) (-1039.496) [-1039.331] (-1039.883) * [-1039.324] (-1039.599) (-1039.850) (-1040.019) -- 0:00:17
717500 -- (-1042.343) (-1041.100) (-1039.131) [-1039.841] * (-1041.058) (-1045.320) [-1038.155] (-1042.955) -- 0:00:17
718000 -- (-1040.045) (-1045.401) [-1038.382] (-1038.963) * (-1039.445) [-1039.955] (-1039.252) (-1042.088) -- 0:00:17
718500 -- [-1040.042] (-1043.780) (-1041.071) (-1038.603) * (-1039.321) (-1040.354) [-1041.021] (-1040.619) -- 0:00:17
719000 -- [-1042.647] (-1039.631) (-1039.029) (-1040.336) * [-1041.312] (-1038.958) (-1039.940) (-1041.524) -- 0:00:17
719500 -- [-1041.003] (-1038.701) (-1038.713) (-1040.668) * [-1039.209] (-1039.237) (-1044.595) (-1042.428) -- 0:00:17
720000 -- (-1038.597) (-1039.065) [-1038.970] (-1042.096) * [-1041.569] (-1038.739) (-1041.063) (-1038.369) -- 0:00:17
Average standard deviation of split frequencies: 0.006787
720500 -- [-1042.146] (-1041.482) (-1044.083) (-1042.297) * (-1039.522) (-1039.454) (-1038.807) [-1038.145] -- 0:00:17
721000 -- (-1042.295) [-1038.979] (-1045.032) (-1039.271) * (-1040.977) [-1041.436] (-1038.892) (-1042.186) -- 0:00:17
721500 -- [-1042.373] (-1041.058) (-1041.073) (-1039.228) * (-1043.602) [-1039.951] (-1039.586) (-1040.206) -- 0:00:17
722000 -- (-1039.301) [-1041.162] (-1041.147) (-1043.095) * (-1038.953) (-1039.018) (-1040.993) [-1044.076] -- 0:00:17
722500 -- (-1040.289) (-1039.892) (-1041.544) [-1040.508] * (-1038.199) (-1040.939) [-1039.773] (-1041.078) -- 0:00:17
723000 -- [-1042.252] (-1040.496) (-1040.478) (-1039.825) * (-1039.153) [-1038.816] (-1039.820) (-1040.955) -- 0:00:17
723500 -- (-1039.402) [-1038.129] (-1038.874) (-1043.695) * (-1039.750) (-1039.624) [-1040.247] (-1039.956) -- 0:00:17
724000 -- (-1039.892) [-1040.569] (-1038.726) (-1038.945) * (-1040.429) (-1041.349) [-1039.346] (-1042.747) -- 0:00:17
724500 -- (-1043.690) (-1041.727) [-1038.691] (-1039.516) * (-1038.944) (-1042.435) [-1038.342] (-1039.899) -- 0:00:17
725000 -- (-1042.030) (-1037.987) [-1040.038] (-1043.179) * (-1040.759) (-1038.470) [-1039.850] (-1038.673) -- 0:00:17
Average standard deviation of split frequencies: 0.006980
725500 -- [-1037.601] (-1038.088) (-1038.844) (-1042.558) * (-1043.345) (-1042.203) [-1039.977] (-1040.284) -- 0:00:17
726000 -- (-1038.660) (-1041.819) [-1040.041] (-1039.434) * (-1041.779) [-1040.343] (-1041.456) (-1040.404) -- 0:00:17
726500 -- [-1039.992] (-1045.495) (-1038.773) (-1039.403) * (-1042.239) (-1043.429) (-1039.444) [-1042.996] -- 0:00:17
727000 -- (-1040.724) (-1043.080) (-1039.054) [-1038.548] * (-1040.814) (-1039.906) [-1041.833] (-1039.364) -- 0:00:17
727500 -- (-1040.828) (-1041.174) (-1042.148) [-1038.774] * [-1041.894] (-1040.694) (-1042.796) (-1041.767) -- 0:00:17
728000 -- (-1039.606) (-1040.513) [-1042.840] (-1041.802) * (-1039.223) (-1040.305) (-1040.675) [-1037.902] -- 0:00:17
728500 -- (-1039.761) (-1044.624) [-1042.632] (-1039.442) * [-1039.487] (-1041.149) (-1038.216) (-1038.397) -- 0:00:17
729000 -- (-1040.685) (-1043.747) [-1038.604] (-1040.884) * (-1040.821) (-1040.385) [-1039.378] (-1042.690) -- 0:00:17
729500 -- (-1039.364) (-1043.603) [-1039.988] (-1041.391) * [-1039.745] (-1041.320) (-1041.143) (-1045.085) -- 0:00:17
730000 -- [-1039.194] (-1039.775) (-1038.497) (-1045.490) * (-1044.111) (-1043.122) (-1042.364) [-1040.343] -- 0:00:17
Average standard deviation of split frequencies: 0.006774
730500 -- (-1039.717) (-1038.406) [-1039.060] (-1040.228) * (-1041.342) [-1039.075] (-1039.413) (-1044.414) -- 0:00:16
731000 -- (-1040.868) [-1039.384] (-1039.367) (-1039.674) * (-1038.550) (-1039.088) (-1039.170) [-1039.284] -- 0:00:16
731500 -- (-1042.034) [-1042.226] (-1039.213) (-1040.430) * [-1038.309] (-1038.737) (-1039.081) (-1041.311) -- 0:00:16
732000 -- (-1038.987) (-1040.711) (-1039.067) [-1040.500] * (-1038.819) [-1040.281] (-1047.064) (-1041.452) -- 0:00:16
732500 -- (-1039.372) (-1039.181) (-1038.086) [-1040.005] * (-1040.351) (-1041.248) (-1040.027) [-1044.803] -- 0:00:16
733000 -- (-1040.515) [-1038.060] (-1038.457) (-1040.148) * (-1038.872) [-1042.211] (-1040.212) (-1038.848) -- 0:00:16
733500 -- (-1040.730) [-1040.221] (-1039.282) (-1043.873) * (-1038.757) [-1039.872] (-1041.098) (-1040.168) -- 0:00:16
734000 -- (-1040.774) [-1039.061] (-1042.289) (-1042.005) * (-1039.180) (-1039.448) (-1040.610) [-1042.420] -- 0:00:16
734500 -- [-1040.631] (-1039.206) (-1040.711) (-1039.322) * (-1040.457) (-1043.010) [-1038.992] (-1042.334) -- 0:00:16
735000 -- (-1040.773) (-1039.230) (-1043.408) [-1039.014] * [-1040.403] (-1038.450) (-1039.221) (-1042.504) -- 0:00:16
Average standard deviation of split frequencies: 0.006245
735500 -- (-1039.757) (-1038.650) (-1040.605) [-1039.371] * (-1040.887) (-1042.615) [-1042.875] (-1045.177) -- 0:00:16
736000 -- (-1039.540) (-1038.893) (-1042.110) [-1043.321] * (-1041.329) (-1041.754) [-1041.514] (-1040.525) -- 0:00:16
736500 -- (-1042.005) [-1038.480] (-1039.272) (-1043.497) * (-1042.065) (-1038.610) [-1042.558] (-1040.176) -- 0:00:16
737000 -- (-1042.166) (-1040.858) (-1039.303) [-1040.228] * (-1042.928) [-1038.391] (-1042.294) (-1042.365) -- 0:00:16
737500 -- (-1041.195) [-1040.238] (-1041.551) (-1041.774) * (-1042.250) (-1041.965) [-1037.839] (-1043.127) -- 0:00:16
738000 -- (-1039.127) [-1038.164] (-1038.341) (-1041.460) * (-1042.918) (-1039.184) [-1039.398] (-1042.790) -- 0:00:16
738500 -- (-1038.794) (-1040.445) [-1042.950] (-1040.555) * (-1038.413) [-1039.254] (-1038.931) (-1040.151) -- 0:00:16
739000 -- [-1037.791] (-1043.822) (-1038.257) (-1039.339) * (-1038.256) (-1038.440) (-1039.956) [-1042.244] -- 0:00:16
739500 -- (-1045.245) (-1042.162) [-1038.250] (-1041.852) * (-1038.699) (-1041.656) [-1038.427] (-1039.838) -- 0:00:16
740000 -- (-1039.644) (-1039.952) (-1040.043) [-1039.828] * (-1038.640) (-1040.538) (-1040.242) [-1042.547] -- 0:00:16
Average standard deviation of split frequencies: 0.006086
740500 -- (-1039.892) (-1041.769) [-1039.161] (-1038.213) * (-1044.899) (-1038.839) [-1040.378] (-1041.348) -- 0:00:16
741000 -- (-1040.227) (-1043.314) (-1040.354) [-1038.714] * (-1041.753) (-1039.773) [-1040.640] (-1041.011) -- 0:00:16
741500 -- (-1039.384) [-1040.284] (-1042.976) (-1040.979) * (-1038.049) [-1039.122] (-1041.108) (-1038.062) -- 0:00:16
742000 -- (-1038.503) [-1041.984] (-1039.093) (-1040.112) * [-1038.816] (-1038.412) (-1042.496) (-1039.465) -- 0:00:16
742500 -- [-1040.922] (-1038.242) (-1038.917) (-1039.383) * [-1038.920] (-1040.131) (-1038.901) (-1039.782) -- 0:00:16
743000 -- (-1039.215) [-1040.246] (-1038.867) (-1039.354) * (-1038.890) (-1041.768) [-1038.716] (-1038.008) -- 0:00:16
743500 -- (-1039.219) (-1043.975) [-1039.417] (-1040.826) * (-1038.748) (-1040.185) [-1038.107] (-1038.230) -- 0:00:16
744000 -- [-1040.264] (-1043.895) (-1040.370) (-1041.731) * (-1042.549) (-1039.114) [-1044.086] (-1040.469) -- 0:00:16
744500 -- (-1041.094) (-1041.913) [-1041.744] (-1039.640) * (-1040.099) [-1039.888] (-1043.419) (-1039.924) -- 0:00:16
745000 -- (-1039.257) (-1044.671) [-1040.787] (-1039.287) * (-1042.410) [-1038.896] (-1044.153) (-1041.499) -- 0:00:16
Average standard deviation of split frequencies: 0.006201
745500 -- (-1041.810) [-1040.925] (-1042.194) (-1038.976) * (-1041.200) (-1038.852) (-1040.986) [-1038.474] -- 0:00:16
746000 -- (-1039.184) (-1042.312) (-1041.865) [-1040.507] * [-1041.510] (-1040.173) (-1039.347) (-1039.941) -- 0:00:16
746500 -- (-1040.364) (-1039.545) (-1041.743) [-1039.211] * [-1041.033] (-1038.337) (-1038.064) (-1040.912) -- 0:00:15
747000 -- [-1039.121] (-1039.447) (-1038.338) (-1038.246) * [-1038.202] (-1040.129) (-1038.733) (-1039.745) -- 0:00:15
747500 -- [-1042.277] (-1045.764) (-1038.663) (-1040.157) * (-1038.386) (-1040.076) (-1039.496) [-1040.494] -- 0:00:15
748000 -- (-1041.335) (-1038.184) [-1038.758] (-1037.830) * (-1039.615) (-1038.292) [-1041.865] (-1041.023) -- 0:00:15
748500 -- (-1038.825) (-1041.732) [-1039.219] (-1040.836) * (-1040.670) (-1039.086) (-1042.370) [-1041.073] -- 0:00:15
749000 -- (-1042.288) (-1039.559) (-1038.509) [-1041.821] * (-1040.249) [-1040.445] (-1042.844) (-1038.321) -- 0:00:15
749500 -- (-1042.205) [-1038.933] (-1038.647) (-1043.658) * (-1041.523) [-1040.537] (-1046.057) (-1043.689) -- 0:00:15
750000 -- [-1040.302] (-1038.403) (-1038.781) (-1041.245) * (-1039.694) [-1040.354] (-1044.696) (-1043.629) -- 0:00:15
Average standard deviation of split frequencies: 0.006398
750500 -- [-1040.509] (-1039.062) (-1041.735) (-1040.817) * [-1040.304] (-1040.816) (-1043.548) (-1038.355) -- 0:00:15
751000 -- (-1039.750) (-1040.450) (-1040.112) [-1039.489] * (-1040.967) [-1039.623] (-1040.742) (-1039.899) -- 0:00:15
751500 -- [-1039.123] (-1041.335) (-1043.263) (-1041.224) * (-1040.574) [-1037.946] (-1038.819) (-1038.700) -- 0:00:15
752000 -- (-1042.877) [-1039.020] (-1042.912) (-1038.829) * (-1039.613) [-1039.764] (-1038.843) (-1041.353) -- 0:00:15
752500 -- (-1041.964) (-1040.092) (-1040.056) [-1039.551] * (-1039.664) (-1045.492) [-1039.842] (-1040.125) -- 0:00:15
753000 -- [-1038.236] (-1040.428) (-1039.493) (-1039.541) * [-1040.719] (-1042.520) (-1038.465) (-1042.164) -- 0:00:15
753500 -- (-1039.458) [-1040.108] (-1041.398) (-1040.061) * (-1040.504) [-1041.708] (-1038.665) (-1040.079) -- 0:00:15
754000 -- (-1042.066) (-1040.097) (-1038.013) [-1040.381] * (-1038.441) (-1038.843) (-1038.256) [-1040.306] -- 0:00:15
754500 -- [-1043.067] (-1038.160) (-1042.954) (-1037.970) * [-1043.821] (-1038.240) (-1039.788) (-1039.284) -- 0:00:15
755000 -- (-1041.169) [-1038.835] (-1042.578) (-1040.910) * (-1041.497) [-1038.739] (-1038.908) (-1039.286) -- 0:00:15
Average standard deviation of split frequencies: 0.006625
755500 -- (-1039.738) [-1038.861] (-1041.568) (-1037.979) * (-1042.206) [-1042.015] (-1044.565) (-1042.695) -- 0:00:15
756000 -- [-1039.760] (-1040.199) (-1039.794) (-1041.534) * (-1042.939) (-1041.147) [-1041.477] (-1042.264) -- 0:00:15
756500 -- (-1039.414) (-1038.991) (-1038.981) [-1040.967] * (-1040.006) (-1039.460) [-1038.154] (-1045.649) -- 0:00:15
757000 -- (-1039.227) [-1039.693] (-1040.088) (-1041.570) * (-1040.346) (-1041.955) (-1037.966) [-1037.781] -- 0:00:15
757500 -- (-1038.872) (-1038.017) [-1039.929] (-1040.176) * (-1039.448) (-1041.799) (-1039.470) [-1038.012] -- 0:00:15
758000 -- (-1042.814) (-1039.042) [-1038.231] (-1040.304) * [-1041.317] (-1040.077) (-1044.422) (-1042.229) -- 0:00:15
758500 -- [-1039.218] (-1039.942) (-1039.813) (-1040.307) * (-1040.008) (-1038.702) [-1040.901] (-1040.814) -- 0:00:15
759000 -- (-1038.054) [-1038.083] (-1041.441) (-1041.666) * (-1042.854) (-1038.267) (-1041.878) [-1038.548] -- 0:00:15
759500 -- (-1041.327) (-1038.096) [-1039.343] (-1039.119) * (-1039.049) (-1038.813) [-1039.552] (-1039.971) -- 0:00:15
760000 -- [-1038.346] (-1038.374) (-1038.071) (-1041.530) * (-1039.313) (-1040.204) (-1039.689) [-1038.276] -- 0:00:15
Average standard deviation of split frequencies: 0.006972
760500 -- (-1042.490) [-1039.499] (-1037.694) (-1041.759) * (-1037.968) [-1040.314] (-1043.507) (-1038.062) -- 0:00:15
761000 -- [-1038.111] (-1047.347) (-1039.068) (-1044.592) * (-1039.715) (-1041.612) [-1041.283] (-1037.558) -- 0:00:15
761500 -- [-1041.857] (-1039.417) (-1038.788) (-1046.020) * (-1038.518) [-1041.024] (-1043.402) (-1039.383) -- 0:00:15
762000 -- [-1039.862] (-1041.331) (-1041.751) (-1042.557) * [-1039.909] (-1039.084) (-1038.456) (-1040.045) -- 0:00:14
762500 -- [-1042.575] (-1038.572) (-1042.117) (-1041.558) * (-1041.713) (-1038.284) (-1042.006) [-1040.472] -- 0:00:14
763000 -- (-1040.825) [-1037.801] (-1039.485) (-1038.838) * (-1038.794) [-1038.805] (-1039.826) (-1043.459) -- 0:00:14
763500 -- (-1041.383) [-1037.644] (-1041.503) (-1041.397) * [-1040.385] (-1040.238) (-1039.430) (-1041.780) -- 0:00:14
764000 -- (-1038.478) (-1037.949) [-1040.422] (-1039.347) * (-1037.845) [-1040.007] (-1039.436) (-1041.654) -- 0:00:14
764500 -- (-1040.632) [-1040.668] (-1042.492) (-1038.307) * (-1040.187) (-1039.358) (-1040.581) [-1039.237] -- 0:00:14
765000 -- (-1038.820) (-1040.699) [-1039.559] (-1038.736) * (-1039.461) (-1042.072) (-1039.223) [-1038.082] -- 0:00:14
Average standard deviation of split frequencies: 0.007231
765500 -- [-1038.289] (-1040.011) (-1040.011) (-1041.121) * (-1041.903) (-1040.383) (-1040.385) [-1038.421] -- 0:00:14
766000 -- (-1038.173) [-1040.550] (-1039.230) (-1039.334) * [-1041.391] (-1039.178) (-1041.731) (-1041.846) -- 0:00:14
766500 -- (-1040.215) (-1039.784) [-1038.112] (-1039.366) * (-1041.953) (-1041.742) (-1042.200) [-1042.777] -- 0:00:14
767000 -- (-1040.900) (-1041.968) (-1039.583) [-1043.008] * (-1042.595) (-1040.200) [-1039.515] (-1042.274) -- 0:00:14
767500 -- (-1040.817) [-1039.447] (-1047.949) (-1040.699) * (-1040.650) (-1040.056) (-1041.255) [-1039.415] -- 0:00:14
768000 -- [-1039.196] (-1041.328) (-1040.031) (-1040.539) * [-1037.745] (-1038.773) (-1038.935) (-1040.699) -- 0:00:14
768500 -- (-1040.747) [-1040.870] (-1040.776) (-1040.815) * (-1037.823) (-1039.903) (-1040.129) [-1038.598] -- 0:00:14
769000 -- (-1046.094) (-1039.364) (-1041.055) [-1041.257] * (-1040.107) (-1039.411) (-1038.893) [-1038.292] -- 0:00:14
769500 -- [-1038.430] (-1041.962) (-1042.983) (-1039.433) * (-1040.231) [-1040.275] (-1038.914) (-1039.976) -- 0:00:14
770000 -- (-1038.060) [-1040.473] (-1038.809) (-1041.163) * [-1042.413] (-1039.629) (-1039.627) (-1041.235) -- 0:00:14
Average standard deviation of split frequencies: 0.006996
770500 -- (-1040.289) (-1041.527) (-1040.992) [-1040.507] * (-1039.893) (-1039.828) [-1039.561] (-1039.728) -- 0:00:14
771000 -- (-1040.213) (-1038.861) (-1039.090) [-1040.186] * (-1039.758) (-1044.205) [-1038.123] (-1041.284) -- 0:00:14
771500 -- (-1041.881) (-1045.581) [-1038.192] (-1039.173) * (-1040.084) (-1043.841) [-1041.359] (-1039.478) -- 0:00:14
772000 -- (-1040.775) (-1040.363) [-1039.367] (-1040.686) * (-1037.501) (-1040.796) (-1039.386) [-1038.546] -- 0:00:14
772500 -- (-1042.160) (-1039.815) (-1040.365) [-1044.504] * (-1042.864) (-1041.441) (-1038.809) [-1039.180] -- 0:00:14
773000 -- (-1038.198) (-1038.910) [-1039.330] (-1043.806) * [-1041.700] (-1038.744) (-1039.585) (-1040.801) -- 0:00:14
773500 -- (-1037.921) [-1041.974] (-1039.356) (-1040.456) * (-1043.222) (-1041.231) [-1038.875] (-1039.355) -- 0:00:14
774000 -- (-1038.127) (-1040.078) [-1039.650] (-1043.449) * (-1039.310) (-1040.988) [-1043.269] (-1039.976) -- 0:00:14
774500 -- (-1039.471) (-1040.984) [-1041.562] (-1046.299) * (-1040.646) [-1039.895] (-1040.354) (-1042.656) -- 0:00:14
775000 -- (-1039.091) (-1038.737) [-1041.190] (-1043.077) * (-1038.989) [-1039.915] (-1041.401) (-1040.831) -- 0:00:14
Average standard deviation of split frequencies: 0.006910
775500 -- (-1042.009) [-1038.603] (-1040.356) (-1039.681) * (-1040.819) (-1040.718) [-1039.342] (-1039.302) -- 0:00:14
776000 -- (-1039.595) [-1040.569] (-1041.267) (-1038.407) * (-1038.357) (-1040.941) [-1038.181] (-1039.671) -- 0:00:14
776500 -- (-1039.166) (-1040.121) (-1038.134) [-1039.597] * (-1038.934) [-1042.903] (-1038.164) (-1040.154) -- 0:00:14
777000 -- (-1041.145) (-1041.733) (-1038.764) [-1042.806] * (-1039.527) (-1040.150) (-1038.359) [-1042.268] -- 0:00:14
777500 -- (-1039.660) (-1041.832) (-1041.487) [-1040.154] * (-1040.080) [-1038.513] (-1039.852) (-1042.475) -- 0:00:14
778000 -- (-1041.881) [-1039.842] (-1044.200) (-1039.694) * [-1038.550] (-1040.811) (-1040.382) (-1042.070) -- 0:00:13
778500 -- (-1040.990) [-1040.794] (-1038.780) (-1039.495) * [-1039.019] (-1041.343) (-1040.448) (-1040.079) -- 0:00:13
779000 -- (-1045.567) (-1037.772) [-1040.882] (-1038.917) * (-1042.910) [-1041.016] (-1042.197) (-1039.232) -- 0:00:13
779500 -- (-1040.856) [-1040.975] (-1043.699) (-1039.233) * (-1041.382) [-1038.493] (-1040.646) (-1043.350) -- 0:00:13
780000 -- [-1038.914] (-1039.923) (-1040.917) (-1039.908) * [-1037.784] (-1039.553) (-1041.093) (-1040.623) -- 0:00:13
Average standard deviation of split frequencies: 0.006605
780500 -- [-1038.317] (-1039.265) (-1038.815) (-1042.977) * (-1038.752) [-1039.011] (-1038.529) (-1041.352) -- 0:00:13
781000 -- (-1043.590) [-1040.874] (-1040.530) (-1041.083) * [-1043.394] (-1037.835) (-1040.611) (-1038.957) -- 0:00:13
781500 -- (-1042.231) (-1040.988) [-1038.232] (-1051.483) * (-1041.445) (-1040.374) [-1043.255] (-1039.782) -- 0:00:13
782000 -- (-1041.867) [-1038.024] (-1038.005) (-1049.508) * (-1041.024) [-1037.802] (-1043.480) (-1041.989) -- 0:00:13
782500 -- (-1041.606) (-1037.986) [-1038.992] (-1038.561) * (-1041.327) (-1040.011) [-1039.474] (-1041.648) -- 0:00:13
783000 -- (-1040.517) (-1039.318) [-1038.633] (-1039.945) * (-1042.426) (-1043.784) (-1039.730) [-1040.764] -- 0:00:13
783500 -- (-1038.888) (-1042.891) [-1039.994] (-1040.079) * (-1040.502) (-1043.000) (-1039.476) [-1040.915] -- 0:00:13
784000 -- [-1041.944] (-1039.805) (-1040.675) (-1039.053) * (-1038.761) (-1038.809) (-1038.871) [-1038.737] -- 0:00:13
784500 -- (-1041.292) (-1038.465) [-1040.979] (-1041.070) * [-1046.620] (-1038.771) (-1042.309) (-1042.766) -- 0:00:13
785000 -- (-1040.840) (-1038.440) [-1039.198] (-1038.033) * [-1041.559] (-1039.465) (-1044.065) (-1040.779) -- 0:00:13
Average standard deviation of split frequencies: 0.006447
785500 -- (-1039.937) [-1039.901] (-1038.308) (-1042.355) * [-1039.686] (-1038.900) (-1040.208) (-1041.018) -- 0:00:13
786000 -- (-1040.283) [-1038.222] (-1038.088) (-1039.293) * (-1038.903) (-1042.112) (-1040.656) [-1038.562] -- 0:00:13
786500 -- [-1039.329] (-1040.748) (-1039.493) (-1047.749) * (-1040.335) [-1038.704] (-1040.463) (-1039.001) -- 0:00:13
787000 -- (-1039.232) (-1038.874) (-1043.024) [-1041.958] * (-1040.732) (-1042.083) (-1041.945) [-1038.626] -- 0:00:13
787500 -- [-1039.204] (-1044.401) (-1039.816) (-1041.367) * [-1040.212] (-1040.765) (-1038.163) (-1039.808) -- 0:00:13
788000 -- (-1038.730) [-1038.664] (-1039.710) (-1039.367) * [-1041.607] (-1040.041) (-1040.145) (-1039.474) -- 0:00:13
788500 -- (-1041.274) (-1042.163) (-1038.390) [-1038.809] * (-1038.532) (-1040.600) [-1038.814] (-1038.775) -- 0:00:13
789000 -- (-1038.818) [-1039.656] (-1041.282) (-1040.119) * (-1040.597) [-1041.447] (-1042.291) (-1038.270) -- 0:00:13
789500 -- (-1041.536) (-1038.552) (-1041.179) [-1039.400] * [-1039.547] (-1041.336) (-1040.708) (-1039.758) -- 0:00:13
790000 -- [-1044.551] (-1039.263) (-1039.053) (-1041.968) * (-1041.596) (-1040.262) [-1040.696] (-1042.793) -- 0:00:13
Average standard deviation of split frequencies: 0.006223
790500 -- (-1043.228) (-1039.244) (-1041.497) [-1039.698] * (-1040.388) [-1042.705] (-1040.182) (-1038.148) -- 0:00:13
791000 -- (-1040.798) [-1038.508] (-1042.472) (-1040.771) * [-1037.951] (-1044.833) (-1041.236) (-1039.167) -- 0:00:13
791500 -- [-1041.698] (-1038.694) (-1041.022) (-1040.762) * (-1038.906) (-1039.009) (-1042.706) [-1039.063] -- 0:00:13
792000 -- (-1041.442) [-1038.240] (-1040.673) (-1038.581) * (-1038.174) (-1038.187) [-1042.764] (-1038.601) -- 0:00:13
792500 -- (-1041.381) (-1039.865) (-1041.817) [-1040.700] * (-1040.091) [-1038.399] (-1042.381) (-1039.050) -- 0:00:13
793000 -- (-1038.980) (-1039.679) (-1043.882) [-1040.228] * (-1039.185) (-1037.857) (-1041.519) [-1039.424] -- 0:00:13
793500 -- (-1040.023) [-1038.660] (-1043.046) (-1042.756) * [-1040.223] (-1037.935) (-1039.049) (-1042.728) -- 0:00:13
794000 -- (-1039.818) [-1039.409] (-1046.088) (-1039.559) * [-1039.023] (-1038.192) (-1043.068) (-1041.104) -- 0:00:12
794500 -- (-1040.049) (-1039.854) [-1040.894] (-1038.959) * (-1039.540) (-1040.521) [-1039.997] (-1041.044) -- 0:00:12
795000 -- (-1038.756) [-1041.089] (-1040.768) (-1041.503) * [-1039.428] (-1044.389) (-1040.283) (-1042.817) -- 0:00:12
Average standard deviation of split frequencies: 0.006255
795500 -- [-1039.743] (-1040.699) (-1045.075) (-1045.667) * (-1040.565) (-1043.460) [-1040.267] (-1042.174) -- 0:00:12
796000 -- (-1038.299) (-1042.699) (-1041.953) [-1039.518] * (-1040.957) (-1040.240) [-1038.676] (-1039.719) -- 0:00:12
796500 -- [-1039.592] (-1038.190) (-1043.052) (-1039.578) * (-1039.229) (-1039.057) (-1038.271) [-1038.052] -- 0:00:12
797000 -- (-1041.465) [-1038.668] (-1042.226) (-1039.284) * (-1038.257) (-1044.714) (-1038.393) [-1039.117] -- 0:00:12
797500 -- [-1042.478] (-1038.707) (-1042.640) (-1038.594) * (-1040.573) (-1039.884) (-1040.684) [-1041.117] -- 0:00:12
798000 -- [-1047.391] (-1043.110) (-1045.417) (-1042.307) * (-1039.586) (-1038.118) [-1039.605] (-1039.724) -- 0:00:12
798500 -- (-1044.574) (-1038.774) (-1043.627) [-1038.862] * (-1039.352) [-1038.470] (-1038.494) (-1039.822) -- 0:00:12
799000 -- (-1051.609) [-1039.351] (-1043.761) (-1040.656) * (-1041.285) (-1044.600) [-1041.288] (-1038.853) -- 0:00:12
799500 -- (-1041.778) (-1039.496) [-1041.438] (-1040.054) * [-1037.965] (-1040.308) (-1040.300) (-1041.714) -- 0:00:12
800000 -- (-1041.538) [-1039.987] (-1039.248) (-1039.674) * (-1038.589) (-1041.648) (-1044.707) [-1039.958] -- 0:00:12
Average standard deviation of split frequencies: 0.006072
800500 -- [-1040.314] (-1040.652) (-1046.756) (-1042.211) * (-1039.388) (-1041.793) [-1038.790] (-1039.154) -- 0:00:12
801000 -- (-1041.216) (-1040.598) (-1040.538) [-1044.400] * [-1038.356] (-1041.405) (-1045.595) (-1038.069) -- 0:00:12
801500 -- (-1042.366) [-1038.579] (-1045.290) (-1042.829) * [-1040.264] (-1038.778) (-1043.241) (-1040.048) -- 0:00:12
802000 -- [-1039.311] (-1039.388) (-1043.685) (-1039.929) * (-1039.302) (-1038.613) (-1039.131) [-1039.552] -- 0:00:12
802500 -- [-1039.398] (-1040.071) (-1040.000) (-1043.975) * [-1042.279] (-1040.351) (-1038.784) (-1040.232) -- 0:00:12
803000 -- (-1038.937) [-1039.086] (-1039.809) (-1040.195) * [-1038.528] (-1047.761) (-1043.515) (-1039.868) -- 0:00:12
803500 -- (-1038.661) [-1039.777] (-1038.617) (-1039.884) * (-1037.829) (-1039.736) (-1039.677) [-1041.660] -- 0:00:12
804000 -- [-1038.529] (-1040.374) (-1041.960) (-1040.036) * (-1039.884) [-1040.515] (-1037.861) (-1040.166) -- 0:00:12
804500 -- [-1039.757] (-1038.610) (-1039.328) (-1043.204) * [-1041.486] (-1039.260) (-1039.329) (-1041.342) -- 0:00:12
805000 -- [-1040.385] (-1038.624) (-1039.815) (-1039.806) * [-1039.913] (-1039.266) (-1038.901) (-1037.861) -- 0:00:12
Average standard deviation of split frequencies: 0.005702
805500 -- (-1045.129) (-1038.580) [-1037.607] (-1042.316) * [-1039.227] (-1038.972) (-1037.992) (-1041.345) -- 0:00:12
806000 -- (-1042.240) [-1040.530] (-1039.460) (-1042.473) * (-1038.939) (-1044.968) (-1038.296) [-1041.181] -- 0:00:12
806500 -- (-1039.547) [-1043.458] (-1042.764) (-1040.968) * (-1040.622) (-1045.126) [-1039.467] (-1040.492) -- 0:00:12
807000 -- (-1040.394) [-1040.731] (-1040.183) (-1044.446) * [-1038.338] (-1044.475) (-1038.990) (-1038.411) -- 0:00:12
807500 -- (-1043.057) [-1038.700] (-1040.015) (-1042.108) * (-1038.288) (-1044.027) (-1040.649) [-1045.606] -- 0:00:12
808000 -- (-1042.873) (-1041.989) (-1038.204) [-1048.374] * (-1038.551) (-1044.127) (-1039.308) [-1043.046] -- 0:00:12
808500 -- (-1040.238) (-1038.863) [-1039.915] (-1039.263) * (-1038.854) (-1038.893) [-1039.156] (-1041.750) -- 0:00:12
809000 -- [-1040.292] (-1038.853) (-1041.491) (-1040.218) * (-1041.659) (-1038.978) [-1038.452] (-1041.801) -- 0:00:12
809500 -- (-1038.380) (-1040.368) (-1038.004) [-1040.428] * (-1041.923) (-1039.200) (-1040.510) [-1039.169] -- 0:00:12
810000 -- (-1038.602) (-1040.784) [-1038.936] (-1040.944) * [-1038.817] (-1038.227) (-1038.434) (-1038.070) -- 0:00:11
Average standard deviation of split frequencies: 0.005633
810500 -- (-1038.202) [-1039.487] (-1039.121) (-1039.434) * (-1040.770) (-1040.494) (-1039.840) [-1038.344] -- 0:00:11
811000 -- (-1042.862) (-1039.239) (-1039.160) [-1039.842] * (-1040.937) [-1040.928] (-1038.828) (-1042.831) -- 0:00:11
811500 -- (-1040.022) [-1038.200] (-1041.086) (-1039.814) * (-1042.031) (-1042.378) [-1040.127] (-1038.506) -- 0:00:11
812000 -- [-1041.119] (-1038.969) (-1038.829) (-1040.309) * (-1040.100) (-1040.797) (-1039.744) [-1041.857] -- 0:00:11
812500 -- (-1045.166) [-1040.990] (-1041.441) (-1038.441) * [-1042.501] (-1038.735) (-1041.331) (-1040.415) -- 0:00:11
813000 -- (-1043.137) (-1040.017) [-1038.952] (-1040.193) * (-1045.224) (-1038.137) (-1042.154) [-1039.873] -- 0:00:11
813500 -- (-1041.553) (-1040.393) [-1038.427] (-1042.169) * [-1041.449] (-1038.328) (-1038.468) (-1040.737) -- 0:00:11
814000 -- [-1038.917] (-1040.866) (-1039.760) (-1038.709) * (-1041.787) [-1037.583] (-1038.984) (-1039.098) -- 0:00:11
814500 -- (-1040.534) (-1040.564) [-1042.805] (-1040.165) * (-1039.558) (-1038.799) (-1038.559) [-1038.999] -- 0:00:11
815000 -- [-1039.745] (-1039.160) (-1040.739) (-1040.128) * (-1040.393) (-1039.945) [-1041.590] (-1041.896) -- 0:00:11
Average standard deviation of split frequencies: 0.005885
815500 -- (-1041.549) (-1037.992) (-1038.400) [-1039.741] * [-1038.536] (-1040.097) (-1039.991) (-1040.127) -- 0:00:11
816000 -- (-1038.946) [-1037.992] (-1038.151) (-1040.263) * [-1040.895] (-1039.864) (-1038.119) (-1040.435) -- 0:00:11
816500 -- (-1038.809) (-1043.001) [-1040.920] (-1040.669) * (-1040.177) (-1037.822) [-1039.754] (-1038.910) -- 0:00:11
817000 -- (-1038.408) (-1038.167) [-1038.976] (-1041.208) * (-1041.408) [-1038.581] (-1040.279) (-1038.851) -- 0:00:11
817500 -- (-1040.449) [-1044.731] (-1040.796) (-1041.178) * (-1041.145) [-1042.155] (-1038.106) (-1038.723) -- 0:00:11
818000 -- (-1040.481) [-1039.405] (-1039.683) (-1041.258) * (-1038.615) (-1041.980) [-1040.706] (-1041.796) -- 0:00:11
818500 -- (-1040.694) (-1041.878) (-1039.275) [-1041.905] * (-1039.103) (-1042.223) (-1043.099) [-1041.103] -- 0:00:11
819000 -- (-1039.284) (-1042.562) (-1040.778) [-1042.784] * (-1038.402) [-1040.194] (-1039.551) (-1040.370) -- 0:00:11
819500 -- (-1038.695) (-1042.230) (-1046.076) [-1044.790] * (-1038.689) (-1041.491) [-1039.116] (-1040.014) -- 0:00:11
820000 -- [-1039.778] (-1041.392) (-1040.956) (-1043.897) * (-1039.114) (-1039.823) (-1038.817) [-1038.836] -- 0:00:11
Average standard deviation of split frequencies: 0.006319
820500 -- (-1042.211) (-1040.597) [-1039.029] (-1040.518) * (-1038.515) (-1040.305) (-1040.941) [-1038.404] -- 0:00:11
821000 -- (-1037.728) (-1039.744) [-1040.981] (-1039.155) * (-1039.660) (-1041.210) [-1040.800] (-1040.984) -- 0:00:11
821500 -- (-1040.169) [-1040.469] (-1039.333) (-1038.146) * (-1040.662) [-1039.041] (-1040.833) (-1040.181) -- 0:00:11
822000 -- (-1039.773) (-1043.765) [-1038.813] (-1041.580) * (-1043.528) (-1038.603) [-1037.769] (-1043.385) -- 0:00:11
822500 -- (-1038.862) (-1044.898) [-1042.989] (-1046.402) * (-1043.969) [-1040.021] (-1037.835) (-1038.940) -- 0:00:11
823000 -- (-1042.233) [-1038.542] (-1041.353) (-1042.295) * (-1039.112) (-1038.673) [-1038.976] (-1038.949) -- 0:00:11
823500 -- (-1044.664) [-1039.610] (-1041.570) (-1039.195) * [-1038.380] (-1042.579) (-1038.450) (-1041.577) -- 0:00:11
824000 -- (-1045.291) [-1039.236] (-1040.848) (-1038.199) * [-1040.637] (-1042.360) (-1038.747) (-1041.875) -- 0:00:11
824500 -- (-1040.061) (-1040.284) (-1039.359) [-1038.065] * (-1039.493) (-1041.230) [-1039.817] (-1039.283) -- 0:00:11
825000 -- (-1039.307) (-1039.910) [-1039.066] (-1038.264) * (-1039.239) (-1038.898) (-1038.831) [-1040.444] -- 0:00:11
Average standard deviation of split frequencies: 0.006099
825500 -- (-1039.110) (-1042.439) [-1038.988] (-1041.134) * (-1041.495) [-1039.101] (-1040.216) (-1039.972) -- 0:00:10
826000 -- (-1038.067) (-1039.494) (-1038.139) [-1039.309] * (-1040.714) [-1042.034] (-1040.603) (-1039.539) -- 0:00:10
826500 -- [-1039.542] (-1039.968) (-1038.541) (-1042.439) * (-1038.691) (-1041.939) (-1038.651) [-1041.915] -- 0:00:10
827000 -- (-1041.621) (-1039.151) [-1040.379] (-1041.125) * (-1039.424) [-1038.446] (-1039.980) (-1039.252) -- 0:00:10
827500 -- (-1038.575) (-1039.125) (-1039.783) [-1041.337] * (-1044.235) (-1041.207) [-1040.899] (-1039.313) -- 0:00:10
828000 -- (-1042.777) [-1040.277] (-1041.381) (-1038.414) * (-1040.633) (-1039.334) [-1039.004] (-1038.292) -- 0:00:10
828500 -- [-1041.399] (-1042.468) (-1042.971) (-1038.994) * (-1042.158) (-1037.673) (-1040.916) [-1040.263] -- 0:00:10
829000 -- (-1039.327) (-1040.775) (-1041.472) [-1039.312] * (-1037.948) [-1038.879] (-1044.173) (-1038.943) -- 0:00:10
829500 -- (-1040.133) (-1040.316) [-1041.453] (-1043.670) * [-1041.787] (-1038.508) (-1038.814) (-1043.559) -- 0:00:10
830000 -- (-1038.808) (-1041.517) [-1040.123] (-1040.852) * (-1046.253) [-1040.975] (-1043.927) (-1042.282) -- 0:00:10
Average standard deviation of split frequencies: 0.006065
830500 -- (-1039.996) [-1039.964] (-1039.160) (-1039.778) * (-1040.096) (-1039.240) (-1038.649) [-1038.522] -- 0:00:10
831000 -- [-1039.902] (-1041.280) (-1043.407) (-1041.226) * [-1038.825] (-1038.327) (-1041.208) (-1038.798) -- 0:00:10
831500 -- (-1038.531) (-1042.182) (-1038.685) [-1039.465] * (-1040.405) (-1039.410) [-1040.041] (-1038.425) -- 0:00:10
832000 -- (-1039.322) [-1042.252] (-1039.509) (-1043.884) * [-1041.956] (-1044.307) (-1039.541) (-1039.109) -- 0:00:10
832500 -- [-1040.998] (-1042.760) (-1039.445) (-1038.919) * [-1039.645] (-1040.897) (-1038.631) (-1038.008) -- 0:00:10
833000 -- (-1043.732) [-1040.106] (-1039.985) (-1040.599) * (-1039.138) [-1041.462] (-1038.326) (-1039.342) -- 0:00:10
833500 -- (-1039.735) (-1038.002) [-1039.364] (-1040.503) * (-1039.729) (-1039.619) (-1038.464) [-1038.244] -- 0:00:10
834000 -- (-1040.800) [-1038.714] (-1038.065) (-1040.926) * (-1041.819) (-1041.089) [-1040.357] (-1038.889) -- 0:00:10
834500 -- (-1041.318) [-1040.138] (-1040.537) (-1038.565) * [-1040.533] (-1041.467) (-1039.719) (-1039.405) -- 0:00:10
835000 -- (-1039.305) (-1038.063) (-1041.218) [-1038.570] * (-1042.769) (-1041.352) [-1039.264] (-1039.447) -- 0:00:10
Average standard deviation of split frequencies: 0.005815
835500 -- (-1039.422) [-1040.822] (-1041.908) (-1041.446) * [-1041.406] (-1038.153) (-1040.443) (-1041.607) -- 0:00:10
836000 -- [-1039.483] (-1039.142) (-1041.159) (-1038.476) * (-1039.034) (-1038.900) [-1040.564] (-1038.289) -- 0:00:10
836500 -- [-1042.233] (-1044.452) (-1037.844) (-1039.544) * (-1043.836) (-1040.142) [-1039.705] (-1038.198) -- 0:00:10
837000 -- (-1041.287) [-1038.950] (-1041.811) (-1040.830) * (-1038.723) [-1039.684] (-1039.723) (-1037.683) -- 0:00:10
837500 -- (-1040.591) (-1045.025) [-1043.280] (-1040.058) * (-1040.088) (-1039.068) [-1038.015] (-1037.670) -- 0:00:10
838000 -- (-1043.785) (-1040.364) [-1038.597] (-1040.810) * [-1038.965] (-1040.133) (-1040.619) (-1039.679) -- 0:00:10
838500 -- (-1038.084) (-1039.529) [-1040.077] (-1038.449) * (-1039.246) [-1042.220] (-1040.156) (-1041.047) -- 0:00:10
839000 -- (-1038.392) [-1041.391] (-1038.582) (-1043.987) * (-1040.659) (-1039.755) [-1040.285] (-1043.721) -- 0:00:10
839500 -- (-1039.711) [-1039.855] (-1039.869) (-1039.435) * (-1040.617) (-1039.539) (-1038.321) [-1043.604] -- 0:00:10
840000 -- (-1038.328) [-1039.012] (-1038.380) (-1040.370) * (-1040.616) (-1046.249) (-1037.747) [-1040.295] -- 0:00:10
Average standard deviation of split frequencies: 0.006168
840500 -- [-1041.584] (-1040.498) (-1038.996) (-1040.134) * (-1043.465) (-1044.789) [-1037.863] (-1039.665) -- 0:00:10
841000 -- [-1040.720] (-1040.519) (-1039.165) (-1042.753) * [-1038.722] (-1041.521) (-1041.173) (-1039.406) -- 0:00:10
841500 -- [-1038.438] (-1041.420) (-1038.456) (-1041.448) * (-1038.723) [-1039.001] (-1041.318) (-1043.139) -- 0:00:09
842000 -- [-1038.803] (-1038.181) (-1038.941) (-1039.856) * (-1039.252) [-1039.018] (-1039.884) (-1042.406) -- 0:00:09
842500 -- (-1038.782) (-1039.965) (-1039.063) [-1039.706] * [-1038.227] (-1038.926) (-1040.770) (-1040.980) -- 0:00:09
843000 -- (-1041.298) (-1041.109) [-1038.002] (-1039.607) * (-1039.976) (-1038.389) [-1039.613] (-1038.889) -- 0:00:09
843500 -- [-1043.431] (-1040.573) (-1039.447) (-1041.135) * (-1041.332) (-1040.506) (-1039.321) [-1040.202] -- 0:00:09
844000 -- (-1038.644) (-1041.175) [-1038.255] (-1038.112) * (-1038.932) (-1051.763) (-1040.471) [-1039.016] -- 0:00:09
844500 -- (-1044.498) (-1038.794) [-1041.628] (-1038.209) * (-1039.395) (-1041.409) (-1039.317) [-1041.485] -- 0:00:09
845000 -- [-1042.568] (-1038.177) (-1042.003) (-1039.209) * (-1040.804) [-1038.824] (-1041.246) (-1042.682) -- 0:00:09
Average standard deviation of split frequencies: 0.006338
845500 -- (-1041.670) (-1039.955) [-1042.078] (-1038.979) * [-1041.398] (-1040.089) (-1041.495) (-1041.998) -- 0:00:09
846000 -- (-1041.921) [-1038.833] (-1047.071) (-1038.475) * (-1041.176) (-1039.051) [-1041.594] (-1037.630) -- 0:00:09
846500 -- (-1041.950) (-1039.900) [-1040.710] (-1041.180) * (-1042.085) [-1039.453] (-1039.387) (-1040.086) -- 0:00:09
847000 -- (-1040.208) (-1039.636) [-1040.276] (-1039.210) * (-1039.592) (-1039.152) (-1039.690) [-1040.339] -- 0:00:09
847500 -- (-1038.504) [-1039.236] (-1039.421) (-1039.245) * (-1042.945) [-1041.223] (-1039.842) (-1040.864) -- 0:00:09
848000 -- (-1038.560) (-1039.341) (-1042.346) [-1038.389] * (-1040.509) [-1038.185] (-1040.530) (-1039.423) -- 0:00:09
848500 -- (-1038.596) (-1038.507) (-1040.880) [-1038.977] * (-1042.340) (-1040.045) [-1041.786] (-1043.930) -- 0:00:09
849000 -- [-1041.556] (-1039.014) (-1039.733) (-1046.419) * (-1045.889) (-1040.894) [-1040.639] (-1042.500) -- 0:00:09
849500 -- [-1038.361] (-1046.156) (-1039.337) (-1039.540) * (-1046.351) [-1039.943] (-1038.060) (-1039.126) -- 0:00:09
850000 -- (-1040.271) [-1037.892] (-1039.490) (-1039.630) * (-1046.139) (-1038.312) (-1039.707) [-1038.818] -- 0:00:09
Average standard deviation of split frequencies: 0.006407
850500 -- [-1040.313] (-1038.074) (-1039.904) (-1040.197) * (-1039.098) (-1040.504) [-1038.041] (-1038.381) -- 0:00:09
851000 -- [-1041.411] (-1041.536) (-1038.721) (-1041.342) * (-1038.954) (-1039.642) [-1039.960] (-1038.506) -- 0:00:09
851500 -- [-1041.845] (-1038.563) (-1044.143) (-1040.108) * (-1039.427) (-1040.433) (-1041.164) [-1038.554] -- 0:00:09
852000 -- (-1041.075) (-1040.172) [-1041.737] (-1041.833) * (-1043.750) (-1040.548) [-1040.595] (-1038.824) -- 0:00:09
852500 -- (-1043.065) (-1038.029) [-1040.986] (-1039.212) * (-1040.705) (-1039.752) (-1041.958) [-1037.790] -- 0:00:09
853000 -- (-1042.480) [-1038.524] (-1042.434) (-1041.651) * (-1042.106) (-1038.615) (-1039.738) [-1038.584] -- 0:00:09
853500 -- [-1038.740] (-1042.341) (-1039.957) (-1040.676) * (-1039.023) (-1040.120) (-1039.928) [-1039.349] -- 0:00:09
854000 -- (-1039.284) (-1047.847) (-1039.564) [-1041.013] * [-1038.532] (-1038.999) (-1039.609) (-1039.070) -- 0:00:09
854500 -- [-1042.418] (-1043.364) (-1038.250) (-1037.921) * [-1037.697] (-1039.769) (-1040.440) (-1039.737) -- 0:00:09
855000 -- (-1039.167) (-1038.936) [-1038.309] (-1038.657) * (-1039.190) (-1039.268) [-1041.315] (-1039.856) -- 0:00:09
Average standard deviation of split frequencies: 0.006333
855500 -- [-1039.129] (-1042.102) (-1041.535) (-1039.850) * (-1041.302) [-1040.527] (-1041.867) (-1038.226) -- 0:00:09
856000 -- (-1038.537) (-1038.323) [-1040.957] (-1043.538) * [-1038.438] (-1040.575) (-1040.377) (-1040.546) -- 0:00:09
856500 -- (-1040.324) (-1038.077) [-1040.990] (-1044.814) * (-1041.324) (-1041.878) [-1038.130] (-1039.885) -- 0:00:09
857000 -- (-1039.103) [-1041.252] (-1039.020) (-1042.299) * (-1040.429) (-1040.486) [-1038.368] (-1040.770) -- 0:00:09
857500 -- (-1042.597) [-1040.248] (-1040.634) (-1050.193) * (-1041.981) (-1041.360) [-1038.676] (-1041.644) -- 0:00:08
858000 -- (-1043.389) [-1038.668] (-1039.291) (-1040.380) * (-1040.651) (-1040.375) [-1039.833] (-1039.534) -- 0:00:08
858500 -- (-1040.857) (-1038.820) (-1039.986) [-1040.607] * (-1040.175) (-1041.402) [-1038.096] (-1038.371) -- 0:00:08
859000 -- (-1038.853) (-1043.032) (-1038.186) [-1042.106] * (-1043.221) (-1040.795) [-1040.910] (-1039.832) -- 0:00:08
859500 -- (-1040.080) (-1038.448) (-1038.140) [-1039.141] * (-1044.846) (-1040.410) (-1039.374) [-1038.564] -- 0:00:08
860000 -- (-1038.579) [-1038.949] (-1042.601) (-1039.979) * (-1040.552) [-1039.257] (-1041.951) (-1048.233) -- 0:00:08
Average standard deviation of split frequencies: 0.006744
860500 -- [-1042.487] (-1038.888) (-1040.093) (-1038.720) * (-1038.525) [-1039.173] (-1043.221) (-1039.523) -- 0:00:08
861000 -- (-1039.027) (-1039.472) (-1040.447) [-1039.295] * (-1038.991) (-1039.894) [-1041.971] (-1039.846) -- 0:00:08
861500 -- [-1039.911] (-1039.314) (-1040.380) (-1044.001) * (-1041.821) (-1043.617) [-1039.848] (-1038.796) -- 0:00:08
862000 -- (-1039.728) (-1040.474) (-1041.115) [-1040.612] * (-1041.049) (-1039.604) (-1038.307) [-1038.703] -- 0:00:08
862500 -- (-1040.082) (-1038.865) (-1038.446) [-1041.832] * (-1044.287) (-1039.912) [-1038.827] (-1038.968) -- 0:00:08
863000 -- (-1039.892) (-1038.296) (-1039.651) [-1040.208] * (-1039.686) (-1039.827) [-1041.208] (-1038.542) -- 0:00:08
863500 -- (-1044.270) (-1038.328) (-1041.232) [-1038.873] * (-1038.635) [-1041.433] (-1039.650) (-1039.011) -- 0:00:08
864000 -- (-1040.196) [-1041.872] (-1044.404) (-1039.076) * [-1038.547] (-1039.377) (-1038.842) (-1040.343) -- 0:00:08
864500 -- (-1040.942) [-1038.039] (-1041.956) (-1039.485) * (-1041.310) [-1039.663] (-1040.729) (-1038.726) -- 0:00:08
865000 -- (-1041.895) (-1039.984) [-1040.103] (-1039.318) * (-1040.335) [-1040.437] (-1039.676) (-1040.225) -- 0:00:08
Average standard deviation of split frequencies: 0.006702
865500 -- (-1038.115) (-1042.739) (-1041.076) [-1038.753] * (-1037.987) (-1038.328) [-1040.845] (-1043.336) -- 0:00:08
866000 -- (-1038.368) [-1039.987] (-1041.055) (-1039.293) * (-1039.155) (-1039.057) [-1041.086] (-1043.609) -- 0:00:08
866500 -- [-1038.531] (-1038.821) (-1040.213) (-1040.856) * (-1038.095) (-1039.518) [-1042.044] (-1042.944) -- 0:00:08
867000 -- (-1040.972) (-1038.683) [-1040.557] (-1040.713) * (-1041.432) (-1040.924) [-1038.610] (-1038.413) -- 0:00:08
867500 -- [-1038.616] (-1039.886) (-1040.371) (-1040.265) * (-1042.970) (-1039.046) [-1038.805] (-1037.943) -- 0:00:08
868000 -- [-1039.769] (-1040.438) (-1045.378) (-1042.524) * (-1038.337) [-1042.012] (-1038.324) (-1044.838) -- 0:00:08
868500 -- [-1039.103] (-1044.901) (-1040.120) (-1047.744) * (-1038.783) (-1041.643) [-1039.173] (-1044.054) -- 0:00:08
869000 -- (-1041.255) [-1042.356] (-1042.358) (-1041.068) * (-1038.482) [-1038.511] (-1039.697) (-1043.964) -- 0:00:08
869500 -- (-1041.463) (-1039.504) (-1041.101) [-1038.415] * [-1040.234] (-1045.897) (-1039.304) (-1046.192) -- 0:00:08
870000 -- (-1038.370) [-1043.056] (-1038.781) (-1038.699) * (-1039.995) (-1040.803) [-1038.482] (-1047.450) -- 0:00:08
Average standard deviation of split frequencies: 0.006429
870500 -- (-1042.303) [-1039.748] (-1042.673) (-1038.415) * (-1042.725) (-1041.308) (-1041.999) [-1046.976] -- 0:00:08
871000 -- [-1039.640] (-1045.145) (-1039.972) (-1040.319) * [-1039.399] (-1042.460) (-1040.974) (-1045.159) -- 0:00:08
871500 -- [-1040.384] (-1039.898) (-1039.479) (-1041.337) * (-1038.714) (-1041.424) (-1041.235) [-1039.223] -- 0:00:08
872000 -- (-1038.350) (-1043.835) [-1037.896] (-1040.412) * [-1043.755] (-1040.245) (-1038.972) (-1039.541) -- 0:00:08
872500 -- (-1038.450) (-1040.162) (-1037.672) [-1038.756] * (-1039.724) (-1040.009) [-1041.321] (-1037.972) -- 0:00:08
873000 -- (-1040.516) (-1041.280) [-1038.392] (-1040.181) * [-1041.252] (-1044.941) (-1040.388) (-1040.080) -- 0:00:08
873500 -- [-1039.545] (-1038.243) (-1042.155) (-1041.538) * (-1041.493) (-1042.200) [-1039.681] (-1042.882) -- 0:00:07
874000 -- (-1046.923) (-1043.748) (-1038.291) [-1040.684] * (-1039.351) [-1041.291] (-1038.953) (-1039.969) -- 0:00:07
874500 -- (-1042.413) (-1040.398) (-1039.321) [-1042.095] * [-1041.931] (-1043.674) (-1037.733) (-1040.660) -- 0:00:07
875000 -- (-1038.834) (-1039.696) (-1041.511) [-1041.422] * (-1040.932) (-1041.209) (-1041.084) [-1040.829] -- 0:00:07
Average standard deviation of split frequencies: 0.006189
875500 -- (-1040.602) (-1039.675) (-1045.609) [-1038.187] * (-1038.575) (-1042.325) (-1041.215) [-1038.146] -- 0:00:07
876000 -- (-1040.185) (-1039.590) [-1039.678] (-1038.368) * (-1038.760) [-1042.707] (-1038.468) (-1038.746) -- 0:00:07
876500 -- (-1040.781) [-1040.038] (-1040.076) (-1039.099) * (-1039.325) [-1040.568] (-1041.526) (-1040.686) -- 0:00:07
877000 -- (-1041.008) [-1039.741] (-1043.189) (-1040.067) * (-1039.531) (-1047.827) (-1038.872) [-1040.619] -- 0:00:07
877500 -- (-1038.471) (-1038.354) [-1040.130] (-1038.157) * (-1041.358) (-1050.364) (-1041.211) [-1039.724] -- 0:00:07
878000 -- (-1041.122) [-1041.911] (-1039.322) (-1040.069) * (-1045.128) [-1040.281] (-1041.651) (-1040.162) -- 0:00:07
878500 -- (-1038.423) (-1042.611) [-1042.564] (-1039.289) * (-1041.132) (-1039.023) [-1039.943] (-1047.881) -- 0:00:07
879000 -- (-1038.015) (-1039.777) (-1040.238) [-1038.951] * [-1041.224] (-1040.023) (-1040.732) (-1040.587) -- 0:00:07
879500 -- (-1038.157) [-1038.901] (-1038.306) (-1038.920) * [-1040.220] (-1038.731) (-1039.720) (-1038.068) -- 0:00:07
880000 -- [-1040.016] (-1040.117) (-1039.821) (-1044.513) * (-1039.579) (-1040.516) (-1039.564) [-1041.759] -- 0:00:07
Average standard deviation of split frequencies: 0.006122
880500 -- (-1039.801) (-1042.797) [-1039.415] (-1039.298) * (-1040.591) [-1038.189] (-1039.248) (-1041.631) -- 0:00:07
881000 -- (-1040.846) [-1040.914] (-1038.092) (-1038.294) * (-1039.256) [-1039.337] (-1041.533) (-1040.140) -- 0:00:07
881500 -- (-1044.053) (-1039.306) (-1040.373) [-1039.199] * (-1038.814) (-1038.845) [-1041.560] (-1038.626) -- 0:00:07
882000 -- (-1041.490) (-1039.772) (-1040.628) [-1039.378] * (-1038.291) [-1041.541] (-1041.500) (-1040.152) -- 0:00:07
882500 -- (-1039.569) (-1039.252) [-1038.758] (-1039.580) * (-1038.475) (-1039.747) (-1041.425) [-1042.646] -- 0:00:07
883000 -- [-1039.784] (-1042.722) (-1040.263) (-1044.542) * (-1040.824) (-1040.142) (-1040.102) [-1040.454] -- 0:00:07
883500 -- (-1040.241) (-1042.550) (-1039.818) [-1041.174] * (-1038.353) [-1043.448] (-1040.150) (-1041.532) -- 0:00:07
884000 -- (-1039.949) (-1041.570) [-1038.808] (-1038.695) * [-1038.171] (-1043.749) (-1040.850) (-1039.943) -- 0:00:07
884500 -- [-1040.546] (-1040.822) (-1039.750) (-1044.050) * (-1040.369) (-1043.967) [-1038.387] (-1039.530) -- 0:00:07
885000 -- [-1038.425] (-1042.201) (-1043.568) (-1039.491) * (-1040.501) (-1041.504) [-1038.178] (-1049.958) -- 0:00:07
Average standard deviation of split frequencies: 0.006019
885500 -- [-1040.434] (-1043.507) (-1040.621) (-1041.026) * (-1041.732) (-1039.975) [-1038.373] (-1041.426) -- 0:00:07
886000 -- (-1039.493) (-1041.264) [-1038.978] (-1039.983) * (-1044.250) (-1042.383) [-1039.752] (-1039.361) -- 0:00:07
886500 -- (-1039.431) [-1038.588] (-1041.032) (-1040.365) * (-1039.958) (-1042.079) (-1041.128) [-1039.118] -- 0:00:07
887000 -- (-1039.522) [-1045.374] (-1041.011) (-1037.996) * (-1039.803) [-1042.020] (-1038.103) (-1040.812) -- 0:00:07
887500 -- (-1039.602) [-1039.351] (-1038.625) (-1038.575) * (-1040.686) [-1039.209] (-1038.324) (-1039.633) -- 0:00:07
888000 -- (-1039.350) (-1040.314) [-1038.856] (-1042.003) * [-1040.665] (-1039.596) (-1039.281) (-1042.175) -- 0:00:07
888500 -- [-1039.440] (-1040.204) (-1039.622) (-1039.102) * (-1040.500) [-1038.272] (-1042.460) (-1039.658) -- 0:00:07
889000 -- (-1039.117) (-1041.971) [-1042.053] (-1037.679) * (-1038.896) [-1038.131] (-1041.954) (-1040.475) -- 0:00:06
889500 -- (-1040.292) [-1040.391] (-1037.996) (-1040.630) * (-1042.654) (-1038.571) (-1040.103) [-1038.923] -- 0:00:06
890000 -- (-1038.982) [-1039.524] (-1037.996) (-1038.935) * (-1039.639) [-1039.651] (-1044.353) (-1038.504) -- 0:00:06
Average standard deviation of split frequencies: 0.006020
890500 -- (-1040.489) (-1039.506) (-1038.188) [-1040.400] * [-1040.444] (-1040.443) (-1041.810) (-1039.047) -- 0:00:06
891000 -- (-1039.084) (-1040.189) [-1038.857] (-1041.709) * [-1040.046] (-1043.902) (-1042.175) (-1039.809) -- 0:00:06
891500 -- (-1042.535) [-1039.955] (-1038.912) (-1046.669) * (-1041.071) (-1039.579) [-1041.516] (-1043.973) -- 0:00:06
892000 -- (-1038.598) [-1040.354] (-1038.626) (-1039.134) * [-1038.661] (-1043.753) (-1038.690) (-1041.374) -- 0:00:06
892500 -- (-1039.889) (-1039.209) (-1043.685) [-1038.655] * (-1038.177) [-1042.790] (-1040.575) (-1041.064) -- 0:00:06
893000 -- (-1038.679) (-1040.838) (-1039.058) [-1037.852] * (-1039.460) (-1038.947) [-1040.946] (-1040.722) -- 0:00:06
893500 -- [-1038.232] (-1041.404) (-1038.525) (-1038.981) * [-1039.545] (-1038.854) (-1040.865) (-1038.454) -- 0:00:06
894000 -- (-1039.267) (-1042.669) (-1040.525) [-1040.116] * (-1044.450) [-1038.802] (-1039.209) (-1041.133) -- 0:00:06
894500 -- (-1039.290) (-1038.729) [-1038.258] (-1039.014) * (-1040.824) (-1038.754) [-1038.908] (-1038.714) -- 0:00:06
895000 -- (-1038.847) (-1042.132) [-1044.629] (-1041.305) * (-1040.152) [-1038.218] (-1042.402) (-1038.775) -- 0:00:06
Average standard deviation of split frequencies: 0.005557
895500 -- (-1040.996) (-1039.632) [-1040.299] (-1043.396) * [-1042.726] (-1039.107) (-1040.892) (-1042.245) -- 0:00:06
896000 -- (-1045.113) (-1038.926) [-1040.079] (-1041.696) * (-1045.035) [-1040.986] (-1040.524) (-1044.110) -- 0:00:06
896500 -- (-1039.941) (-1040.891) (-1040.235) [-1037.790] * [-1038.367] (-1039.701) (-1041.117) (-1038.809) -- 0:00:06
897000 -- (-1043.964) (-1042.552) (-1038.637) [-1037.773] * (-1039.099) (-1039.438) [-1037.937] (-1042.946) -- 0:00:06
897500 -- (-1039.685) (-1040.323) (-1038.510) [-1037.823] * (-1039.550) (-1040.195) (-1037.971) [-1038.907] -- 0:00:06
898000 -- (-1039.494) (-1041.247) [-1038.887] (-1038.354) * [-1040.365] (-1041.039) (-1038.942) (-1041.102) -- 0:00:06
898500 -- (-1037.624) (-1038.015) [-1042.693] (-1040.987) * (-1043.350) (-1038.710) (-1037.774) [-1040.687] -- 0:00:06
899000 -- (-1040.944) (-1038.826) (-1042.679) [-1040.297] * (-1042.797) [-1039.065] (-1038.176) (-1039.764) -- 0:00:06
899500 -- (-1040.341) (-1039.807) (-1039.529) [-1040.239] * [-1038.727] (-1041.837) (-1041.845) (-1043.432) -- 0:00:06
900000 -- (-1040.826) (-1040.855) [-1038.251] (-1039.115) * (-1043.590) (-1041.638) (-1041.120) [-1039.627] -- 0:00:06
Average standard deviation of split frequencies: 0.005513
900500 -- (-1039.903) (-1038.816) (-1039.534) [-1040.097] * (-1039.366) [-1039.208] (-1039.602) (-1043.303) -- 0:00:06
901000 -- (-1039.050) (-1044.571) (-1038.023) [-1039.183] * [-1039.369] (-1039.898) (-1046.024) (-1039.405) -- 0:00:06
901500 -- [-1040.957] (-1040.681) (-1038.413) (-1040.154) * (-1043.568) [-1038.915] (-1039.802) (-1038.370) -- 0:00:06
902000 -- (-1039.807) (-1041.111) (-1041.315) [-1040.135] * (-1042.019) (-1040.200) [-1040.392] (-1040.191) -- 0:00:06
902500 -- [-1039.434] (-1048.646) (-1042.030) (-1039.195) * (-1044.289) [-1040.801] (-1039.582) (-1038.707) -- 0:00:06
903000 -- (-1041.108) (-1040.303) [-1041.112] (-1040.794) * (-1045.546) [-1043.411] (-1041.150) (-1039.522) -- 0:00:06
903500 -- (-1042.210) (-1039.990) (-1042.415) [-1038.272] * (-1040.606) (-1040.095) (-1042.265) [-1044.789] -- 0:00:06
904000 -- (-1041.377) [-1040.267] (-1042.067) (-1040.716) * (-1043.194) (-1043.359) [-1042.869] (-1040.727) -- 0:00:06
904500 -- (-1039.405) (-1041.342) [-1043.181] (-1040.598) * (-1039.315) (-1041.302) (-1038.457) [-1038.684] -- 0:00:06
905000 -- (-1037.890) [-1042.310] (-1041.177) (-1044.842) * [-1038.918] (-1039.813) (-1039.332) (-1039.025) -- 0:00:05
Average standard deviation of split frequencies: 0.005654
905500 -- (-1038.698) [-1038.047] (-1041.567) (-1042.503) * (-1039.254) [-1043.605] (-1038.458) (-1039.154) -- 0:00:05
906000 -- (-1039.899) [-1037.784] (-1042.492) (-1042.865) * (-1038.059) (-1043.590) (-1038.522) [-1039.176] -- 0:00:05
906500 -- (-1043.640) (-1037.855) [-1039.019] (-1043.494) * (-1046.394) (-1044.009) [-1040.369] (-1043.655) -- 0:00:05
907000 -- (-1048.893) (-1040.938) (-1040.763) [-1039.702] * (-1040.598) (-1041.314) (-1038.435) [-1040.025] -- 0:00:05
907500 -- (-1045.844) (-1039.128) [-1038.724] (-1038.572) * (-1040.455) (-1039.316) [-1038.487] (-1038.406) -- 0:00:05
908000 -- (-1041.393) (-1039.982) (-1038.466) [-1039.530] * (-1043.670) (-1038.269) [-1039.946] (-1040.392) -- 0:00:05
908500 -- (-1041.235) [-1041.983] (-1037.869) (-1041.392) * (-1038.691) [-1038.149] (-1041.698) (-1039.985) -- 0:00:05
909000 -- (-1039.799) (-1038.632) [-1043.366] (-1043.784) * (-1040.102) (-1038.740) (-1038.999) [-1040.306] -- 0:00:05
909500 -- (-1038.826) [-1039.797] (-1043.094) (-1038.166) * (-1038.112) (-1039.399) (-1041.451) [-1040.077] -- 0:00:05
910000 -- (-1041.812) (-1039.617) (-1042.871) [-1038.379] * (-1037.807) [-1040.017] (-1046.365) (-1039.743) -- 0:00:05
Average standard deviation of split frequencies: 0.005556
910500 -- (-1040.137) (-1038.868) [-1039.998] (-1041.059) * (-1041.729) (-1039.958) [-1039.827] (-1040.965) -- 0:00:05
911000 -- (-1045.829) [-1037.943] (-1039.335) (-1038.391) * (-1039.995) (-1042.495) [-1039.274] (-1041.659) -- 0:00:05
911500 -- (-1042.239) [-1038.242] (-1039.730) (-1041.139) * (-1038.949) (-1038.323) (-1040.997) [-1039.632] -- 0:00:05
912000 -- (-1040.428) (-1039.199) (-1043.491) [-1039.326] * [-1040.191] (-1040.459) (-1038.634) (-1038.466) -- 0:00:05
912500 -- (-1039.994) [-1039.321] (-1039.482) (-1038.207) * (-1040.712) (-1040.158) (-1038.524) [-1039.472] -- 0:00:05
913000 -- (-1039.791) [-1041.175] (-1038.193) (-1039.186) * [-1040.275] (-1038.551) (-1038.777) (-1038.834) -- 0:00:05
913500 -- [-1038.592] (-1039.516) (-1040.893) (-1038.729) * (-1040.509) (-1039.002) [-1039.512] (-1041.481) -- 0:00:05
914000 -- (-1039.401) (-1040.819) [-1040.135] (-1038.631) * (-1040.443) [-1043.219] (-1040.674) (-1038.099) -- 0:00:05
914500 -- [-1039.202] (-1040.005) (-1038.297) (-1041.828) * (-1040.990) [-1038.269] (-1038.042) (-1037.937) -- 0:00:05
915000 -- (-1039.780) (-1040.547) [-1039.751] (-1040.996) * (-1042.963) (-1038.716) (-1038.702) [-1038.193] -- 0:00:05
Average standard deviation of split frequencies: 0.005558
915500 -- (-1039.420) [-1039.131] (-1038.544) (-1039.530) * (-1041.865) [-1038.649] (-1040.296) (-1042.090) -- 0:00:05
916000 -- (-1038.043) [-1038.268] (-1039.000) (-1039.790) * (-1039.618) (-1042.844) (-1041.891) [-1040.079] -- 0:00:05
916500 -- (-1038.034) (-1039.492) (-1039.064) [-1038.419] * (-1038.472) [-1040.509] (-1040.729) (-1041.832) -- 0:00:05
917000 -- [-1040.509] (-1040.993) (-1041.120) (-1038.083) * [-1039.799] (-1039.466) (-1039.742) (-1041.759) -- 0:00:05
917500 -- [-1043.974] (-1041.689) (-1039.308) (-1039.433) * (-1042.344) [-1038.422] (-1039.246) (-1039.682) -- 0:00:05
918000 -- (-1042.497) [-1041.893] (-1041.234) (-1038.713) * (-1040.195) [-1040.789] (-1039.036) (-1040.380) -- 0:00:05
918500 -- [-1039.668] (-1037.925) (-1041.934) (-1042.444) * (-1042.730) (-1037.916) [-1041.217] (-1039.714) -- 0:00:05
919000 -- (-1040.406) [-1038.977] (-1039.427) (-1040.560) * [-1037.973] (-1040.116) (-1038.691) (-1042.329) -- 0:00:05
919500 -- (-1045.862) (-1041.256) [-1039.655] (-1040.477) * (-1039.302) (-1039.989) [-1039.459] (-1040.190) -- 0:00:05
920000 -- (-1041.211) (-1038.282) (-1039.530) [-1045.394] * (-1039.292) (-1039.065) [-1042.518] (-1038.697) -- 0:00:05
Average standard deviation of split frequencies: 0.005803
920500 -- [-1038.395] (-1041.858) (-1038.221) (-1042.750) * [-1041.363] (-1039.296) (-1043.656) (-1038.390) -- 0:00:05
921000 -- (-1037.823) (-1042.319) (-1038.457) [-1040.493] * [-1039.679] (-1037.936) (-1040.053) (-1038.764) -- 0:00:04
921500 -- [-1042.016] (-1041.972) (-1038.949) (-1042.890) * (-1039.655) [-1039.183] (-1038.850) (-1040.402) -- 0:00:04
922000 -- [-1042.279] (-1040.264) (-1039.034) (-1039.863) * (-1040.039) [-1038.165] (-1039.688) (-1038.224) -- 0:00:04
922500 -- (-1046.061) [-1040.808] (-1037.979) (-1041.275) * [-1037.618] (-1039.031) (-1040.256) (-1041.226) -- 0:00:04
923000 -- (-1041.798) [-1038.993] (-1039.699) (-1038.981) * [-1039.269] (-1041.839) (-1039.543) (-1041.426) -- 0:00:04
923500 -- (-1038.275) [-1038.876] (-1040.968) (-1038.867) * (-1043.593) (-1040.985) (-1037.970) [-1039.004] -- 0:00:04
924000 -- [-1038.076] (-1040.720) (-1039.077) (-1038.867) * (-1049.641) (-1040.912) (-1040.325) [-1040.448] -- 0:00:04
924500 -- [-1040.856] (-1043.238) (-1042.463) (-1039.967) * (-1039.951) [-1040.700] (-1040.797) (-1041.357) -- 0:00:04
925000 -- (-1037.931) (-1041.419) (-1038.573) [-1040.011] * (-1038.884) (-1039.209) (-1047.157) [-1038.087] -- 0:00:04
Average standard deviation of split frequencies: 0.006332
925500 -- (-1042.000) (-1039.689) [-1038.236] (-1037.791) * (-1042.229) (-1039.950) [-1039.032] (-1040.716) -- 0:00:04
926000 -- (-1040.378) [-1040.619] (-1041.582) (-1044.146) * [-1043.296] (-1042.436) (-1039.454) (-1040.997) -- 0:00:04
926500 -- [-1041.186] (-1040.544) (-1043.866) (-1042.303) * [-1040.784] (-1039.144) (-1039.311) (-1042.092) -- 0:00:04
927000 -- [-1038.447] (-1041.050) (-1039.228) (-1047.677) * (-1039.342) (-1040.206) [-1040.768] (-1041.839) -- 0:00:04
927500 -- (-1038.388) [-1041.005] (-1038.339) (-1040.099) * (-1039.627) [-1041.024] (-1041.551) (-1041.198) -- 0:00:04
928000 -- [-1039.223] (-1038.895) (-1038.752) (-1039.032) * (-1039.733) (-1038.188) (-1042.013) [-1040.549] -- 0:00:04
928500 -- (-1038.087) [-1039.749] (-1039.578) (-1042.057) * (-1041.634) (-1038.345) (-1042.145) [-1040.480] -- 0:00:04
929000 -- [-1040.312] (-1041.549) (-1045.791) (-1043.240) * [-1038.989] (-1039.106) (-1040.774) (-1038.641) -- 0:00:04
929500 -- [-1038.033] (-1038.562) (-1039.527) (-1039.243) * (-1040.633) (-1038.957) (-1039.532) [-1042.651] -- 0:00:04
930000 -- (-1040.655) (-1039.013) (-1040.116) [-1044.657] * [-1038.997] (-1040.184) (-1038.235) (-1038.869) -- 0:00:04
Average standard deviation of split frequencies: 0.005639
930500 -- (-1041.732) [-1039.912] (-1043.015) (-1040.953) * [-1041.893] (-1041.414) (-1040.501) (-1038.312) -- 0:00:04
931000 -- (-1038.444) (-1040.574) [-1042.851] (-1041.474) * (-1041.480) (-1039.249) [-1038.192] (-1038.390) -- 0:00:04
931500 -- (-1038.688) (-1042.146) [-1040.877] (-1038.649) * (-1039.716) (-1039.090) [-1038.980] (-1040.387) -- 0:00:04
932000 -- [-1038.382] (-1040.891) (-1042.734) (-1039.938) * (-1038.625) (-1043.499) (-1038.858) [-1040.220] -- 0:00:04
932500 -- (-1040.958) (-1040.263) [-1038.707] (-1039.876) * [-1039.728] (-1045.247) (-1043.127) (-1040.990) -- 0:00:04
933000 -- (-1038.314) (-1040.713) (-1041.381) [-1040.576] * (-1041.990) (-1041.815) [-1039.272] (-1040.121) -- 0:00:04
933500 -- [-1037.960] (-1041.671) (-1039.764) (-1042.136) * [-1042.348] (-1038.438) (-1044.486) (-1040.366) -- 0:00:04
934000 -- (-1038.060) (-1042.173) (-1038.734) [-1040.605] * (-1041.149) (-1040.102) (-1043.650) [-1038.477] -- 0:00:04
934500 -- (-1040.296) (-1037.554) [-1038.932] (-1038.475) * (-1040.806) (-1038.590) [-1040.205] (-1038.088) -- 0:00:04
935000 -- (-1038.406) (-1039.011) (-1039.556) [-1040.549] * [-1040.076] (-1038.637) (-1039.353) (-1040.211) -- 0:00:04
Average standard deviation of split frequencies: 0.006075
935500 -- (-1037.857) (-1045.556) [-1039.624] (-1042.101) * [-1038.090] (-1038.418) (-1039.663) (-1040.462) -- 0:00:04
936000 -- (-1039.440) [-1042.192] (-1039.458) (-1039.216) * (-1038.587) (-1038.969) (-1037.837) [-1041.403] -- 0:00:04
936500 -- (-1045.038) [-1042.207] (-1044.169) (-1039.482) * [-1039.843] (-1040.427) (-1041.508) (-1039.427) -- 0:00:04
937000 -- (-1041.845) [-1045.709] (-1039.572) (-1045.047) * (-1042.594) (-1040.366) (-1039.268) [-1042.704] -- 0:00:03
937500 -- (-1039.617) (-1040.720) [-1038.811] (-1039.860) * (-1038.581) [-1040.790] (-1040.226) (-1045.908) -- 0:00:03
938000 -- (-1041.105) (-1042.506) [-1043.081] (-1038.928) * [-1040.739] (-1041.144) (-1038.595) (-1045.438) -- 0:00:03
938500 -- (-1043.332) (-1039.158) (-1044.208) [-1039.638] * [-1041.148] (-1041.812) (-1039.416) (-1040.426) -- 0:00:03
939000 -- (-1041.449) (-1038.619) [-1040.205] (-1038.705) * (-1039.842) (-1040.173) (-1040.466) [-1040.021] -- 0:00:03
939500 -- (-1041.021) (-1038.712) [-1039.844] (-1040.939) * (-1039.247) [-1040.383] (-1043.786) (-1039.409) -- 0:00:03
940000 -- (-1042.131) [-1038.284] (-1042.396) (-1039.885) * (-1044.274) [-1039.469] (-1038.911) (-1044.048) -- 0:00:03
Average standard deviation of split frequencies: 0.006296
940500 -- (-1039.437) [-1039.081] (-1038.948) (-1041.863) * [-1041.377] (-1040.495) (-1039.951) (-1043.772) -- 0:00:03
941000 -- (-1039.006) (-1038.266) [-1039.093] (-1043.504) * [-1038.837] (-1040.484) (-1040.770) (-1038.859) -- 0:00:03
941500 -- (-1038.846) (-1041.262) (-1038.591) [-1039.787] * (-1038.983) (-1040.001) (-1037.622) [-1041.306] -- 0:00:03
942000 -- (-1039.948) (-1041.286) [-1039.081] (-1040.065) * [-1038.289] (-1041.758) (-1038.490) (-1043.919) -- 0:00:03
942500 -- (-1041.141) [-1041.169] (-1039.916) (-1040.040) * (-1042.825) [-1040.485] (-1044.866) (-1042.435) -- 0:00:03
943000 -- (-1039.194) (-1039.674) (-1040.133) [-1038.235] * (-1042.239) [-1037.813] (-1038.327) (-1038.503) -- 0:00:03
943500 -- (-1041.571) (-1040.490) [-1039.680] (-1040.602) * [-1042.030] (-1039.027) (-1039.353) (-1040.021) -- 0:00:03
944000 -- (-1038.935) (-1039.525) [-1039.372] (-1041.431) * (-1039.039) (-1039.441) [-1038.723] (-1040.799) -- 0:00:03
944500 -- (-1046.361) (-1039.144) [-1039.177] (-1039.178) * (-1038.354) (-1039.989) [-1038.721] (-1041.588) -- 0:00:03
945000 -- (-1039.848) (-1038.477) [-1038.811] (-1041.970) * (-1039.939) [-1038.064] (-1038.633) (-1039.099) -- 0:00:03
Average standard deviation of split frequencies: 0.006353
945500 -- (-1039.235) (-1040.883) [-1038.788] (-1041.902) * (-1037.910) (-1038.081) (-1039.805) [-1038.910] -- 0:00:03
946000 -- (-1042.831) (-1041.180) (-1041.470) [-1043.299] * (-1037.884) (-1041.026) (-1039.004) [-1042.476] -- 0:00:03
946500 -- [-1040.268] (-1042.243) (-1039.981) (-1042.392) * (-1038.935) (-1038.640) (-1039.779) [-1039.159] -- 0:00:03
947000 -- (-1039.970) (-1038.998) [-1039.827] (-1041.120) * [-1039.536] (-1037.729) (-1040.972) (-1041.011) -- 0:00:03
947500 -- (-1040.780) (-1038.442) [-1040.676] (-1040.936) * (-1039.267) (-1037.583) (-1040.792) [-1038.133] -- 0:00:03
948000 -- (-1040.580) (-1039.182) (-1039.127) [-1040.649] * (-1041.507) (-1039.148) [-1038.815] (-1040.171) -- 0:00:03
948500 -- (-1038.151) (-1038.424) [-1038.191] (-1041.733) * (-1039.063) (-1042.058) [-1038.919] (-1039.461) -- 0:00:03
949000 -- (-1040.121) (-1039.596) (-1041.572) [-1041.075] * (-1038.618) [-1039.686] (-1039.989) (-1040.372) -- 0:00:03
949500 -- (-1040.596) (-1045.277) [-1047.620] (-1039.784) * (-1039.927) (-1043.949) [-1038.656] (-1039.955) -- 0:00:03
950000 -- (-1040.789) (-1041.843) [-1039.986] (-1042.054) * (-1041.933) (-1040.091) [-1041.003] (-1039.605) -- 0:00:03
Average standard deviation of split frequencies: 0.006043
950500 -- [-1038.146] (-1037.763) (-1039.899) (-1039.692) * (-1040.893) (-1038.834) (-1041.062) [-1038.326] -- 0:00:03
951000 -- (-1038.547) (-1040.209) (-1044.583) [-1039.800] * (-1040.224) [-1038.665] (-1040.639) (-1038.131) -- 0:00:03
951500 -- (-1039.947) [-1040.780] (-1039.461) (-1038.409) * [-1037.849] (-1039.263) (-1039.976) (-1040.059) -- 0:00:03
952000 -- [-1039.209] (-1040.687) (-1039.073) (-1041.193) * [-1038.452] (-1040.136) (-1044.807) (-1038.342) -- 0:00:03
952500 -- (-1039.336) (-1039.059) [-1038.756] (-1040.450) * (-1040.926) [-1038.198] (-1043.133) (-1038.256) -- 0:00:02
953000 -- [-1039.011] (-1038.758) (-1038.734) (-1041.197) * (-1040.477) [-1040.602] (-1041.268) (-1037.869) -- 0:00:02
953500 -- (-1038.702) (-1040.852) [-1040.020] (-1042.363) * (-1039.055) [-1040.033] (-1039.679) (-1038.990) -- 0:00:02
954000 -- (-1041.952) (-1039.290) [-1040.142] (-1040.894) * [-1040.232] (-1039.485) (-1042.209) (-1038.706) -- 0:00:02
954500 -- [-1040.755] (-1041.955) (-1038.385) (-1039.905) * (-1038.801) [-1039.538] (-1040.139) (-1038.002) -- 0:00:02
955000 -- [-1041.146] (-1039.959) (-1038.299) (-1047.849) * (-1039.614) (-1041.291) [-1039.924] (-1040.326) -- 0:00:02
Average standard deviation of split frequencies: 0.005490
955500 -- (-1037.568) [-1042.836] (-1040.200) (-1040.187) * (-1039.286) (-1042.474) (-1039.418) [-1041.056] -- 0:00:02
956000 -- [-1039.063] (-1039.735) (-1040.709) (-1039.500) * (-1038.960) (-1040.260) [-1040.111] (-1041.025) -- 0:00:02
956500 -- (-1039.694) [-1038.798] (-1042.879) (-1042.156) * (-1039.843) [-1040.809] (-1040.539) (-1039.695) -- 0:00:02
957000 -- (-1038.375) (-1040.531) [-1040.497] (-1040.760) * (-1041.868) [-1039.107] (-1038.515) (-1044.242) -- 0:00:02
957500 -- (-1038.370) [-1041.035] (-1041.943) (-1044.212) * (-1046.181) [-1039.592] (-1038.457) (-1041.228) -- 0:00:02
958000 -- (-1038.543) [-1040.603] (-1039.161) (-1042.736) * (-1039.017) (-1039.064) (-1040.332) [-1039.037] -- 0:00:02
958500 -- [-1039.182] (-1039.118) (-1040.530) (-1040.696) * (-1040.163) (-1040.471) (-1038.113) [-1038.419] -- 0:00:02
959000 -- [-1040.286] (-1040.583) (-1040.543) (-1038.621) * (-1040.680) (-1037.995) [-1042.352] (-1043.560) -- 0:00:02
959500 -- (-1039.448) [-1041.376] (-1043.483) (-1047.129) * (-1040.414) (-1037.905) [-1038.327] (-1037.887) -- 0:00:02
960000 -- (-1041.154) (-1039.157) (-1039.199) [-1045.812] * (-1039.979) [-1037.811] (-1040.733) (-1048.469) -- 0:00:02
Average standard deviation of split frequencies: 0.006287
960500 -- [-1040.223] (-1039.625) (-1039.715) (-1046.397) * (-1040.415) [-1039.182] (-1041.878) (-1039.028) -- 0:00:02
961000 -- (-1040.570) [-1038.533] (-1042.342) (-1044.511) * (-1039.837) (-1040.155) [-1040.170] (-1042.325) -- 0:00:02
961500 -- (-1040.250) [-1038.906] (-1042.873) (-1039.376) * (-1040.396) (-1038.332) (-1042.069) [-1040.212] -- 0:00:02
962000 -- (-1042.572) [-1039.040] (-1041.256) (-1038.858) * (-1039.524) (-1038.868) (-1043.326) [-1040.713] -- 0:00:02
962500 -- [-1038.660] (-1040.314) (-1039.389) (-1039.189) * (-1039.955) (-1042.163) [-1047.622] (-1042.602) -- 0:00:02
963000 -- (-1039.536) [-1038.153] (-1038.748) (-1042.200) * [-1039.343] (-1043.458) (-1045.277) (-1043.097) -- 0:00:02
963500 -- [-1039.620] (-1044.817) (-1038.597) (-1039.632) * [-1039.780] (-1039.172) (-1040.485) (-1040.266) -- 0:00:02
964000 -- [-1038.250] (-1039.609) (-1038.151) (-1043.535) * (-1039.901) (-1038.099) [-1039.479] (-1041.289) -- 0:00:02
964500 -- (-1041.158) (-1037.848) [-1038.687] (-1039.890) * (-1049.156) (-1039.797) [-1040.863] (-1042.135) -- 0:00:02
965000 -- (-1038.449) (-1038.167) [-1039.489] (-1042.837) * (-1039.956) [-1044.001] (-1042.968) (-1041.896) -- 0:00:02
Average standard deviation of split frequencies: 0.005917
965500 -- (-1042.597) [-1038.096] (-1040.984) (-1039.910) * (-1044.101) [-1039.052] (-1038.094) (-1039.929) -- 0:00:02
966000 -- [-1039.170] (-1037.972) (-1041.160) (-1040.921) * (-1040.677) (-1043.225) (-1039.059) [-1038.525] -- 0:00:02
966500 -- (-1038.213) (-1038.469) [-1038.806] (-1042.573) * (-1040.126) [-1038.526] (-1038.771) (-1039.023) -- 0:00:02
967000 -- [-1038.619] (-1037.745) (-1041.832) (-1038.902) * (-1040.087) (-1042.634) (-1038.967) [-1039.254] -- 0:00:02
967500 -- (-1040.713) (-1039.066) [-1045.721] (-1042.053) * [-1039.962] (-1041.479) (-1040.370) (-1039.400) -- 0:00:02
968000 -- (-1041.070) [-1039.934] (-1041.296) (-1041.103) * [-1039.991] (-1038.359) (-1041.496) (-1039.384) -- 0:00:02
968500 -- (-1039.559) [-1045.880] (-1039.283) (-1040.296) * (-1039.329) (-1040.488) [-1042.053] (-1039.880) -- 0:00:01
969000 -- (-1039.530) (-1041.576) [-1037.723] (-1038.746) * (-1039.518) [-1040.065] (-1040.640) (-1041.249) -- 0:00:01
969500 -- (-1044.284) [-1038.095] (-1040.880) (-1039.843) * (-1039.915) [-1042.665] (-1039.435) (-1041.621) -- 0:00:01
970000 -- [-1042.547] (-1043.670) (-1041.299) (-1041.190) * (-1040.412) [-1038.322] (-1038.137) (-1041.948) -- 0:00:01
Average standard deviation of split frequencies: 0.006162
970500 -- (-1043.655) (-1039.426) [-1038.768] (-1038.897) * (-1039.907) [-1040.650] (-1041.771) (-1038.330) -- 0:00:01
971000 -- (-1045.484) [-1039.514] (-1038.681) (-1041.249) * [-1040.255] (-1041.304) (-1039.359) (-1038.150) -- 0:00:01
971500 -- [-1039.428] (-1039.789) (-1042.618) (-1045.385) * (-1039.793) (-1042.898) (-1041.432) [-1040.419] -- 0:00:01
972000 -- (-1038.704) [-1039.314] (-1040.594) (-1039.548) * [-1037.831] (-1039.983) (-1038.716) (-1041.498) -- 0:00:01
972500 -- (-1041.254) [-1040.488] (-1040.337) (-1037.750) * (-1038.609) (-1043.633) (-1042.129) [-1039.211] -- 0:00:01
973000 -- (-1039.980) [-1038.732] (-1042.548) (-1040.468) * (-1039.834) (-1040.813) (-1040.923) [-1038.995] -- 0:00:01
973500 -- [-1038.924] (-1040.208) (-1041.227) (-1039.878) * (-1040.494) (-1038.581) [-1040.483] (-1039.789) -- 0:00:01
974000 -- (-1040.224) (-1043.697) [-1039.749] (-1040.825) * (-1040.628) (-1038.566) [-1041.096] (-1038.882) -- 0:00:01
974500 -- (-1038.857) (-1045.661) [-1041.202] (-1040.815) * (-1041.597) (-1042.328) (-1047.262) [-1043.292] -- 0:00:01
975000 -- (-1038.433) (-1042.097) [-1038.466] (-1039.579) * (-1038.755) (-1041.116) [-1044.231] (-1037.819) -- 0:00:01
Average standard deviation of split frequencies: 0.006158
975500 -- (-1039.537) [-1041.012] (-1038.922) (-1041.150) * (-1040.467) (-1041.042) (-1040.331) [-1041.808] -- 0:00:01
976000 -- (-1039.407) (-1041.711) [-1038.571] (-1041.962) * (-1040.400) [-1038.819] (-1039.807) (-1039.104) -- 0:00:01
976500 -- (-1039.059) [-1039.505] (-1038.800) (-1039.646) * [-1041.277] (-1039.051) (-1039.625) (-1039.367) -- 0:00:01
977000 -- [-1039.967] (-1038.758) (-1046.420) (-1041.424) * (-1038.402) [-1039.394] (-1042.990) (-1039.406) -- 0:00:01
977500 -- [-1039.599] (-1039.683) (-1039.221) (-1038.376) * (-1039.355) [-1038.365] (-1051.030) (-1040.858) -- 0:00:01
978000 -- [-1040.665] (-1042.718) (-1037.581) (-1038.323) * (-1040.915) (-1041.848) [-1038.512] (-1040.661) -- 0:00:01
978500 -- (-1037.686) [-1042.547] (-1038.309) (-1040.975) * (-1038.852) (-1038.167) [-1038.297] (-1045.537) -- 0:00:01
979000 -- (-1038.916) (-1041.055) [-1042.659] (-1039.177) * (-1039.199) (-1038.161) (-1039.861) [-1042.687] -- 0:00:01
979500 -- (-1040.860) (-1038.111) [-1042.850] (-1040.068) * (-1042.763) [-1037.868] (-1046.935) (-1042.801) -- 0:00:01
980000 -- (-1038.963) [-1038.430] (-1042.157) (-1038.775) * (-1045.227) [-1038.640] (-1039.581) (-1040.441) -- 0:00:01
Average standard deviation of split frequencies: 0.005828
980500 -- (-1040.055) (-1042.186) (-1038.693) [-1039.101] * (-1040.458) [-1038.549] (-1039.335) (-1040.091) -- 0:00:01
981000 -- (-1041.959) (-1038.795) (-1042.795) [-1041.498] * (-1040.090) [-1038.403] (-1038.716) (-1039.190) -- 0:00:01
981500 -- (-1039.292) [-1038.205] (-1045.152) (-1043.497) * (-1042.082) [-1042.558] (-1039.526) (-1038.305) -- 0:00:01
982000 -- (-1042.433) (-1040.103) (-1047.384) [-1041.716] * (-1042.079) (-1039.485) [-1039.366] (-1039.346) -- 0:00:01
982500 -- (-1047.526) [-1041.064] (-1040.869) (-1044.058) * (-1039.482) (-1038.614) [-1040.818] (-1045.567) -- 0:00:01
983000 -- (-1040.280) (-1039.157) (-1039.445) [-1043.725] * (-1038.768) (-1039.895) (-1038.367) [-1040.900] -- 0:00:01
983500 -- [-1042.621] (-1039.184) (-1038.844) (-1042.430) * [-1039.407] (-1038.183) (-1041.381) (-1038.271) -- 0:00:01
984000 -- (-1040.711) (-1040.748) (-1042.133) [-1039.086] * (-1040.257) (-1041.719) (-1041.895) [-1042.642] -- 0:00:01
984500 -- (-1042.143) (-1040.631) [-1040.148] (-1039.290) * (-1039.213) (-1041.103) [-1043.888] (-1041.805) -- 0:00:00
985000 -- [-1042.702] (-1039.111) (-1041.587) (-1042.768) * (-1037.835) (-1038.932) [-1038.850] (-1041.413) -- 0:00:00
Average standard deviation of split frequencies: 0.005737
985500 -- (-1048.295) (-1039.880) (-1038.289) [-1039.590] * [-1038.622] (-1037.754) (-1040.134) (-1044.478) -- 0:00:00
986000 -- [-1041.027] (-1044.696) (-1041.113) (-1039.372) * (-1038.270) (-1038.569) [-1040.344] (-1040.507) -- 0:00:00
986500 -- (-1041.065) (-1042.207) (-1044.239) [-1038.822] * (-1038.671) [-1038.408] (-1040.285) (-1038.984) -- 0:00:00
987000 -- [-1044.606] (-1042.960) (-1045.113) (-1039.356) * (-1040.780) [-1039.210] (-1043.177) (-1038.815) -- 0:00:00
987500 -- (-1042.469) (-1038.907) (-1041.546) [-1040.583] * (-1042.710) [-1038.113] (-1041.722) (-1038.912) -- 0:00:00
988000 -- (-1043.915) [-1039.612] (-1041.369) (-1042.717) * (-1038.929) [-1040.170] (-1039.154) (-1041.130) -- 0:00:00
988500 -- (-1041.332) [-1039.514] (-1041.046) (-1038.235) * [-1038.896] (-1039.769) (-1041.106) (-1042.334) -- 0:00:00
989000 -- [-1038.799] (-1037.721) (-1039.859) (-1040.718) * [-1039.009] (-1039.400) (-1041.906) (-1039.929) -- 0:00:00
989500 -- (-1044.016) [-1038.739] (-1038.809) (-1039.479) * [-1040.013] (-1041.592) (-1041.708) (-1041.238) -- 0:00:00
990000 -- (-1042.880) (-1038.564) (-1041.565) [-1042.032] * (-1040.601) (-1040.907) [-1039.714] (-1040.941) -- 0:00:00
Average standard deviation of split frequencies: 0.005298
990500 -- (-1041.465) (-1042.916) [-1043.423] (-1039.880) * (-1040.635) (-1038.652) (-1042.644) [-1038.820] -- 0:00:00
991000 -- (-1040.263) [-1038.968] (-1041.480) (-1042.696) * (-1044.141) [-1038.652] (-1039.438) (-1039.566) -- 0:00:00
991500 -- (-1040.692) (-1038.061) [-1039.335] (-1039.636) * (-1040.695) [-1042.263] (-1038.659) (-1037.996) -- 0:00:00
992000 -- (-1037.604) (-1038.996) (-1038.902) [-1037.879] * (-1040.688) [-1039.839] (-1039.281) (-1039.014) -- 0:00:00
992500 -- (-1040.369) [-1038.543] (-1039.066) (-1040.168) * [-1040.309] (-1038.738) (-1039.525) (-1044.609) -- 0:00:00
993000 -- (-1040.708) (-1037.656) (-1039.207) [-1038.906] * (-1041.102) (-1037.968) [-1044.051] (-1041.555) -- 0:00:00
993500 -- (-1040.915) (-1037.660) [-1040.267] (-1042.677) * (-1038.121) [-1038.563] (-1040.889) (-1039.607) -- 0:00:00
994000 -- (-1040.192) (-1037.898) (-1039.694) [-1039.582] * (-1039.479) [-1038.612] (-1039.519) (-1041.063) -- 0:00:00
994500 -- (-1038.953) (-1039.845) [-1039.680] (-1040.514) * (-1039.036) (-1040.224) (-1049.471) [-1039.141] -- 0:00:00
995000 -- [-1038.280] (-1038.136) (-1039.034) (-1040.105) * (-1039.921) [-1039.679] (-1040.931) (-1039.356) -- 0:00:00
Average standard deviation of split frequencies: 0.005080
995500 -- (-1039.947) (-1039.381) (-1038.563) [-1039.885] * (-1038.852) (-1040.599) (-1038.666) [-1039.308] -- 0:00:00
996000 -- [-1039.410] (-1039.327) (-1039.195) (-1041.062) * [-1038.475] (-1040.866) (-1042.162) (-1039.473) -- 0:00:00
996500 -- (-1040.170) (-1038.563) (-1039.106) [-1039.228] * [-1039.725] (-1037.854) (-1040.272) (-1039.788) -- 0:00:00
997000 -- (-1040.241) (-1038.673) [-1039.129] (-1038.502) * (-1038.771) (-1039.978) (-1040.514) [-1039.697] -- 0:00:00
997500 -- (-1039.837) (-1039.742) [-1038.121] (-1040.263) * (-1037.989) [-1038.984] (-1040.689) (-1039.668) -- 0:00:00
998000 -- (-1037.721) [-1040.456] (-1039.695) (-1043.148) * (-1042.485) (-1040.066) (-1041.614) [-1042.479] -- 0:00:00
998500 -- (-1042.358) (-1041.166) [-1038.339] (-1042.965) * (-1042.435) (-1038.874) [-1044.552] (-1039.382) -- 0:00:00
999000 -- (-1040.567) (-1042.725) [-1038.686] (-1042.807) * [-1040.787] (-1040.148) (-1039.364) (-1041.415) -- 0:00:00
999500 -- (-1041.992) (-1039.809) (-1038.212) [-1039.529] * (-1041.280) (-1040.404) [-1039.783] (-1042.701) -- 0:00:00
1000000 -- (-1038.801) (-1041.082) [-1038.681] (-1038.978) * (-1040.066) [-1039.324] (-1038.801) (-1040.354) -- 0:00:00
Average standard deviation of split frequencies: 0.004868
Analysis completed in 1 mins 3 seconds
Analysis used 61.55 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1037.52
Likelihood of best state for "cold" chain of run 2 was -1037.52
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.0 % ( 79 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
26.6 % ( 27 %) Dirichlet(Pi{all})
29.1 % ( 22 %) Slider(Pi{all})
78.3 % ( 57 %) Multiplier(Alpha{1,2})
77.7 % ( 57 %) Multiplier(Alpha{3})
20.7 % ( 27 %) Slider(Pinvar{all})
98.7 % (100 %) ExtSPR(Tau{all},V{all})
69.8 % ( 61 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 27 %) Multiplier(V{all})
97.4 % (100 %) Nodeslider(V{all})
30.4 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.7 % ( 72 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
26.9 % ( 25 %) Dirichlet(Pi{all})
28.9 % ( 20 %) Slider(Pi{all})
79.1 % ( 55 %) Multiplier(Alpha{1,2})
78.1 % ( 53 %) Multiplier(Alpha{3})
21.4 % ( 28 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.0 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 84 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
97.4 % ( 95 %) Nodeslider(V{all})
30.2 % ( 21 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166320 0.82 0.67
3 | 166187 166841 0.84
4 | 166440 166912 167300
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167034 0.82 0.66
3 | 167125 166529 0.83
4 | 166032 166655 166625
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1039.19
| 1 2 |
| 2 1 |
| 2 1|
| 1 2 2 1 2 |
| 12 11 * 2 |
| 221 1 2 1 2 2 12 1 |
| 2 2 * 1 1 2 1 11 2 21 21 1 2|
| 1 1 2 1 2 2* 2 *2 2 1 |
| 1 1 2 2 2 *2 11 12 *1 11 2 |
|*212 2 1 * 1 1 2 2 2 1* 2 212 |
| 1 1 1 1 1 |
| 2 2 1 2 1 2 2 1 1 2 |
| 2 2 |
| 2 1 |
| 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1040.84
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1039.27 -1042.91
2 -1039.24 -1042.46
--------------------------------------
TOTAL -1039.25 -1042.71
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.906651 0.089087 0.367455 1.488333 0.872747 1247.01 1374.00 1.000
r(A<->C){all} 0.170110 0.020446 0.000062 0.459721 0.135533 132.44 238.38 1.004
r(A<->G){all} 0.162623 0.018790 0.000039 0.450589 0.124494 187.40 209.16 1.006
r(A<->T){all} 0.155769 0.017596 0.000074 0.423604 0.120149 199.74 260.12 1.000
r(C<->G){all} 0.170961 0.020309 0.000065 0.447991 0.131734 219.66 242.99 1.000
r(C<->T){all} 0.173705 0.020863 0.000058 0.462985 0.135792 229.23 250.35 1.003
r(G<->T){all} 0.166832 0.020063 0.000009 0.448450 0.133013 256.66 310.75 1.008
pi(A){all} 0.193255 0.000208 0.163342 0.219337 0.193171 1139.31 1320.15 1.000
pi(C){all} 0.313257 0.000281 0.280713 0.346086 0.313298 985.73 1050.07 1.001
pi(G){all} 0.296136 0.000264 0.265751 0.329009 0.296122 1182.87 1200.98 1.000
pi(T){all} 0.197351 0.000216 0.169294 0.226298 0.196975 1169.89 1189.96 1.000
alpha{1,2} 0.420732 0.225922 0.000145 1.383276 0.249502 985.17 1152.80 1.000
alpha{3} 0.461734 0.239803 0.000198 1.412645 0.299766 861.62 932.52 1.000
pinvar{all} 0.997946 0.000006 0.993457 1.000000 0.998715 1333.52 1353.45 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ....**
8 -- .*.***
9 -- .*...*
10 -- .**.**
11 -- .**...
12 -- ..****
13 -- ..**..
14 -- ...*.*
15 -- ..*.*.
16 -- ...**.
17 -- .*..*.
18 -- .*.*..
19 -- ..*..*
20 -- .***.*
21 -- .****.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 455 0.151566 0.003298 0.149234 0.153897 2
8 454 0.151233 0.006595 0.146569 0.155896 2
9 453 0.150899 0.001413 0.149900 0.151899 2
10 443 0.147568 0.000471 0.147235 0.147901 2
11 436 0.145237 0.000000 0.145237 0.145237 2
12 431 0.143571 0.009893 0.136576 0.150566 2
13 429 0.142905 0.007066 0.137908 0.147901 2
14 427 0.142239 0.003298 0.139907 0.144570 2
15 426 0.141905 0.001884 0.140573 0.143238 2
16 423 0.140906 0.000471 0.140573 0.141239 2
17 421 0.140240 0.003298 0.137908 0.142572 2
18 419 0.139574 0.005182 0.135909 0.143238 2
19 419 0.139574 0.012719 0.130580 0.148568 2
20 408 0.135909 0.005653 0.131912 0.139907 2
21 401 0.133578 0.011777 0.125250 0.141905 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.104859 0.010344 0.000051 0.311661 0.075054 1.000 2
length{all}[2] 0.100326 0.010224 0.000024 0.308395 0.070690 1.000 2
length{all}[3] 0.098184 0.009285 0.000066 0.293628 0.068595 1.000 2
length{all}[4] 0.102036 0.010664 0.000027 0.301611 0.069607 1.000 2
length{all}[5] 0.100329 0.010526 0.000006 0.295753 0.067936 1.001 2
length{all}[6] 0.099530 0.009769 0.000025 0.298068 0.070808 1.000 2
length{all}[7] 0.092534 0.009665 0.000046 0.264801 0.062687 0.998 2
length{all}[8] 0.094974 0.008848 0.000050 0.300299 0.065837 0.998 2
length{all}[9] 0.097480 0.009530 0.000325 0.287533 0.068626 0.998 2
length{all}[10] 0.108990 0.012088 0.000241 0.343166 0.069783 1.000 2
length{all}[11] 0.107954 0.010131 0.000593 0.317695 0.078148 0.998 2
length{all}[12] 0.102816 0.010287 0.000750 0.318138 0.071471 0.998 2
length{all}[13] 0.100661 0.009353 0.000068 0.310458 0.070045 0.999 2
length{all}[14] 0.097090 0.009938 0.000190 0.291572 0.068575 1.000 2
length{all}[15] 0.104318 0.009512 0.000094 0.303766 0.071729 1.000 2
length{all}[16] 0.097364 0.010406 0.000053 0.319152 0.057867 0.998 2
length{all}[17] 0.109975 0.011591 0.000278 0.321719 0.080017 0.999 2
length{all}[18] 0.103553 0.008826 0.000124 0.291287 0.075055 0.998 2
length{all}[19] 0.101196 0.009187 0.000134 0.287774 0.071209 0.999 2
length{all}[20] 0.097897 0.009948 0.000130 0.302289 0.065595 0.998 2
length{all}[21] 0.095573 0.009515 0.000013 0.302488 0.065838 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004868
Maximum standard deviation of split frequencies = 0.012719
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|-------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 762
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 55 patterns at 254 / 254 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 55 patterns at 254 / 254 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
53680 bytes for conP
4840 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.075094 0.094373 0.040862 0.023880 0.099582 0.058316 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1095.904986
Iterating by ming2
Initial: fx= 1095.904986
x= 0.07509 0.09437 0.04086 0.02388 0.09958 0.05832 0.30000 1.30000
1 h-m-p 0.0000 0.0001 607.6535 ++ 1060.559597 m 0.0001 13 | 1/8
2 h-m-p 0.0008 0.0044 68.7942 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 556.2875 ++ 1039.438321 m 0.0001 44 | 2/8
4 h-m-p 0.0007 0.0061 49.8205 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 498.3560 ++ 1021.958815 m 0.0001 75 | 3/8
6 h-m-p 0.0009 0.0086 35.4944 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 432.3486 ++ 1009.273955 m 0.0001 106 | 4/8
8 h-m-p 0.0010 0.0134 23.3382 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 353.6261 ++ 999.485693 m 0.0001 137 | 5/8
10 h-m-p 0.0015 0.0251 13.0749 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 250.8209 ++ 998.155418 m 0.0000 168 | 6/8
12 h-m-p 0.0867 8.0000 0.0000 +Y 998.155418 0 0.3468 180 | 6/8
13 h-m-p 1.1205 8.0000 0.0000 ++ 998.155418 m 8.0000 193 | 6/8
14 h-m-p 0.0160 8.0000 0.0002 +++++ 998.155418 m 8.0000 209 | 6/8
15 h-m-p 0.0184 8.0000 0.0969 -----Y 998.155418 0 0.0000 227 | 6/8
16 h-m-p 0.0220 8.0000 0.0000 --C 998.155418 0 0.0003 242 | 6/8
17 h-m-p 0.0231 8.0000 0.0000 ------Y 998.155418 0 0.0000 261
Out..
lnL = -998.155418
262 lfun, 262 eigenQcodon, 1572 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.060277 0.102039 0.077697 0.067049 0.010506 0.037541 0.300283 0.621111 0.392132
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.457914
np = 9
lnL0 = -1084.738813
Iterating by ming2
Initial: fx= 1084.738813
x= 0.06028 0.10204 0.07770 0.06705 0.01051 0.03754 0.30028 0.62111 0.39213
1 h-m-p 0.0000 0.0000 582.6925 ++ 1069.832886 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0003 361.3972 ++ 1036.696131 m 0.0003 26 | 2/9
3 h-m-p 0.0000 0.0001 1001.4104 ++ 1015.480214 m 0.0001 38 | 3/9
4 h-m-p 0.0001 0.0003 198.5118 ++ 1009.448075 m 0.0003 50 | 4/9
5 h-m-p 0.0000 0.0000 40889.7054 ++ 1003.601654 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 3306092.3707 ++ 999.433281 m 0.0000 74 | 6/9
7 h-m-p 0.0066 0.0823 4.6366 ------------.. | 6/9
8 h-m-p 0.0000 0.0000 249.1005 ++ 998.155404 m 0.0000 108 | 7/9
9 h-m-p 0.0287 8.0000 0.0000 +++++ 998.155404 m 8.0000 123 | 7/9
10 h-m-p 0.0160 8.0000 0.0166 -----Y 998.155404 0 0.0000 142 | 7/9
11 h-m-p 0.0160 8.0000 0.0032 +++++ 998.155404 m 8.0000 159 | 7/9
12 h-m-p 0.0000 0.0010 527.1854 ---------.. | 7/9
13 h-m-p 0.0160 8.0000 0.0001 +++++ 998.155404 m 8.0000 195 | 7/9
14 h-m-p 0.0173 8.0000 0.0270 --------C 998.155404 0 0.0000 217 | 7/9
15 h-m-p 0.0160 8.0000 0.0001 +++++ 998.155404 m 8.0000 234 | 7/9
16 h-m-p 0.0044 2.1784 0.3133 --------Y 998.155404 0 0.0000 256 | 7/9
17 h-m-p 0.0160 8.0000 0.0001 +++++ 998.155404 m 8.0000 273 | 7/9
18 h-m-p 0.0044 2.1865 0.3165 ---------C 998.155404 0 0.0000 296 | 7/9
19 h-m-p 0.0160 8.0000 0.0002 -------------.. | 7/9
20 h-m-p 0.0160 8.0000 0.0001 +++++ 998.155404 m 8.0000 338 | 7/9
21 h-m-p 0.0054 2.6885 0.4084 --------C 998.155404 0 0.0000 360 | 7/9
22 h-m-p 0.0160 8.0000 0.0005 +++++ 998.155403 m 8.0000 377 | 7/9
23 h-m-p 0.0130 2.2730 0.3215 -------------.. | 7/9
24 h-m-p 0.0160 8.0000 0.0001 +++++ 998.155403 m 8.0000 419 | 7/9
25 h-m-p 0.0054 2.6752 0.4107 --------Y 998.155403 0 0.0000 441 | 7/9
26 h-m-p 0.0160 8.0000 0.0001 +++++ 998.155403 m 8.0000 458 | 7/9
27 h-m-p 0.0059 2.9665 0.4580 ---------Y 998.155403 0 0.0000 481 | 7/9
28 h-m-p 0.0160 8.0000 0.0000 -----C 998.155403 0 0.0000 500 | 7/9
29 h-m-p 0.0160 8.0000 0.0000 +++++ 998.155403 m 8.0000 517 | 7/9
30 h-m-p 0.0051 2.5352 0.2667 --------Y 998.155403 0 0.0000 539 | 7/9
31 h-m-p 0.0160 8.0000 0.0002 ----C 998.155403 0 0.0000 557 | 7/9
32 h-m-p 0.0160 8.0000 0.0000 +++++ 998.155403 m 8.0000 574 | 7/9
33 h-m-p 0.0040 2.0131 0.3359 -------C 998.155403 0 0.0000 595 | 7/9
34 h-m-p 0.0160 8.0000 0.0009 ------Y 998.155403 0 0.0000 615 | 7/9
35 h-m-p 0.0160 8.0000 0.0000 +++++ 998.155403 m 8.0000 632 | 7/9
36 h-m-p 0.0044 2.1860 0.3098 --------Y 998.155403 0 0.0000 654 | 7/9
37 h-m-p 0.0160 8.0000 0.0208 +++++ 998.155394 m 8.0000 671 | 7/9
38 h-m-p 0.4719 2.3893 0.3530 ------------C 998.155394 0 0.0000 697 | 7/9
39 h-m-p 0.0160 8.0000 0.0001 ------Y 998.155394 0 0.0000 717 | 7/9
40 h-m-p 0.0160 8.0000 0.0002 +++++ 998.155394 m 8.0000 734 | 7/9
41 h-m-p 0.0077 3.8170 0.2232 -------------.. | 7/9
42 h-m-p 0.0160 8.0000 0.0001 +++++ 998.155394 m 8.0000 776 | 7/9
43 h-m-p 0.0086 4.2935 0.2659 -------------.. | 7/9
44 h-m-p 0.0160 8.0000 0.0001 +++++ 998.155393 m 8.0000 818 | 7/9
45 h-m-p 0.0086 4.2989 0.2655 -------------.. | 7/9
46 h-m-p 0.0160 8.0000 0.0001 +++++ 998.155393 m 8.0000 860 | 7/9
47 h-m-p 0.0083 4.1291 0.2764 ----------Y 998.155393 0 0.0000 884 | 7/9
48 h-m-p 0.0160 8.0000 0.0000 +++++ 998.155393 m 8.0000 901 | 7/9
49 h-m-p 0.0064 3.1784 0.2137 -------Y 998.155393 0 0.0000 922 | 7/9
50 h-m-p 0.0160 8.0000 0.0003 -----C 998.155393 0 0.0000 941 | 7/9
51 h-m-p 0.0160 8.0000 0.0000 +++++ 998.155393 m 8.0000 958 | 7/9
52 h-m-p 0.0077 3.8542 0.2191 --------C 998.155393 0 0.0000 980 | 7/9
53 h-m-p 0.0160 8.0000 0.0010 ---------C 998.155393 0 0.0000 1003 | 7/9
54 h-m-p 0.0122 6.0904 0.0260 +++++ 998.155377 m 6.0904 1020 | 8/9
55 h-m-p 0.3564 4.0367 0.0609 ++ 998.155347 m 4.0367 1034 | 9/9
56 h-m-p 0.0160 8.0000 0.0000 N 998.155347 0 0.0160 1047 | 9/9
57 h-m-p 0.0160 8.0000 0.0000 N 998.155347 0 0.0160 1059
Out..
lnL = -998.155347
1060 lfun, 3180 eigenQcodon, 12720 P(t)
Time used: 0:04
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.065644 0.092547 0.040913 0.057336 0.032691 0.047498 0.000100 1.601873 0.398649 0.395166 1.330071
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.782684
np = 11
lnL0 = -1079.367318
Iterating by ming2
Initial: fx= 1079.367318
x= 0.06564 0.09255 0.04091 0.05734 0.03269 0.04750 0.00011 1.60187 0.39865 0.39517 1.33007
1 h-m-p 0.0000 0.0000 571.2865 ++ 1078.383345 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0005 338.5817 +++ 1031.671168 m 0.0005 31 | 2/11
3 h-m-p 0.0000 0.0000 989.4475 ++ 1022.571948 m 0.0000 45 | 3/11
4 h-m-p 0.0001 0.0004 170.3076 ++ 1014.509049 m 0.0004 59 | 4/11
5 h-m-p 0.0000 0.0000 7500.9635 ++ 1006.985654 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 2130.8481 ++ 1002.909242 m 0.0000 87 | 6/11
7 h-m-p 0.0000 0.0000 6514082.1063 ++ 1002.450230 m 0.0000 101 | 7/11
8 h-m-p 0.0160 8.0000 2.4633 -------------.. | 7/11
9 h-m-p 0.0000 0.0001 244.2780 ++ 998.155393 m 0.0001 140 | 8/11
10 h-m-p 0.2412 8.0000 0.0000 +++ 998.155393 m 8.0000 155 | 8/11
11 h-m-p 0.0185 8.0000 0.0047 +++++ 998.155393 m 8.0000 175 | 8/11
12 h-m-p 0.0160 8.0000 2.9445 ---------Y 998.155393 0 0.0000 201 | 8/11
13 h-m-p 0.0160 8.0000 0.0000 +++++ 998.155393 m 8.0000 218 | 8/11
14 h-m-p 0.0174 8.0000 0.0021 +++++ 998.155393 m 8.0000 238 | 8/11
15 h-m-p 0.0072 0.3707 2.3299 +++ 998.155389 m 0.3707 256 | 9/11
16 h-m-p 1.6000 8.0000 0.2787 +Y 998.155388 0 4.3416 271 | 9/11
17 h-m-p 1.6000 8.0000 0.0617 Y 998.155388 0 0.9175 287 | 9/11
18 h-m-p 1.6000 8.0000 0.0009 ++ 998.155388 m 8.0000 303 | 9/11
19 h-m-p 1.6000 8.0000 0.0001 ++ 998.155388 m 8.0000 319 | 9/11
20 h-m-p 0.0160 8.0000 0.3528 +++++ 998.155383 m 8.0000 338 | 9/11
21 h-m-p 0.8592 8.0000 3.2849 ++ 998.155381 m 8.0000 354 | 9/11
22 h-m-p 1.6000 8.0000 7.2841 -----------N 998.155381 0 0.0000 379 | 9/11
23 h-m-p 0.0160 8.0000 0.0222 +++++ 998.155377 m 8.0000 396 | 9/11
24 h-m-p 0.0087 4.3524 25.7219 -------------.. | 9/11
25 h-m-p 0.0160 8.0000 0.0000 +++++ 998.155377 m 8.0000 440 | 9/11
26 h-m-p 0.0160 8.0000 0.3407 ------------N 998.155377 0 0.0000 468 | 9/11
27 h-m-p 0.0160 8.0000 0.0000 +++++ 998.155377 m 8.0000 487 | 9/11
28 h-m-p 0.0160 8.0000 11.9408 ++++Y 998.155347 0 4.0960 507 | 9/11
29 h-m-p 1.6000 8.0000 0.0000 N 998.155347 0 1.6000 521 | 9/11
30 h-m-p 0.0160 8.0000 0.0000 N 998.155347 0 0.0160 537
Out..
lnL = -998.155347
538 lfun, 2152 eigenQcodon, 9684 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -998.211381 S = -998.156483 -0.021235
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:06
did 20 / 55 patterns 0:06
did 30 / 55 patterns 0:06
did 40 / 55 patterns 0:07
did 50 / 55 patterns 0:07
did 55 / 55 patterns 0:07
Time used: 0:07
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.030845 0.039850 0.016120 0.037749 0.096061 0.069066 0.000100 0.790858 1.941313
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 19.329493
np = 9
lnL0 = -1067.707079
Iterating by ming2
Initial: fx= 1067.707079
x= 0.03084 0.03985 0.01612 0.03775 0.09606 0.06907 0.00011 0.79086 1.94131
1 h-m-p 0.0000 0.0000 568.6941 ++ 1066.977225 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0184 42.8950 +++++ 1051.406578 m 0.0184 29 | 2/9
3 h-m-p 0.0000 0.0001 1545.3277 ++ 1013.116654 m 0.0001 41 | 3/9
4 h-m-p 0.0001 0.0007 308.9334 ++ 1002.961476 m 0.0007 53 | 4/9
5 h-m-p 0.0000 0.0002 593.2547 ++ 1001.917083 m 0.0002 65 | 5/9
6 h-m-p 0.0000 0.0000 2526.3410 ++ 999.831901 m 0.0000 77 | 6/9
7 h-m-p 0.0022 0.0279 44.7188 ------------.. | 6/9
8 h-m-p 0.0000 0.0000 349.5319 ++ 999.668254 m 0.0000 111 | 7/9
9 h-m-p 0.0160 8.0000 0.8824 -------------.. | 7/9
10 h-m-p 0.0000 0.0000 246.3928 ++ 998.155347 m 0.0000 148 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 Y 998.155347 0 1.0000 160 | 8/9
12 h-m-p 1.6000 8.0000 0.0000 Y 998.155347 0 1.6000 173
Out..
lnL = -998.155347
174 lfun, 1914 eigenQcodon, 10440 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.068006 0.029779 0.103548 0.096286 0.028887 0.102812 0.000100 0.900000 0.327372 1.427104 1.298255
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 19.054366
np = 11
lnL0 = -1092.912655
Iterating by ming2
Initial: fx= 1092.912655
x= 0.06801 0.02978 0.10355 0.09629 0.02889 0.10281 0.00011 0.90000 0.32737 1.42710 1.29826
1 h-m-p 0.0000 0.0000 486.9688 ++ 1092.696434 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0004 368.3261 +++ 1056.636406 m 0.0004 31 | 2/11
3 h-m-p 0.0000 0.0000 525.5625 ++ 1055.660808 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0017 187.0218 ++++ 1023.196210 m 0.0017 61 | 4/11
5 h-m-p 0.0005 0.0027 94.1462 ++ 1007.899765 m 0.0027 75 | 5/11
6 h-m-p 0.0001 0.0004 155.3837 ++ 1005.050525 m 0.0004 89 | 6/11
7 h-m-p 0.0000 0.0001 269.0456 ++ 1003.215141 m 0.0001 103 | 7/11
8 h-m-p 0.0008 0.0067 36.3661 ++ 998.155396 m 0.0067 117 | 8/11
9 h-m-p 1.6000 8.0000 0.0004 ++ 998.155396 m 8.0000 131 | 8/11
10 h-m-p 0.0002 0.0803 114.5125 ---------Y 998.155396 0 0.0000 157 | 8/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 998.155396 m 8.0000 174 | 8/11
12 h-m-p 0.0054 2.7058 0.3575 --------Y 998.155396 0 0.0000 199 | 8/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 998.155396 m 8.0000 219 | 8/11
14 h-m-p 0.0081 4.0356 0.2539 -------------.. | 8/11
15 h-m-p 0.0160 8.0000 0.0001 +++++ 998.155396 m 8.0000 267 | 8/11
16 h-m-p 0.0079 3.9627 0.1938 -------------.. | 8/11
17 h-m-p 0.0160 8.0000 0.0001 +++++ 998.155396 m 8.0000 315 | 8/11
18 h-m-p 0.0080 3.9763 0.1933 -----------Y 998.155396 0 0.0000 343 | 8/11
19 h-m-p 0.0160 8.0000 0.0003 +++++ 998.155396 m 8.0000 363 | 8/11
20 h-m-p 0.0106 4.0950 0.2064 ---------Y 998.155396 0 0.0000 389 | 8/11
21 h-m-p 0.0160 8.0000 0.0002 +++++ 998.155396 m 8.0000 409 | 8/11
22 h-m-p 0.0085 4.2500 0.2050 -------------.. | 8/11
23 h-m-p 0.0160 8.0000 0.0001 +++++ 998.155396 m 8.0000 457 | 8/11
24 h-m-p 0.0082 4.0998 0.1884 ---------N 998.155396 0 0.0000 483 | 8/11
25 h-m-p 0.0160 8.0000 0.0001 +++++ 998.155396 m 8.0000 503 | 8/11
26 h-m-p 0.0067 3.3351 0.3191 -----------N 998.155396 0 0.0000 531 | 8/11
27 h-m-p 0.0160 8.0000 0.0001 +++++ 998.155396 m 8.0000 551 | 8/11
28 h-m-p 0.0071 3.5568 0.5161 --------Y 998.155396 0 0.0000 576 | 8/11
29 h-m-p 0.0160 8.0000 0.0000 --------N 998.155396 0 0.0000 601 | 8/11
30 h-m-p 0.0160 8.0000 0.0000 +++++ 998.155396 m 8.0000 621 | 8/11
31 h-m-p 0.0091 4.5327 0.2095 ---------Y 998.155396 0 0.0000 647 | 8/11
32 h-m-p 0.0160 8.0000 0.0001 ----Y 998.155396 0 0.0000 668 | 8/11
33 h-m-p 0.0160 8.0000 0.0000 +++++ 998.155396 m 8.0000 688 | 8/11
34 h-m-p 0.0085 4.2575 0.2362 ----------Y 998.155396 0 0.0000 715 | 8/11
35 h-m-p 0.0160 8.0000 0.0000 +++++ 998.155396 m 8.0000 735 | 8/11
36 h-m-p 0.0081 4.0274 0.2114 -----------Y 998.155396 0 0.0000 763 | 8/11
37 h-m-p 0.0160 8.0000 0.0000 ----C 998.155396 0 0.0000 784 | 8/11
38 h-m-p 0.0160 8.0000 0.0000 +++++ 998.155396 m 8.0000 804 | 8/11
39 h-m-p 0.0035 1.7506 0.4532 ---------N 998.155396 0 0.0000 830 | 8/11
40 h-m-p 0.0160 8.0000 0.0004 -------Y 998.155396 0 0.0000 854 | 8/11
41 h-m-p 0.0160 8.0000 0.0003 +++++ 998.155396 m 8.0000 874 | 8/11
42 h-m-p 0.0106 4.1698 0.1890 ---------Y 998.155396 0 0.0000 900 | 8/11
43 h-m-p 0.0160 8.0000 0.0001 +++++ 998.155396 m 8.0000 920 | 8/11
44 h-m-p 0.0084 4.1932 0.1881 -----------C 998.155396 0 0.0000 948 | 8/11
45 h-m-p 0.0160 8.0000 0.0000 +++++ 998.155396 m 8.0000 968 | 8/11
46 h-m-p 0.0084 4.2196 0.1881 -------------.. | 8/11
47 h-m-p 0.0160 8.0000 0.0001 +++++ 998.155396 m 8.0000 1016 | 8/11
48 h-m-p 0.0082 4.1146 0.1886 ----------N 998.155396 0 0.0000 1043 | 8/11
49 h-m-p 0.0160 8.0000 0.0001 +++++ 998.155396 m 8.0000 1063 | 8/11
50 h-m-p 0.0068 3.3786 0.5275 ------------Y 998.155396 0 0.0000 1092 | 8/11
51 h-m-p 0.0160 8.0000 0.0000 ----C 998.155396 0 0.0000 1113 | 8/11
52 h-m-p 0.0160 8.0000 0.0002 +++++ 998.155395 m 8.0000 1133 | 8/11
53 h-m-p 0.0082 4.1048 0.2042 ---------Y 998.155395 0 0.0000 1159 | 8/11
54 h-m-p 0.0160 8.0000 0.0001 +++++ 998.155395 m 8.0000 1179 | 8/11
55 h-m-p 0.0082 4.1105 0.2026 ---------Y 998.155395 0 0.0000 1205 | 8/11
56 h-m-p 0.0160 8.0000 0.0000 +++++ 998.155395 m 8.0000 1225 | 8/11
57 h-m-p 0.0080 4.0009 0.2157 --------Y 998.155395 0 0.0000 1250 | 8/11
58 h-m-p 0.0160 8.0000 0.0001 +++++ 998.155395 m 8.0000 1270 | 8/11
59 h-m-p 0.0081 4.0571 0.2216 -----------N 998.155395 0 0.0000 1298 | 8/11
60 h-m-p 0.0160 8.0000 0.0000 ---Y 998.155395 0 0.0001 1318 | 8/11
61 h-m-p 0.0160 8.0000 0.0000 +++++ 998.155395 m 8.0000 1338 | 8/11
62 h-m-p 0.0083 4.1368 0.1931 ----------Y 998.155395 0 0.0000 1365 | 8/11
63 h-m-p 0.0160 8.0000 0.0000 ----Y 998.155395 0 0.0000 1386 | 8/11
64 h-m-p 0.0160 8.0000 0.0000 +++++ 998.155395 m 8.0000 1406 | 8/11
65 h-m-p 0.0078 3.9174 0.2109 ---------Y 998.155395 0 0.0000 1432 | 8/11
66 h-m-p 0.0160 8.0000 0.0001 ----C 998.155395 0 0.0000 1453 | 8/11
67 h-m-p 0.0160 8.0000 0.0258 +++++ 998.155362 m 8.0000 1473 | 8/11
68 h-m-p 0.7611 3.8278 0.2716 -------------C 998.155362 0 0.0000 1503 | 8/11
69 h-m-p 0.0105 5.2604 0.0069 +++++ 998.155347 m 5.2604 1523 | 9/11
70 h-m-p 1.6000 8.0000 0.0000 ++ 998.155347 m 8.0000 1540 | 9/11
71 h-m-p 0.6317 8.0000 0.0002 ++ 998.155347 m 8.0000 1556 | 9/11
72 h-m-p 0.2693 8.0000 0.0048 ---Y 998.155347 0 0.0011 1575 | 9/11
73 h-m-p 1.6000 8.0000 0.0000 C 998.155347 0 0.4000 1591 | 9/11
74 h-m-p 1.2733 8.0000 0.0000 --------------Y 998.155347 0 0.0000 1621
Out..
lnL = -998.155347
1622 lfun, 19464 eigenQcodon, 107052 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -998.227813 S = -998.156482 -0.031794
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:35
did 20 / 55 patterns 0:36
did 30 / 55 patterns 0:36
did 40 / 55 patterns 0:36
did 50 / 55 patterns 0:36
did 55 / 55 patterns 0:36
Time used: 0:36
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=254
NC_011896_1_WP_010908382_1_1600_thyX VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NC_002677_1_NP_302061_1_933_thyX VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NZ_LVXE01000041_1_WP_010908382_1_1826_thyX VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NZ_LYPH01000047_1_WP_010908382_1_1845_thyX VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NZ_CP029543_1_WP_010908382_1_1630_DIJ64_RS08300 VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
NZ_AP014567_1_WP_010908382_1_1670_JK2ML_RS08500 VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP
**************************************************
NC_011896_1_WP_010908382_1_1600_thyX NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
NC_002677_1_NP_302061_1_933_thyX NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
NZ_LVXE01000041_1_WP_010908382_1_1826_thyX NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
NZ_LYPH01000047_1_WP_010908382_1_1845_thyX NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
NZ_CP029543_1_WP_010908382_1_1630_DIJ64_RS08300 NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
NZ_AP014567_1_WP_010908382_1_1670_JK2ML_RS08500 NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS
**************************************************
NC_011896_1_WP_010908382_1_1600_thyX YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NC_002677_1_NP_302061_1_933_thyX YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NZ_LVXE01000041_1_WP_010908382_1_1826_thyX YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NZ_LYPH01000047_1_WP_010908382_1_1845_thyX YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NZ_CP029543_1_WP_010908382_1_1630_DIJ64_RS08300 YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
NZ_AP014567_1_WP_010908382_1_1670_JK2ML_RS08500 YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL
**************************************************
NC_011896_1_WP_010908382_1_1600_thyX NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
NC_002677_1_NP_302061_1_933_thyX NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
NZ_LVXE01000041_1_WP_010908382_1_1826_thyX NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
NZ_LYPH01000047_1_WP_010908382_1_1845_thyX NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
NZ_CP029543_1_WP_010908382_1_1630_DIJ64_RS08300 NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
NZ_AP014567_1_WP_010908382_1_1670_JK2ML_RS08500 NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI
**************************************************
NC_011896_1_WP_010908382_1_1600_thyX AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
NC_002677_1_NP_302061_1_933_thyX AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
NZ_LVXE01000041_1_WP_010908382_1_1826_thyX AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
NZ_LYPH01000047_1_WP_010908382_1_1845_thyX AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
NZ_CP029543_1_WP_010908382_1_1630_DIJ64_RS08300 AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
NZ_AP014567_1_WP_010908382_1_1670_JK2ML_RS08500 AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL
**************************************************
NC_011896_1_WP_010908382_1_1600_thyX ATEA
NC_002677_1_NP_302061_1_933_thyX ATEA
NZ_LVXE01000041_1_WP_010908382_1_1826_thyX ATEA
NZ_LYPH01000047_1_WP_010908382_1_1845_thyX ATEA
NZ_CP029543_1_WP_010908382_1_1630_DIJ64_RS08300 ATEA
NZ_AP014567_1_WP_010908382_1_1670_JK2ML_RS08500 ATEA
****
>NC_011896_1_WP_010908382_1_1600_thyX GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA GCCACCGAAGCT >NC_002677_1_NP_302061_1_933_thyX GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA GCCACCGAAGCT >NZ_LVXE01000041_1_WP_010908382_1_1826_thyX GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA GCCACCGAAGCT >NZ_LYPH01000047_1_WP_010908382_1_1845_thyX GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA GCCACCGAAGCT >NZ_CP029543_1_WP_010908382_1_1630_DIJ64_RS08300 GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA GCCACCGAAGCT >NZ_AP014567_1_WP_010908382_1_1670_JK2ML_RS08500 GTGGCCCAGATCGCGCCGCTACGCGTGCAACTAATTGCCAAGACTGAGTT TCTGGCGCCTCCTGACGTGTCGTGGACTACCGACGCCGACGGTGGTTCCG CGCTGGTCGAATTCGCCGGTCGCGCCTGTTATCAGAGCTGGTCGAAGCCC AATCCCCGGACCGCGACCAACGCCGCGTACATTAAACACATCATTGACGT CGGGCATGTTGCGGTGCTCGAGCATGCCAGCGTTTCGTTCTATATCAGCG GCATCTCGCGATCATGCACTCACGAGCTGATCCGACATCGGCATTTCTCC TACTCTCAGCTGTCGCAGCGCTACGTGCCGGAAAAGGATGCCCAGGTCGT TGTGCCACCGGACATGGAGGATGACGACGAACTTCAACAGATTCTGATTG CGGCCGTAGAGGCCAGCCGGGCCACCTACACTGAACTGCTGGTCAAGCTG AACGCCAAGTTAATGGCCGGTGAGCTCGGCGGGAATAGGGCGGTGTTGCG GCGCAAGCAAGCTCGCCAAGCTGCCCACGCGGTGCTGCCCAACGCCAACG AGACCCGGATCGTTGTGACCGGGAACTACCGGGCATGGCGGCACTTCATC GCCATGCGGGCCAGCGAGCACGCCGACGTCGAAATCCGGCGGCTGGCCAT TGTCTGCCTGCGCCGGCTCGTCGACGTTGCGCCCGCAGTATTCGCTGATT TCGAGATCACCGCACTTGCTGATGGTACTGAGGTCGCAACTAGTCCTTTA GCCACCGAAGCT
>NC_011896_1_WP_010908382_1_1600_thyX VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL ATEA >NC_002677_1_NP_302061_1_933_thyX VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL ATEA >NZ_LVXE01000041_1_WP_010908382_1_1826_thyX VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL ATEA >NZ_LYPH01000047_1_WP_010908382_1_1845_thyX VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL ATEA >NZ_CP029543_1_WP_010908382_1_1630_DIJ64_RS08300 VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL ATEA >NZ_AP014567_1_WP_010908382_1_1670_JK2ML_RS08500 VAQIAPLRVQLIAKTEFLAPPDVSWTTDADGGSALVEFAGRACYQSWSKP NPRTATNAAYIKHIIDVGHVAVLEHASVSFYISGISRSCTHELIRHRHFS YSQLSQRYVPEKDAQVVVPPDMEDDDELQQILIAAVEASRATYTELLVKL NAKLMAGELGGNRAVLRRKQARQAAHAVLPNANETRIVVTGNYRAWRHFI AMRASEHADVEIRRLAIVCLRRLVDVAPAVFADFEITALADGTEVATSPL ATEA
#NEXUS
[ID: 0894829762]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908382_1_1600_thyX
NC_002677_1_NP_302061_1_933_thyX
NZ_LVXE01000041_1_WP_010908382_1_1826_thyX
NZ_LYPH01000047_1_WP_010908382_1_1845_thyX
NZ_CP029543_1_WP_010908382_1_1630_DIJ64_RS08300
NZ_AP014567_1_WP_010908382_1_1670_JK2ML_RS08500
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908382_1_1600_thyX,
2 NC_002677_1_NP_302061_1_933_thyX,
3 NZ_LVXE01000041_1_WP_010908382_1_1826_thyX,
4 NZ_LYPH01000047_1_WP_010908382_1_1845_thyX,
5 NZ_CP029543_1_WP_010908382_1_1630_DIJ64_RS08300,
6 NZ_AP014567_1_WP_010908382_1_1670_JK2ML_RS08500
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07505439,2:0.07068961,3:0.06859533,4:0.06960674,5:0.06793579,6:0.07080755);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07505439,2:0.07068961,3:0.06859533,4:0.06960674,5:0.06793579,6:0.07080755);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1039.27 -1042.91
2 -1039.24 -1042.46
--------------------------------------
TOTAL -1039.25 -1042.71
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/thyX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.906651 0.089087 0.367455 1.488333 0.872747 1247.01 1374.00 1.000
r(A<->C){all} 0.170110 0.020446 0.000062 0.459721 0.135533 132.44 238.38 1.004
r(A<->G){all} 0.162623 0.018790 0.000039 0.450589 0.124494 187.40 209.16 1.006
r(A<->T){all} 0.155769 0.017596 0.000074 0.423604 0.120149 199.74 260.12 1.000
r(C<->G){all} 0.170961 0.020309 0.000065 0.447991 0.131734 219.66 242.99 1.000
r(C<->T){all} 0.173705 0.020863 0.000058 0.462985 0.135792 229.23 250.35 1.003
r(G<->T){all} 0.166832 0.020063 0.000009 0.448450 0.133013 256.66 310.75 1.008
pi(A){all} 0.193255 0.000208 0.163342 0.219337 0.193171 1139.31 1320.15 1.000
pi(C){all} 0.313257 0.000281 0.280713 0.346086 0.313298 985.73 1050.07 1.001
pi(G){all} 0.296136 0.000264 0.265751 0.329009 0.296122 1182.87 1200.98 1.000
pi(T){all} 0.197351 0.000216 0.169294 0.226298 0.196975 1169.89 1189.96 1.000
alpha{1,2} 0.420732 0.225922 0.000145 1.383276 0.249502 985.17 1152.80 1.000
alpha{3} 0.461734 0.239803 0.000198 1.412645 0.299766 861.62 932.52 1.000
pinvar{all} 0.997946 0.000006 0.993457 1.000000 0.998715 1333.52 1353.45 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/12res/thyX/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 254
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 1 1 1 1 1 1
TTC 6 6 6 6 6 6 | TCC 2 2 2 2 2 2 | TAC 5 5 5 5 5 5 | TGC 2 2 2 2 2 2
Leu TTA 2 2 2 2 2 2 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 3 3 3 3 3 3 | His CAT 4 4 4 4 4 4 | Arg CGT 0 0 0 0 0 0
CTC 3 3 3 3 3 3 | CCC 4 4 4 4 4 4 | CAC 5 5 5 5 5 5 | CGC 6 6 6 6 6 6
CTA 2 2 2 2 2 2 | CCA 1 1 1 1 1 1 | Gln CAA 4 4 4 4 4 4 | CGA 2 2 2 2 2 2
CTG 11 11 11 11 11 11 | CCG 3 3 3 3 3 3 | CAG 6 6 6 6 6 6 | CGG 11 11 11 11 11 11
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 6 6 6 6 6 6 | Thr ACT 6 6 6 6 6 6 | Asn AAT 2 2 2 2 2 2 | Ser AGT 1 1 1 1 1 1
ATC 9 9 9 9 9 9 | ACC 8 8 8 8 8 8 | AAC 5 5 5 5 5 5 | AGC 5 5 5 5 5 5
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 0 0 0 0 0 0 | AAG 6 6 6 6 6 6 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 5 5 5 | Ala GCT 5 5 5 5 5 5 | Asp GAT 4 4 4 4 4 4 | Gly GGT 5 5 5 5 5 5
GTC 8 8 8 8 8 8 | GCC 20 20 20 20 20 20 | GAC 9 9 9 9 9 9 | GGC 2 2 2 2 2 2
GTA 2 2 2 2 2 2 | GCA 4 4 4 4 4 4 | Glu GAA 6 6 6 6 6 6 | GGA 0 0 0 0 0 0
GTG 9 9 9 9 9 9 | GCG 10 10 10 10 10 10 | GAG 10 10 10 10 10 10 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908382_1_1600_thyX
position 1: T:0.12598 C:0.26378 A:0.20866 G:0.40157
position 2: T:0.27559 C:0.28740 A:0.27165 G:0.16535
position 3: T:0.18898 C:0.38976 A:0.09843 G:0.32283
Average T:0.19685 C:0.31365 A:0.19291 G:0.29659
#2: NC_002677_1_NP_302061_1_933_thyX
position 1: T:0.12598 C:0.26378 A:0.20866 G:0.40157
position 2: T:0.27559 C:0.28740 A:0.27165 G:0.16535
position 3: T:0.18898 C:0.38976 A:0.09843 G:0.32283
Average T:0.19685 C:0.31365 A:0.19291 G:0.29659
#3: NZ_LVXE01000041_1_WP_010908382_1_1826_thyX
position 1: T:0.12598 C:0.26378 A:0.20866 G:0.40157
position 2: T:0.27559 C:0.28740 A:0.27165 G:0.16535
position 3: T:0.18898 C:0.38976 A:0.09843 G:0.32283
Average T:0.19685 C:0.31365 A:0.19291 G:0.29659
#4: NZ_LYPH01000047_1_WP_010908382_1_1845_thyX
position 1: T:0.12598 C:0.26378 A:0.20866 G:0.40157
position 2: T:0.27559 C:0.28740 A:0.27165 G:0.16535
position 3: T:0.18898 C:0.38976 A:0.09843 G:0.32283
Average T:0.19685 C:0.31365 A:0.19291 G:0.29659
#5: NZ_CP029543_1_WP_010908382_1_1630_DIJ64_RS08300
position 1: T:0.12598 C:0.26378 A:0.20866 G:0.40157
position 2: T:0.27559 C:0.28740 A:0.27165 G:0.16535
position 3: T:0.18898 C:0.38976 A:0.09843 G:0.32283
Average T:0.19685 C:0.31365 A:0.19291 G:0.29659
#6: NZ_AP014567_1_WP_010908382_1_1670_JK2ML_RS08500
position 1: T:0.12598 C:0.26378 A:0.20866 G:0.40157
position 2: T:0.27559 C:0.28740 A:0.27165 G:0.16535
position 3: T:0.18898 C:0.38976 A:0.09843 G:0.32283
Average T:0.19685 C:0.31365 A:0.19291 G:0.29659
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 12 | Cys C TGT 6
TTC 36 | TCC 12 | TAC 30 | TGC 12
Leu L TTA 12 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 30 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 18 | His H CAT 24 | Arg R CGT 0
CTC 18 | CCC 24 | CAC 30 | CGC 36
CTA 12 | CCA 6 | Gln Q CAA 24 | CGA 12
CTG 66 | CCG 18 | CAG 36 | CGG 66
------------------------------------------------------------------------------
Ile I ATT 36 | Thr T ACT 36 | Asn N AAT 12 | Ser S AGT 6
ATC 54 | ACC 48 | AAC 30 | AGC 30
ATA 0 | ACA 0 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 18 | ACG 0 | AAG 36 | AGG 6
------------------------------------------------------------------------------
Val V GTT 30 | Ala A GCT 30 | Asp D GAT 24 | Gly G GGT 30
GTC 48 | GCC 120 | GAC 54 | GGC 12
GTA 12 | GCA 24 | Glu E GAA 36 | GGA 0
GTG 54 | GCG 60 | GAG 60 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12598 C:0.26378 A:0.20866 G:0.40157
position 2: T:0.27559 C:0.28740 A:0.27165 G:0.16535
position 3: T:0.18898 C:0.38976 A:0.09843 G:0.32283
Average T:0.19685 C:0.31365 A:0.19291 G:0.29659
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -998.155418 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300283 1.298255
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908382_1_1600_thyX: 0.000004, NC_002677_1_NP_302061_1_933_thyX: 0.000004, NZ_LVXE01000041_1_WP_010908382_1_1826_thyX: 0.000004, NZ_LYPH01000047_1_WP_010908382_1_1845_thyX: 0.000004, NZ_CP029543_1_WP_010908382_1_1630_DIJ64_RS08300: 0.000004, NZ_AP014567_1_WP_010908382_1_1670_JK2ML_RS08500: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30028
omega (dN/dS) = 1.29826
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 594.1 167.9 1.2983 0.0000 0.0000 0.0 0.0
7..2 0.000 594.1 167.9 1.2983 0.0000 0.0000 0.0 0.0
7..3 0.000 594.1 167.9 1.2983 0.0000 0.0000 0.0 0.0
7..4 0.000 594.1 167.9 1.2983 0.0000 0.0000 0.0 0.0
7..5 0.000 594.1 167.9 1.2983 0.0000 0.0000 0.0 0.0
7..6 0.000 594.1 167.9 1.2983 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -998.155347 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908382_1_1600_thyX: 0.000004, NC_002677_1_NP_302061_1_933_thyX: 0.000004, NZ_LVXE01000041_1_WP_010908382_1_1826_thyX: 0.000004, NZ_LYPH01000047_1_WP_010908382_1_1845_thyX: 0.000004, NZ_CP029543_1_WP_010908382_1_1630_DIJ64_RS08300: 0.000004, NZ_AP014567_1_WP_010908382_1_1670_JK2ML_RS08500: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 602.1 159.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 602.1 159.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 602.1 159.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 602.1 159.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 602.1 159.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 602.1 159.9 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:04
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -998.155347 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908382_1_1600_thyX: 0.000004, NC_002677_1_NP_302061_1_933_thyX: 0.000004, NZ_LVXE01000041_1_WP_010908382_1_1826_thyX: 0.000004, NZ_LYPH01000047_1_WP_010908382_1_1845_thyX: 0.000004, NZ_CP029543_1_WP_010908382_1_1630_DIJ64_RS08300: 0.000004, NZ_AP014567_1_WP_010908382_1_1670_JK2ML_RS08500: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 602.1 159.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 602.1 159.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 602.1 159.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 602.1 159.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 602.1 159.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 602.1 159.9 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908382_1_1600_thyX)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.103 0.103 0.102 0.101 0.100 0.100 0.099 0.098 0.097 0.097
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:07
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -998.155347 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.251614
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908382_1_1600_thyX: 0.000004, NC_002677_1_NP_302061_1_933_thyX: 0.000004, NZ_LVXE01000041_1_WP_010908382_1_1826_thyX: 0.000004, NZ_LYPH01000047_1_WP_010908382_1_1845_thyX: 0.000004, NZ_CP029543_1_WP_010908382_1_1630_DIJ64_RS08300: 0.000004, NZ_AP014567_1_WP_010908382_1_1670_JK2ML_RS08500: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.25161
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 602.1 159.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 602.1 159.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 602.1 159.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 602.1 159.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 602.1 159.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 602.1 159.9 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -998.155347 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.564895 1.822205
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908382_1_1600_thyX: 0.000004, NC_002677_1_NP_302061_1_933_thyX: 0.000004, NZ_LVXE01000041_1_WP_010908382_1_1826_thyX: 0.000004, NZ_LYPH01000047_1_WP_010908382_1_1845_thyX: 0.000004, NZ_CP029543_1_WP_010908382_1_1630_DIJ64_RS08300: 0.000004, NZ_AP014567_1_WP_010908382_1_1670_JK2ML_RS08500: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.56490
(p1 = 0.00001) w = 1.82221
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.82221
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 602.1 159.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 602.1 159.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 602.1 159.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 602.1 159.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 602.1 159.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 602.1 159.9 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908382_1_1600_thyX)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.095 0.096 0.097 0.098 0.099 0.101 0.102 0.103 0.104 0.106
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.105 0.104 0.103 0.102 0.100 0.099 0.098 0.097 0.096 0.095
Time used: 0:36
Model 1: NearlyNeutral -998.155347 Model 2: PositiveSelection -998.155347 Model 0: one-ratio -998.155418 Model 7: beta -998.155347 Model 8: beta&w>1 -998.155347 Model 0 vs 1 1.4200000009623182E-4 Model 2 vs 1 0.0 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
