--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:36:03 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/tig/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/12res/tig/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/tig/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/12res/tig/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1934.86         -1938.62
2      -1934.92         -1938.79
--------------------------------------
TOTAL    -1934.89         -1938.71
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/12res/tig/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/tig/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/tig/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.879875    0.087805    0.316196    1.453921    0.846824   1435.11   1443.02    1.000
r(A<->C){all}   0.168052    0.019062    0.000120    0.440855    0.133182    232.97    264.07    1.000
r(A<->G){all}   0.217435    0.026064    0.000055    0.525322    0.186216    195.67    223.38    1.002
r(A<->T){all}   0.164675    0.019675    0.000062    0.446966    0.126570    165.78    195.57    1.000
r(C<->G){all}   0.153873    0.018391    0.000124    0.429593    0.115223    234.59    255.30    1.000
r(C<->T){all}   0.156975    0.018314    0.000004    0.421544    0.121852    192.68    210.35    1.000
r(G<->T){all}   0.138991    0.015947    0.000039    0.401500    0.101145    333.93    377.66    1.006
pi(A){all}      0.217129    0.000119    0.195681    0.238073    0.216867   1029.31   1220.99    1.000
pi(C){all}      0.261074    0.000134    0.238929    0.284565    0.260918   1289.95   1311.30    1.000
pi(G){all}      0.330236    0.000156    0.306737    0.354439    0.330014   1486.40   1493.70    1.000
pi(T){all}      0.191561    0.000111    0.172010    0.213053    0.191669   1017.09   1114.90    1.000
alpha{1,2}      0.330237    0.162656    0.000555    1.149652    0.192758   1257.62   1379.31    1.000
alpha{3}        0.430599    0.245225    0.000115    1.399796    0.250672   1121.50   1190.88    1.001
pinvar{all}     0.997728    0.000004    0.994111    0.999943    0.998203   1396.00   1448.50    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1832.279179
Model 2: PositiveSelection	-1831.803068
Model 0: one-ratio	-1831.853801
Model 7: beta	-1832.279095
Model 8: beta&w>1	-1831.803019


Model 0 vs 1	0.8507560000002741

Model 2 vs 1	0.9522220000003472

Model 8 vs 7	0.9521520000002965
>C1
VKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVP
ARLLEARFGRETLLDQVVNEAMPSRYGQALAESEVQPIGQPEIEVIRKEY
GQDLAFTVEVEVRPKIALPDFSTLKVVVDPVEVSTDDVEAELRSLRARFG
TLIGVDRPVALGDFVSIDLSATINGEKVPNADAEGLSHEVGYGRLIAGLD
DALVGLSAGESRVFTTQLATSKHAGQDAEVIVTVKSVKERELPEPDDEFA
QLVSEFDTMAELRANLGDQVRKAKYAQQAEKIRDAAVDALLERVDVPLPE
GIVQAQFNNALHDALSGLGHDEAKFAEVLAERGSSREEFEAEARSAAERD
VTRQLLLDVVADDQKIQVGQDDLNERLLATSQQYGVDAQQLFGFLRENNR
LSSLVTDARRRLAVAAVVEAATFTDSDGNTIDTSEFFGKHAQSDKADQKT
EEADPNSDAIDEEVDEAAE
>C2
VKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVP
ARLLEARFGRETLLDQVVNEAMPSRYGQALAESEVQPIGQPEIEVIRKEY
GQDLAFTVEVEVRPKIALPDFSTLKVVVDPVEVSTDDVEAELRSLRARFG
TLIGVDRPVALGDFVSIDLSATINGEKVPNADAEGLSHEVGYGRLIAGLD
DALVGLSAGESRVFTTQLATSKHAGQDAEVIVTVKSVKERELPEPDDEFA
QLVSEFDTMAELRANLGDQVRKAKYAQQAEKIRDAAVDALLERVDVPLPE
GIVQAQFNNALHDALSGLGHDEAKFAEVLAERGSSREEFEAEARSAAERD
VTRQLLLDVVADDQKIQVGQDDLNERLLATSQQYGVDAQQLFGFLRENNR
LSSLVTDARRRLAVAAVVEAATFTDSDGNTIDTSEFFGKHAQSDKADQKT
EEADPNSDAIDEEVDEAAE
>C3
VKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVP
ARLLEARFGRETLLDQVVNEAMPSRYGQALAESEVQPIGQPEIEVIRKEY
GQDLAFTVEVEVRPKIALPDFSTLKVVVDPVEVSTDDVEAELRSLRARFG
TLIGVDRPVALGDFVSIDLSATINGEKVPNADAEGLSHEVGYGRLIAGLD
DALVGLSAGESRVFTTQLATSKHAGQDAEVIVTVKSVKERELPEPDDEFA
QLVSEFDTMAELRANLGDQVRKAKYAQQAEKIRDAAVDALLERVDVPLPE
GIVQAQFNNALHDALSGLGHDEAKFAEVLAERGSSREEFEAEARSAAERD
VTRQLLLDVVADDQKIQVGQDDLNERLLATSQQYGVDAQQLFGFLRENNR
LSSLVTDARRRLAVAAVVEAATFTDSDGNTIDTSEFFGKHAQSDKADQKT
EEADPNSDAIDEEVDEAAE
>C4
VKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVP
ARLLEARFGRETLLDQVVNEAMPSRYGQALAESEVQPIGQPEIEVIRKEY
GQDLAFTVEVEVRPKIALPDFSTLKVVVDPVEVSTDDVEAELRSLRARFG
TLIGVDRPVALGDFVSIDLSATINGEKVPNADAEGLSHEVGYGRLIAGLD
DALVGLSAGESRVFTTQLATSKHAGQDAEVIVTVKSVKERELPEPDDEFA
QLVSEFDTMAELRANLGDQVRKAKYAQQAEKIRDAAVDALLERVDVPLPE
GIVQAQFNNALHDALSGLGHDEAKFAEVLAERGSSREEFEAEARSAAERD
VTRQLLLDVVADDQKIQVGQDDLNERLLATSQQYGVDAQQLFGFLRENNR
LSSLVTDARRRLAVAAVVEAATFTDSDGNTIDTSEFFGKHAQSDKADQKT
EEADPNSDAIDEEVDEAAE
>C5
VKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVP
ARLLEARFGRETLLDQVVNEAMPSRYGQALAESEVQPIGQPEIEVIRKEY
GQDLAFTVEVEVRPKIALPDFSTLKVVVDPVEVSTDDVEAELRSLRARFG
TLIGVDRPVALGDFVSIDLSATINGEKVPNADAEGLSHEVGYGRLIAGLD
DALVGLSAGESRVFTTQLATSKHAGQDAEVIVTVKSVKERELPEPDDEFA
QLVSEFDTMAELRANLGDQVRKAKYAQQAEKIRDAAVDALLERVDVPLPE
GIVQAQFNNALHDALSGLGHDEAKFAEVLAERGSSREEFEAEARSAAERD
VTRQLLLDVVADDQKIQVGQDDLNERLLATSQQYGVDAQQLFGFLRENNR
LSSLVTDARRRLAVAAVVEAATFTDSDGNTIDTSEFFGKHAQSDKADQKT
EEADPNSDAIDEEVDEAAE
>C6
VKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVP
ARLLEARFGRETLLDQVVNEAMPSRYGQALAESEVQPIGQPEIEVIRKEY
GQDLAFTVEVEVRPKIALPDFSTLKVVVDPVEVSTDDVEAELRSLRARFG
TLIGVDRPVALGDFVSIDLSATINGEKVPNADAEGLSHEVGYGRLIAGLD
DALVGLSAGESRVFTTQLATSKHAGQDAEVIVTVKSVKERELPEPDDEFA
QLVSEFDTMAELRANLGDQVRKAKYAQQAEKIRDAAVDALLERVDVPLPE
GIVQAQFNNALHDALSGLGHDEAKFAEVLAERGSSREEFEAEARSAAERD
VTRQLLLDVVADDQKIQVGQDDLNKRLLATSQQYGVDAQQLFGFLRENNR
LSSLVTDARRRLAVAAVVEAATFTDSDGNTIDTSEFFGKHAQSDKADQKT
EEADPNSDAIDEEVDEAAE
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=469 

C1              VKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVP
C2              VKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVP
C3              VKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVP
C4              VKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVP
C5              VKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVP
C6              VKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVP
                **************************************************

C1              ARLLEARFGRETLLDQVVNEAMPSRYGQALAESEVQPIGQPEIEVIRKEY
C2              ARLLEARFGRETLLDQVVNEAMPSRYGQALAESEVQPIGQPEIEVIRKEY
C3              ARLLEARFGRETLLDQVVNEAMPSRYGQALAESEVQPIGQPEIEVIRKEY
C4              ARLLEARFGRETLLDQVVNEAMPSRYGQALAESEVQPIGQPEIEVIRKEY
C5              ARLLEARFGRETLLDQVVNEAMPSRYGQALAESEVQPIGQPEIEVIRKEY
C6              ARLLEARFGRETLLDQVVNEAMPSRYGQALAESEVQPIGQPEIEVIRKEY
                **************************************************

C1              GQDLAFTVEVEVRPKIALPDFSTLKVVVDPVEVSTDDVEAELRSLRARFG
C2              GQDLAFTVEVEVRPKIALPDFSTLKVVVDPVEVSTDDVEAELRSLRARFG
C3              GQDLAFTVEVEVRPKIALPDFSTLKVVVDPVEVSTDDVEAELRSLRARFG
C4              GQDLAFTVEVEVRPKIALPDFSTLKVVVDPVEVSTDDVEAELRSLRARFG
C5              GQDLAFTVEVEVRPKIALPDFSTLKVVVDPVEVSTDDVEAELRSLRARFG
C6              GQDLAFTVEVEVRPKIALPDFSTLKVVVDPVEVSTDDVEAELRSLRARFG
                **************************************************

C1              TLIGVDRPVALGDFVSIDLSATINGEKVPNADAEGLSHEVGYGRLIAGLD
C2              TLIGVDRPVALGDFVSIDLSATINGEKVPNADAEGLSHEVGYGRLIAGLD
C3              TLIGVDRPVALGDFVSIDLSATINGEKVPNADAEGLSHEVGYGRLIAGLD
C4              TLIGVDRPVALGDFVSIDLSATINGEKVPNADAEGLSHEVGYGRLIAGLD
C5              TLIGVDRPVALGDFVSIDLSATINGEKVPNADAEGLSHEVGYGRLIAGLD
C6              TLIGVDRPVALGDFVSIDLSATINGEKVPNADAEGLSHEVGYGRLIAGLD
                **************************************************

C1              DALVGLSAGESRVFTTQLATSKHAGQDAEVIVTVKSVKERELPEPDDEFA
C2              DALVGLSAGESRVFTTQLATSKHAGQDAEVIVTVKSVKERELPEPDDEFA
C3              DALVGLSAGESRVFTTQLATSKHAGQDAEVIVTVKSVKERELPEPDDEFA
C4              DALVGLSAGESRVFTTQLATSKHAGQDAEVIVTVKSVKERELPEPDDEFA
C5              DALVGLSAGESRVFTTQLATSKHAGQDAEVIVTVKSVKERELPEPDDEFA
C6              DALVGLSAGESRVFTTQLATSKHAGQDAEVIVTVKSVKERELPEPDDEFA
                **************************************************

C1              QLVSEFDTMAELRANLGDQVRKAKYAQQAEKIRDAAVDALLERVDVPLPE
C2              QLVSEFDTMAELRANLGDQVRKAKYAQQAEKIRDAAVDALLERVDVPLPE
C3              QLVSEFDTMAELRANLGDQVRKAKYAQQAEKIRDAAVDALLERVDVPLPE
C4              QLVSEFDTMAELRANLGDQVRKAKYAQQAEKIRDAAVDALLERVDVPLPE
C5              QLVSEFDTMAELRANLGDQVRKAKYAQQAEKIRDAAVDALLERVDVPLPE
C6              QLVSEFDTMAELRANLGDQVRKAKYAQQAEKIRDAAVDALLERVDVPLPE
                **************************************************

C1              GIVQAQFNNALHDALSGLGHDEAKFAEVLAERGSSREEFEAEARSAAERD
C2              GIVQAQFNNALHDALSGLGHDEAKFAEVLAERGSSREEFEAEARSAAERD
C3              GIVQAQFNNALHDALSGLGHDEAKFAEVLAERGSSREEFEAEARSAAERD
C4              GIVQAQFNNALHDALSGLGHDEAKFAEVLAERGSSREEFEAEARSAAERD
C5              GIVQAQFNNALHDALSGLGHDEAKFAEVLAERGSSREEFEAEARSAAERD
C6              GIVQAQFNNALHDALSGLGHDEAKFAEVLAERGSSREEFEAEARSAAERD
                **************************************************

C1              VTRQLLLDVVADDQKIQVGQDDLNERLLATSQQYGVDAQQLFGFLRENNR
C2              VTRQLLLDVVADDQKIQVGQDDLNERLLATSQQYGVDAQQLFGFLRENNR
C3              VTRQLLLDVVADDQKIQVGQDDLNERLLATSQQYGVDAQQLFGFLRENNR
C4              VTRQLLLDVVADDQKIQVGQDDLNERLLATSQQYGVDAQQLFGFLRENNR
C5              VTRQLLLDVVADDQKIQVGQDDLNERLLATSQQYGVDAQQLFGFLRENNR
C6              VTRQLLLDVVADDQKIQVGQDDLNKRLLATSQQYGVDAQQLFGFLRENNR
                ************************:*************************

C1              LSSLVTDARRRLAVAAVVEAATFTDSDGNTIDTSEFFGKHAQSDKADQKT
C2              LSSLVTDARRRLAVAAVVEAATFTDSDGNTIDTSEFFGKHAQSDKADQKT
C3              LSSLVTDARRRLAVAAVVEAATFTDSDGNTIDTSEFFGKHAQSDKADQKT
C4              LSSLVTDARRRLAVAAVVEAATFTDSDGNTIDTSEFFGKHAQSDKADQKT
C5              LSSLVTDARRRLAVAAVVEAATFTDSDGNTIDTSEFFGKHAQSDKADQKT
C6              LSSLVTDARRRLAVAAVVEAATFTDSDGNTIDTSEFFGKHAQSDKADQKT
                **************************************************

C1              EEADPNSDAIDEEVDEAAE
C2              EEADPNSDAIDEEVDEAAE
C3              EEADPNSDAIDEEVDEAAE
C4              EEADPNSDAIDEEVDEAAE
C5              EEADPNSDAIDEEVDEAAE
C6              EEADPNSDAIDEEVDEAAE
                *******************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  469 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  469 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14070]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [14070]--->[14070]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.541 Mb, Max= 31.052 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVP
C2              VKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVP
C3              VKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVP
C4              VKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVP
C5              VKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVP
C6              VKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVP
                **************************************************

C1              ARLLEARFGRETLLDQVVNEAMPSRYGQALAESEVQPIGQPEIEVIRKEY
C2              ARLLEARFGRETLLDQVVNEAMPSRYGQALAESEVQPIGQPEIEVIRKEY
C3              ARLLEARFGRETLLDQVVNEAMPSRYGQALAESEVQPIGQPEIEVIRKEY
C4              ARLLEARFGRETLLDQVVNEAMPSRYGQALAESEVQPIGQPEIEVIRKEY
C5              ARLLEARFGRETLLDQVVNEAMPSRYGQALAESEVQPIGQPEIEVIRKEY
C6              ARLLEARFGRETLLDQVVNEAMPSRYGQALAESEVQPIGQPEIEVIRKEY
                **************************************************

C1              GQDLAFTVEVEVRPKIALPDFSTLKVVVDPVEVSTDDVEAELRSLRARFG
C2              GQDLAFTVEVEVRPKIALPDFSTLKVVVDPVEVSTDDVEAELRSLRARFG
C3              GQDLAFTVEVEVRPKIALPDFSTLKVVVDPVEVSTDDVEAELRSLRARFG
C4              GQDLAFTVEVEVRPKIALPDFSTLKVVVDPVEVSTDDVEAELRSLRARFG
C5              GQDLAFTVEVEVRPKIALPDFSTLKVVVDPVEVSTDDVEAELRSLRARFG
C6              GQDLAFTVEVEVRPKIALPDFSTLKVVVDPVEVSTDDVEAELRSLRARFG
                **************************************************

C1              TLIGVDRPVALGDFVSIDLSATINGEKVPNADAEGLSHEVGYGRLIAGLD
C2              TLIGVDRPVALGDFVSIDLSATINGEKVPNADAEGLSHEVGYGRLIAGLD
C3              TLIGVDRPVALGDFVSIDLSATINGEKVPNADAEGLSHEVGYGRLIAGLD
C4              TLIGVDRPVALGDFVSIDLSATINGEKVPNADAEGLSHEVGYGRLIAGLD
C5              TLIGVDRPVALGDFVSIDLSATINGEKVPNADAEGLSHEVGYGRLIAGLD
C6              TLIGVDRPVALGDFVSIDLSATINGEKVPNADAEGLSHEVGYGRLIAGLD
                **************************************************

C1              DALVGLSAGESRVFTTQLATSKHAGQDAEVIVTVKSVKERELPEPDDEFA
C2              DALVGLSAGESRVFTTQLATSKHAGQDAEVIVTVKSVKERELPEPDDEFA
C3              DALVGLSAGESRVFTTQLATSKHAGQDAEVIVTVKSVKERELPEPDDEFA
C4              DALVGLSAGESRVFTTQLATSKHAGQDAEVIVTVKSVKERELPEPDDEFA
C5              DALVGLSAGESRVFTTQLATSKHAGQDAEVIVTVKSVKERELPEPDDEFA
C6              DALVGLSAGESRVFTTQLATSKHAGQDAEVIVTVKSVKERELPEPDDEFA
                **************************************************

C1              QLVSEFDTMAELRANLGDQVRKAKYAQQAEKIRDAAVDALLERVDVPLPE
C2              QLVSEFDTMAELRANLGDQVRKAKYAQQAEKIRDAAVDALLERVDVPLPE
C3              QLVSEFDTMAELRANLGDQVRKAKYAQQAEKIRDAAVDALLERVDVPLPE
C4              QLVSEFDTMAELRANLGDQVRKAKYAQQAEKIRDAAVDALLERVDVPLPE
C5              QLVSEFDTMAELRANLGDQVRKAKYAQQAEKIRDAAVDALLERVDVPLPE
C6              QLVSEFDTMAELRANLGDQVRKAKYAQQAEKIRDAAVDALLERVDVPLPE
                **************************************************

C1              GIVQAQFNNALHDALSGLGHDEAKFAEVLAERGSSREEFEAEARSAAERD
C2              GIVQAQFNNALHDALSGLGHDEAKFAEVLAERGSSREEFEAEARSAAERD
C3              GIVQAQFNNALHDALSGLGHDEAKFAEVLAERGSSREEFEAEARSAAERD
C4              GIVQAQFNNALHDALSGLGHDEAKFAEVLAERGSSREEFEAEARSAAERD
C5              GIVQAQFNNALHDALSGLGHDEAKFAEVLAERGSSREEFEAEARSAAERD
C6              GIVQAQFNNALHDALSGLGHDEAKFAEVLAERGSSREEFEAEARSAAERD
                **************************************************

C1              VTRQLLLDVVADDQKIQVGQDDLNERLLATSQQYGVDAQQLFGFLRENNR
C2              VTRQLLLDVVADDQKIQVGQDDLNERLLATSQQYGVDAQQLFGFLRENNR
C3              VTRQLLLDVVADDQKIQVGQDDLNERLLATSQQYGVDAQQLFGFLRENNR
C4              VTRQLLLDVVADDQKIQVGQDDLNERLLATSQQYGVDAQQLFGFLRENNR
C5              VTRQLLLDVVADDQKIQVGQDDLNERLLATSQQYGVDAQQLFGFLRENNR
C6              VTRQLLLDVVADDQKIQVGQDDLNKRLLATSQQYGVDAQQLFGFLRENNR
                ************************:*************************

C1              LSSLVTDARRRLAVAAVVEAATFTDSDGNTIDTSEFFGKHAQSDKADQKT
C2              LSSLVTDARRRLAVAAVVEAATFTDSDGNTIDTSEFFGKHAQSDKADQKT
C3              LSSLVTDARRRLAVAAVVEAATFTDSDGNTIDTSEFFGKHAQSDKADQKT
C4              LSSLVTDARRRLAVAAVVEAATFTDSDGNTIDTSEFFGKHAQSDKADQKT
C5              LSSLVTDARRRLAVAAVVEAATFTDSDGNTIDTSEFFGKHAQSDKADQKT
C6              LSSLVTDARRRLAVAAVVEAATFTDSDGNTIDTSEFFGKHAQSDKADQKT
                **************************************************

C1              EEADPNSDAIDEEVDEAAE
C2              EEADPNSDAIDEEVDEAAE
C3              EEADPNSDAIDEEVDEAAE
C4              EEADPNSDAIDEEVDEAAE
C5              EEADPNSDAIDEEVDEAAE
C6              EEADPNSDAIDEEVDEAAE
                *******************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 99.79 C1	 C6	 99.79
TOP	    5    0	 99.79 C6	 C1	 99.79
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 99.79 C2	 C6	 99.79
TOP	    5    1	 99.79 C6	 C2	 99.79
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 99.79 C3	 C6	 99.79
TOP	    5    2	 99.79 C6	 C3	 99.79
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 99.79 C4	 C6	 99.79
TOP	    5    3	 99.79 C6	 C4	 99.79
BOT	    4    5	 99.79 C5	 C6	 99.79
TOP	    5    4	 99.79 C6	 C5	 99.79
AVG	 0	 C1	  *	 99.96
AVG	 1	 C2	  *	 99.96
AVG	 2	 C3	  *	 99.96
AVG	 3	 C4	  *	 99.96
AVG	 4	 C5	  *	 99.96
AVG	 5	 C6	  *	 99.79
TOT	 TOT	  *	 99.93
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGAAAAGCAGTGTCGAGCAGTTGAACCCTACTCGGGTGCGTATCAACGT
C2              GTGAAAAGCAGTGTCGAGCAGTTGAACCCTACTCGGGTGCGTATCAACGT
C3              GTGAAAAGCAGTGTCGAGCAGTTGAACCCTACTCGGGTGCGTATCAACGT
C4              GTGAAAAGCAGTGTCGAGCAGTTGAACCCTACTCGGGTGCGTATCAACGT
C5              GTGAAAAGCAGTGTCGAGCAGTTGAACCCTACTCGGGTGCGTATCAACGT
C6              GTGAAAAGCAGTGTCGAGCAGTTGAACCCTACTCGGGTGCGTATCAACGT
                **************************************************

C1              GGAAGTACCTTTTACAGAGCTTGAGCCGGATTTTCAGCGGGCCTACAAAG
C2              GGAAGTACCTTTTACAGAGCTTGAGCCGGATTTTCAGCGGGCCTACAAAG
C3              GGAAGTACCTTTTACAGAGCTTGAGCCGGATTTTCAGCGGGCCTACAAAG
C4              GGAAGTACCTTTTACAGAGCTTGAGCCGGATTTTCAGCGGGCCTACAAAG
C5              GGAAGTACCTTTTACAGAGCTTGAGCCGGATTTTCAGCGGGCCTACAAAG
C6              GGAAGTACCTTTTACAGAGCTTGAGCCGGATTTTCAGCGGGCCTACAAAG
                **************************************************

C1              AGCTGGCCAGACATGTGCAGCTGCCCGGTTTCCGGCCCGGGAAAGTTCCT
C2              AGCTGGCCAGACATGTGCAGCTGCCCGGTTTCCGGCCCGGGAAAGTTCCT
C3              AGCTGGCCAGACATGTGCAGCTGCCCGGTTTCCGGCCCGGGAAAGTTCCT
C4              AGCTGGCCAGACATGTGCAGCTGCCCGGTTTCCGGCCCGGGAAAGTTCCT
C5              AGCTGGCCAGACATGTGCAGCTGCCCGGTTTCCGGCCCGGGAAAGTTCCT
C6              AGCTGGCCAGACATGTGCAGCTGCCCGGTTTCCGGCCCGGGAAAGTTCCT
                **************************************************

C1              GCGCGATTGCTGGAGGCCCGTTTTGGTCGGGAGACGCTGCTCGATCAGGT
C2              GCGCGATTGCTGGAGGCCCGTTTTGGTCGGGAGACGCTGCTCGATCAGGT
C3              GCGCGATTGCTGGAGGCCCGTTTTGGTCGGGAGACGCTGCTCGATCAGGT
C4              GCGCGATTGCTGGAGGCCCGTTTTGGTCGGGAGACGCTGCTCGATCAGGT
C5              GCGCGATTGCTGGAGGCCCGTTTTGGTCGGGAGACGCTGCTCGATCAGGT
C6              GCGCGATTGCTGGAGGCCCGTTTTGGTCGGGAGACGCTGCTCGATCAGGT
                **************************************************

C1              CGTCAACGAAGCCATGCCCAGTCGGTACGGGCAGGCGCTGGCGGAGTCTG
C2              CGTCAACGAAGCCATGCCCAGTCGGTACGGGCAGGCGCTGGCGGAGTCTG
C3              CGTCAACGAAGCCATGCCCAGTCGGTACGGGCAGGCGCTGGCGGAGTCTG
C4              CGTCAACGAAGCCATGCCCAGTCGGTACGGGCAGGCGCTGGCGGAGTCTG
C5              CGTCAACGAAGCCATGCCCAGTCGGTACGGGCAGGCGCTGGCGGAGTCTG
C6              CGTCAACGAAGCCATGCCCAGTCGGTACGGGCAGGCGCTGGCGGAGTCTG
                **************************************************

C1              AGGTCCAACCGATCGGCCAGCCCGAAATAGAGGTGATCAGAAAGGAGTAC
C2              AGGTCCAACCGATCGGCCAGCCCGAAATAGAGGTGATCAGAAAGGAGTAC
C3              AGGTCCAACCGATCGGCCAGCCCGAAATAGAGGTGATCAGAAAGGAGTAC
C4              AGGTCCAACCGATCGGCCAGCCCGAAATAGAGGTGATCAGAAAGGAGTAC
C5              AGGTCCAACCGATCGGCCAGCCCGAAATAGAGGTGATCAGAAAGGAGTAC
C6              AGGTCCAACCGATCGGCCAGCCCGAAATAGAGGTGATCAGAAAGGAGTAC
                **************************************************

C1              GGTCAGGATCTGGCTTTCACCGTCGAAGTTGAGGTACGCCCCAAGATCGC
C2              GGTCAGGATCTGGCTTTCACCGTCGAAGTTGAGGTACGCCCCAAGATCGC
C3              GGTCAGGATCTGGCTTTCACCGTCGAAGTTGAGGTACGCCCCAAGATCGC
C4              GGTCAGGATCTGGCTTTCACCGTCGAAGTTGAGGTACGCCCCAAGATCGC
C5              GGTCAGGATCTGGCTTTCACCGTCGAAGTTGAGGTACGCCCCAAGATCGC
C6              GGTCAGGATCTGGCTTTCACCGTCGAAGTTGAGGTACGCCCCAAGATCGC
                **************************************************

C1              ACTTCCGGATTTCAGCACATTGAAGGTTGTTGTGGATCCGGTCGAGGTCA
C2              ACTTCCGGATTTCAGCACATTGAAGGTTGTTGTGGATCCGGTCGAGGTCA
C3              ACTTCCGGATTTCAGCACATTGAAGGTTGTTGTGGATCCGGTCGAGGTCA
C4              ACTTCCGGATTTCAGCACATTGAAGGTTGTTGTGGATCCGGTCGAGGTCA
C5              ACTTCCGGATTTCAGCACATTGAAGGTTGTTGTGGATCCGGTCGAGGTCA
C6              ACTTCCGGATTTCAGCACATTGAAGGTTGTTGTGGATCCGGTCGAGGTCA
                **************************************************

C1              GCACCGATGATGTCGAGGCAGAGTTGCGGTCGTTGCGTGCCAGGTTCGGC
C2              GCACCGATGATGTCGAGGCAGAGTTGCGGTCGTTGCGTGCCAGGTTCGGC
C3              GCACCGATGATGTCGAGGCAGAGTTGCGGTCGTTGCGTGCCAGGTTCGGC
C4              GCACCGATGATGTCGAGGCAGAGTTGCGGTCGTTGCGTGCCAGGTTCGGC
C5              GCACCGATGATGTCGAGGCAGAGTTGCGGTCGTTGCGTGCCAGGTTCGGC
C6              GCACCGATGATGTCGAGGCAGAGTTGCGGTCGTTGCGTGCCAGGTTCGGC
                **************************************************

C1              ACTCTGATCGGCGTGGACCGACCTGTGGCGCTCGGTGACTTTGTCTCGAT
C2              ACTCTGATCGGCGTGGACCGACCTGTGGCGCTCGGTGACTTTGTCTCGAT
C3              ACTCTGATCGGCGTGGACCGACCTGTGGCGCTCGGTGACTTTGTCTCGAT
C4              ACTCTGATCGGCGTGGACCGACCTGTGGCGCTCGGTGACTTTGTCTCGAT
C5              ACTCTGATCGGCGTGGACCGACCTGTGGCGCTCGGTGACTTTGTCTCGAT
C6              ACTCTGATCGGCGTGGACCGACCTGTGGCGCTCGGTGACTTTGTCTCGAT
                **************************************************

C1              TGATTTGTCGGCCACCATCAATGGCGAGAAGGTGCCGAACGCCGATGCGG
C2              TGATTTGTCGGCCACCATCAATGGCGAGAAGGTGCCGAACGCCGATGCGG
C3              TGATTTGTCGGCCACCATCAATGGCGAGAAGGTGCCGAACGCCGATGCGG
C4              TGATTTGTCGGCCACCATCAATGGCGAGAAGGTGCCGAACGCCGATGCGG
C5              TGATTTGTCGGCCACCATCAATGGCGAGAAGGTGCCGAACGCCGATGCGG
C6              TGATTTGTCGGCCACCATCAATGGCGAGAAGGTGCCGAACGCCGATGCGG
                **************************************************

C1              AGGGGCTGTCTCATGAGGTCGGCTACGGCCGGCTTATCGCAGGTCTCGAC
C2              AGGGGCTGTCTCATGAGGTCGGCTACGGCCGGCTTATCGCAGGTCTCGAC
C3              AGGGGCTGTCTCATGAGGTCGGCTACGGCCGGCTTATCGCAGGTCTCGAC
C4              AGGGGCTGTCTCATGAGGTCGGCTACGGCCGGCTTATCGCAGGTCTCGAC
C5              AGGGGCTGTCTCATGAGGTCGGCTACGGCCGGCTTATCGCAGGTCTCGAC
C6              AGGGGCTGTCTCATGAGGTCGGCTACGGCCGGCTTATCGCAGGTCTCGAC
                **************************************************

C1              GATGCGCTCGTCGGTTTGTCCGCTGGTGAGTCGCGAGTCTTCACCACCCA
C2              GATGCGCTCGTCGGTTTGTCCGCTGGTGAGTCGCGAGTCTTCACCACCCA
C3              GATGCGCTCGTCGGTTTGTCCGCTGGTGAGTCGCGAGTCTTCACCACCCA
C4              GATGCGCTCGTCGGTTTGTCCGCTGGTGAGTCGCGAGTCTTCACCACCCA
C5              GATGCGCTCGTCGGTTTGTCCGCTGGTGAGTCGCGAGTCTTCACCACCCA
C6              GATGCGCTCGTCGGTTTGTCCGCTGGTGAGTCGCGAGTCTTCACCACCCA
                **************************************************

C1              GTTAGCGACCAGCAAACACGCCGGGCAAGACGCAGAGGTCATCGTCACCG
C2              GTTAGCGACCAGCAAACACGCCGGGCAAGACGCAGAGGTCATCGTCACCG
C3              GTTAGCGACCAGCAAACACGCCGGGCAAGACGCAGAGGTCATCGTCACCG
C4              GTTAGCGACCAGCAAACACGCCGGGCAAGACGCAGAGGTCATCGTCACCG
C5              GTTAGCGACCAGCAAACACGCCGGGCAAGACGCAGAGGTCATCGTCACCG
C6              GTTAGCGACCAGCAAACACGCCGGGCAAGACGCAGAGGTCATCGTCACCG
                **************************************************

C1              TCAAGTCGGTCAAGGAACGCGAATTGCCGGAGCCGGATGACGAATTCGCG
C2              TCAAGTCGGTCAAGGAACGCGAATTGCCGGAGCCGGATGACGAATTCGCG
C3              TCAAGTCGGTCAAGGAACGCGAATTGCCGGAGCCGGATGACGAATTCGCG
C4              TCAAGTCGGTCAAGGAACGCGAATTGCCGGAGCCGGATGACGAATTCGCG
C5              TCAAGTCGGTCAAGGAACGCGAATTGCCGGAGCCGGATGACGAATTCGCG
C6              TCAAGTCGGTCAAGGAACGCGAATTGCCGGAGCCGGATGACGAATTCGCG
                **************************************************

C1              CAACTGGTCAGCGAGTTCGACACCATGGCAGAACTACGGGCCAATCTCGG
C2              CAACTGGTCAGCGAGTTCGACACCATGGCAGAACTACGGGCCAATCTCGG
C3              CAACTGGTCAGCGAGTTCGACACCATGGCAGAACTACGGGCCAATCTCGG
C4              CAACTGGTCAGCGAGTTCGACACCATGGCAGAACTACGGGCCAATCTCGG
C5              CAACTGGTCAGCGAGTTCGACACCATGGCAGAACTACGGGCCAATCTCGG
C6              CAACTGGTCAGCGAGTTCGACACCATGGCAGAACTACGGGCCAATCTCGG
                **************************************************

C1              GGATCAGGTCCGTAAGGCTAAGTACGCCCAGCAAGCGGAGAAAATCCGTG
C2              GGATCAGGTCCGTAAGGCTAAGTACGCCCAGCAAGCGGAGAAAATCCGTG
C3              GGATCAGGTCCGTAAGGCTAAGTACGCCCAGCAAGCGGAGAAAATCCGTG
C4              GGATCAGGTCCGTAAGGCTAAGTACGCCCAGCAAGCGGAGAAAATCCGTG
C5              GGATCAGGTCCGTAAGGCTAAGTACGCCCAGCAAGCGGAGAAAATCCGTG
C6              GGATCAGGTCCGTAAGGCTAAGTACGCCCAGCAAGCGGAGAAAATCCGTG
                **************************************************

C1              ACGCGGCTGTGGACGCTTTGCTCGAGCGGGTAGATGTGCCATTGCCGGAA
C2              ACGCGGCTGTGGACGCTTTGCTCGAGCGGGTAGATGTGCCATTGCCGGAA
C3              ACGCGGCTGTGGACGCTTTGCTCGAGCGGGTAGATGTGCCATTGCCGGAA
C4              ACGCGGCTGTGGACGCTTTGCTCGAGCGGGTAGATGTGCCATTGCCGGAA
C5              ACGCGGCTGTGGACGCTTTGCTCGAGCGGGTAGATGTGCCATTGCCGGAA
C6              ACGCGGCTGTGGACGCTTTGCTCGAGCGGGTAGATGTGCCATTGCCGGAA
                **************************************************

C1              GGGATTGTGCAAGCCCAGTTCAATAATGCCCTGCATGACGCGCTCAGCGG
C2              GGGATTGTGCAAGCCCAGTTCAATAATGCCCTGCATGACGCGCTCAGCGG
C3              GGGATTGTGCAAGCCCAGTTCAATAATGCCCTGCATGACGCGCTCAGCGG
C4              GGGATTGTGCAAGCCCAGTTCAATAATGCCCTGCATGACGCGCTCAGCGG
C5              GGGATTGTGCAAGCCCAGTTCAATAATGCCCTGCATGACGCGCTCAGCGG
C6              GGGATTGTGCAAGCCCAGTTCAATAATGCCCTGCATGACGCGCTCAGCGG
                **************************************************

C1              CCTGGGCCACGACGAAGCCAAGTTCGCCGAGGTGCTCGCTGAGCGTGGGT
C2              CCTGGGCCACGACGAAGCCAAGTTCGCCGAGGTGCTCGCTGAGCGTGGGT
C3              CCTGGGCCACGACGAAGCCAAGTTCGCCGAGGTGCTCGCTGAGCGTGGGT
C4              CCTGGGCCACGACGAAGCCAAGTTCGCCGAGGTGCTCGCTGAGCGTGGGT
C5              CCTGGGCCACGACGAAGCCAAGTTCGCCGAGGTGCTCGCTGAGCGTGGGT
C6              CCTGGGCCACGACGAAGCCAAGTTCGCCGAGGTGCTCGCTGAGCGTGGGT
                **************************************************

C1              CGTCGCGCGAGGAGTTCGAGGCTGAAGCGCGTAGCGCTGCCGAGAGAGAT
C2              CGTCGCGCGAGGAGTTCGAGGCTGAAGCGCGTAGCGCTGCCGAGAGAGAT
C3              CGTCGCGCGAGGAGTTCGAGGCTGAAGCGCGTAGCGCTGCCGAGAGAGAT
C4              CGTCGCGCGAGGAGTTCGAGGCTGAAGCGCGTAGCGCTGCCGAGAGAGAT
C5              CGTCGCGCGAGGAGTTCGAGGCTGAAGCGCGTAGCGCTGCCGAGAGAGAT
C6              CGTCGCGCGAGGAGTTCGAGGCTGAAGCGCGTAGCGCTGCCGAGAGAGAT
                **************************************************

C1              GTCACGAGGCAACTGCTGTTGGATGTAGTGGCTGACGACCAGAAGATCCA
C2              GTCACGAGGCAACTGCTGTTGGATGTAGTGGCTGACGACCAGAAGATCCA
C3              GTCACGAGGCAACTGCTGTTGGATGTAGTGGCTGACGACCAGAAGATCCA
C4              GTCACGAGGCAACTGCTGTTGGATGTAGTGGCTGACGACCAGAAGATCCA
C5              GTCACGAGGCAACTGCTGTTGGATGTAGTGGCTGACGACCAGAAGATCCA
C6              GTCACGAGGCAACTGCTGTTGGATGTAGTGGCTGACGACCAGAAGATCCA
                **************************************************

C1              GGTGGGTCAGGATGACCTGAACGAACGCTTGCTCGCCACGTCTCAGCAAT
C2              GGTGGGTCAGGATGACCTGAACGAACGCTTGCTCGCCACGTCTCAGCAAT
C3              GGTGGGTCAGGATGACCTGAACGAACGCTTGCTCGCCACGTCTCAGCAAT
C4              GGTGGGTCAGGATGACCTGAACGAACGCTTGCTCGCCACGTCTCAGCAAT
C5              GGTGGGTCAGGATGACCTGAACGAACGCTTGCTCGCCACGTCTCAGCAAT
C6              GGTGGGTCAGGATGACCTGAACAAACGCTTGCTCGCCACGTCTCAGCAAT
                **********************.***************************

C1              ACGGCGTCGACGCACAGCAGCTGTTTGGCTTCTTGCGGGAAAACAACCGG
C2              ACGGCGTCGACGCACAGCAGCTGTTTGGCTTCTTGCGGGAAAACAACCGG
C3              ACGGCGTCGACGCACAGCAGCTGTTTGGCTTCTTGCGGGAAAACAACCGG
C4              ACGGCGTCGACGCACAGCAGCTGTTTGGCTTCTTGCGGGAAAACAACCGG
C5              ACGGCGTCGACGCACAGCAGCTGTTTGGCTTCTTGCGGGAAAACAACCGG
C6              ACGGCGTCGACGCACAGCAGCTGTTTGGCTTCTTGCGGGAAAACAACCGG
                **************************************************

C1              TTATCGTCCTTGGTTACTGACGCGCGGCGCAGGCTGGCGGTCGCAGCTGT
C2              TTATCGTCCTTGGTTACTGACGCGCGGCGCAGGCTGGCGGTCGCAGCTGT
C3              TTATCGTCCTTGGTTACTGACGCGCGGCGCAGGCTGGCGGTCGCAGCTGT
C4              TTATCGTCCTTGGTTACTGACGCGCGGCGCAGGCTGGCGGTCGCAGCTGT
C5              TTATCGTCCTTGGTTACTGACGCGCGGCGCAGGCTGGCGGTCGCAGCTGT
C6              TTATCGTCCTTGGTTACTGACGCGCGGCGCAGGCTGGCGGTCGCAGCTGT
                **************************************************

C1              GGTCGAGGCGGCTACGTTCACCGATAGTGACGGAAACACGATAGACACCA
C2              GGTCGAGGCGGCTACGTTCACCGATAGTGACGGAAACACGATAGACACCA
C3              GGTCGAGGCGGCTACGTTCACCGATAGTGACGGAAACACGATAGACACCA
C4              GGTCGAGGCGGCTACGTTCACCGATAGTGACGGAAACACGATAGACACCA
C5              GGTCGAGGCGGCTACGTTCACCGATAGTGACGGAAACACGATAGACACCA
C6              GGTCGAGGCGGCTACGTTCACCGATAGTGACGGAAACACGATAGACACCA
                **************************************************

C1              GTGAATTTTTCGGTAAGCATGCCCAAAGCGATAAGGCCGACCAGAAGACC
C2              GTGAATTTTTCGGTAAGCATGCCCAAAGCGATAAGGCCGACCAGAAGACC
C3              GTGAATTTTTCGGTAAGCATGCCCAAAGCGATAAGGCCGACCAGAAGACC
C4              GTGAATTTTTCGGTAAGCATGCCCAAAGCGATAAGGCCGACCAGAAGACC
C5              GTGAATTTTTCGGTAAGCATGCCCAAAGCGATAAGGCCGACCAGAAGACC
C6              GTGAATTTTTCGGTAAGCATGCCCAAAGCGATAAGGCCGACCAGAAGACC
                **************************************************

C1              GAAGAAGCAGATCCGAACAGTGATGCCATCGATGAAGAGGTCGACGAGGC
C2              GAAGAAGCAGATCCGAACAGTGATGCCATCGATGAAGAGGTCGACGAGGC
C3              GAAGAAGCAGATCCGAACAGTGATGCCATCGATGAAGAGGTCGACGAGGC
C4              GAAGAAGCAGATCCGAACAGTGATGCCATCGATGAAGAGGTCGACGAGGC
C5              GAAGAAGCAGATCCGAACAGTGATGCCATCGATGAAGAGGTCGACGAGGC
C6              GAAGAAGCAGATCCGAACAGTGATGCCATCGATGAAGAGGTCGACGAGGC
                **************************************************

C1              CGCGGAA
C2              CGCGGAA
C3              CGCGGAA
C4              CGCGGAA
C5              CGCGGAA
C6              CGCGGAA
                *******



>C1
GTGAAAAGCAGTGTCGAGCAGTTGAACCCTACTCGGGTGCGTATCAACGT
GGAAGTACCTTTTACAGAGCTTGAGCCGGATTTTCAGCGGGCCTACAAAG
AGCTGGCCAGACATGTGCAGCTGCCCGGTTTCCGGCCCGGGAAAGTTCCT
GCGCGATTGCTGGAGGCCCGTTTTGGTCGGGAGACGCTGCTCGATCAGGT
CGTCAACGAAGCCATGCCCAGTCGGTACGGGCAGGCGCTGGCGGAGTCTG
AGGTCCAACCGATCGGCCAGCCCGAAATAGAGGTGATCAGAAAGGAGTAC
GGTCAGGATCTGGCTTTCACCGTCGAAGTTGAGGTACGCCCCAAGATCGC
ACTTCCGGATTTCAGCACATTGAAGGTTGTTGTGGATCCGGTCGAGGTCA
GCACCGATGATGTCGAGGCAGAGTTGCGGTCGTTGCGTGCCAGGTTCGGC
ACTCTGATCGGCGTGGACCGACCTGTGGCGCTCGGTGACTTTGTCTCGAT
TGATTTGTCGGCCACCATCAATGGCGAGAAGGTGCCGAACGCCGATGCGG
AGGGGCTGTCTCATGAGGTCGGCTACGGCCGGCTTATCGCAGGTCTCGAC
GATGCGCTCGTCGGTTTGTCCGCTGGTGAGTCGCGAGTCTTCACCACCCA
GTTAGCGACCAGCAAACACGCCGGGCAAGACGCAGAGGTCATCGTCACCG
TCAAGTCGGTCAAGGAACGCGAATTGCCGGAGCCGGATGACGAATTCGCG
CAACTGGTCAGCGAGTTCGACACCATGGCAGAACTACGGGCCAATCTCGG
GGATCAGGTCCGTAAGGCTAAGTACGCCCAGCAAGCGGAGAAAATCCGTG
ACGCGGCTGTGGACGCTTTGCTCGAGCGGGTAGATGTGCCATTGCCGGAA
GGGATTGTGCAAGCCCAGTTCAATAATGCCCTGCATGACGCGCTCAGCGG
CCTGGGCCACGACGAAGCCAAGTTCGCCGAGGTGCTCGCTGAGCGTGGGT
CGTCGCGCGAGGAGTTCGAGGCTGAAGCGCGTAGCGCTGCCGAGAGAGAT
GTCACGAGGCAACTGCTGTTGGATGTAGTGGCTGACGACCAGAAGATCCA
GGTGGGTCAGGATGACCTGAACGAACGCTTGCTCGCCACGTCTCAGCAAT
ACGGCGTCGACGCACAGCAGCTGTTTGGCTTCTTGCGGGAAAACAACCGG
TTATCGTCCTTGGTTACTGACGCGCGGCGCAGGCTGGCGGTCGCAGCTGT
GGTCGAGGCGGCTACGTTCACCGATAGTGACGGAAACACGATAGACACCA
GTGAATTTTTCGGTAAGCATGCCCAAAGCGATAAGGCCGACCAGAAGACC
GAAGAAGCAGATCCGAACAGTGATGCCATCGATGAAGAGGTCGACGAGGC
CGCGGAA
>C2
GTGAAAAGCAGTGTCGAGCAGTTGAACCCTACTCGGGTGCGTATCAACGT
GGAAGTACCTTTTACAGAGCTTGAGCCGGATTTTCAGCGGGCCTACAAAG
AGCTGGCCAGACATGTGCAGCTGCCCGGTTTCCGGCCCGGGAAAGTTCCT
GCGCGATTGCTGGAGGCCCGTTTTGGTCGGGAGACGCTGCTCGATCAGGT
CGTCAACGAAGCCATGCCCAGTCGGTACGGGCAGGCGCTGGCGGAGTCTG
AGGTCCAACCGATCGGCCAGCCCGAAATAGAGGTGATCAGAAAGGAGTAC
GGTCAGGATCTGGCTTTCACCGTCGAAGTTGAGGTACGCCCCAAGATCGC
ACTTCCGGATTTCAGCACATTGAAGGTTGTTGTGGATCCGGTCGAGGTCA
GCACCGATGATGTCGAGGCAGAGTTGCGGTCGTTGCGTGCCAGGTTCGGC
ACTCTGATCGGCGTGGACCGACCTGTGGCGCTCGGTGACTTTGTCTCGAT
TGATTTGTCGGCCACCATCAATGGCGAGAAGGTGCCGAACGCCGATGCGG
AGGGGCTGTCTCATGAGGTCGGCTACGGCCGGCTTATCGCAGGTCTCGAC
GATGCGCTCGTCGGTTTGTCCGCTGGTGAGTCGCGAGTCTTCACCACCCA
GTTAGCGACCAGCAAACACGCCGGGCAAGACGCAGAGGTCATCGTCACCG
TCAAGTCGGTCAAGGAACGCGAATTGCCGGAGCCGGATGACGAATTCGCG
CAACTGGTCAGCGAGTTCGACACCATGGCAGAACTACGGGCCAATCTCGG
GGATCAGGTCCGTAAGGCTAAGTACGCCCAGCAAGCGGAGAAAATCCGTG
ACGCGGCTGTGGACGCTTTGCTCGAGCGGGTAGATGTGCCATTGCCGGAA
GGGATTGTGCAAGCCCAGTTCAATAATGCCCTGCATGACGCGCTCAGCGG
CCTGGGCCACGACGAAGCCAAGTTCGCCGAGGTGCTCGCTGAGCGTGGGT
CGTCGCGCGAGGAGTTCGAGGCTGAAGCGCGTAGCGCTGCCGAGAGAGAT
GTCACGAGGCAACTGCTGTTGGATGTAGTGGCTGACGACCAGAAGATCCA
GGTGGGTCAGGATGACCTGAACGAACGCTTGCTCGCCACGTCTCAGCAAT
ACGGCGTCGACGCACAGCAGCTGTTTGGCTTCTTGCGGGAAAACAACCGG
TTATCGTCCTTGGTTACTGACGCGCGGCGCAGGCTGGCGGTCGCAGCTGT
GGTCGAGGCGGCTACGTTCACCGATAGTGACGGAAACACGATAGACACCA
GTGAATTTTTCGGTAAGCATGCCCAAAGCGATAAGGCCGACCAGAAGACC
GAAGAAGCAGATCCGAACAGTGATGCCATCGATGAAGAGGTCGACGAGGC
CGCGGAA
>C3
GTGAAAAGCAGTGTCGAGCAGTTGAACCCTACTCGGGTGCGTATCAACGT
GGAAGTACCTTTTACAGAGCTTGAGCCGGATTTTCAGCGGGCCTACAAAG
AGCTGGCCAGACATGTGCAGCTGCCCGGTTTCCGGCCCGGGAAAGTTCCT
GCGCGATTGCTGGAGGCCCGTTTTGGTCGGGAGACGCTGCTCGATCAGGT
CGTCAACGAAGCCATGCCCAGTCGGTACGGGCAGGCGCTGGCGGAGTCTG
AGGTCCAACCGATCGGCCAGCCCGAAATAGAGGTGATCAGAAAGGAGTAC
GGTCAGGATCTGGCTTTCACCGTCGAAGTTGAGGTACGCCCCAAGATCGC
ACTTCCGGATTTCAGCACATTGAAGGTTGTTGTGGATCCGGTCGAGGTCA
GCACCGATGATGTCGAGGCAGAGTTGCGGTCGTTGCGTGCCAGGTTCGGC
ACTCTGATCGGCGTGGACCGACCTGTGGCGCTCGGTGACTTTGTCTCGAT
TGATTTGTCGGCCACCATCAATGGCGAGAAGGTGCCGAACGCCGATGCGG
AGGGGCTGTCTCATGAGGTCGGCTACGGCCGGCTTATCGCAGGTCTCGAC
GATGCGCTCGTCGGTTTGTCCGCTGGTGAGTCGCGAGTCTTCACCACCCA
GTTAGCGACCAGCAAACACGCCGGGCAAGACGCAGAGGTCATCGTCACCG
TCAAGTCGGTCAAGGAACGCGAATTGCCGGAGCCGGATGACGAATTCGCG
CAACTGGTCAGCGAGTTCGACACCATGGCAGAACTACGGGCCAATCTCGG
GGATCAGGTCCGTAAGGCTAAGTACGCCCAGCAAGCGGAGAAAATCCGTG
ACGCGGCTGTGGACGCTTTGCTCGAGCGGGTAGATGTGCCATTGCCGGAA
GGGATTGTGCAAGCCCAGTTCAATAATGCCCTGCATGACGCGCTCAGCGG
CCTGGGCCACGACGAAGCCAAGTTCGCCGAGGTGCTCGCTGAGCGTGGGT
CGTCGCGCGAGGAGTTCGAGGCTGAAGCGCGTAGCGCTGCCGAGAGAGAT
GTCACGAGGCAACTGCTGTTGGATGTAGTGGCTGACGACCAGAAGATCCA
GGTGGGTCAGGATGACCTGAACGAACGCTTGCTCGCCACGTCTCAGCAAT
ACGGCGTCGACGCACAGCAGCTGTTTGGCTTCTTGCGGGAAAACAACCGG
TTATCGTCCTTGGTTACTGACGCGCGGCGCAGGCTGGCGGTCGCAGCTGT
GGTCGAGGCGGCTACGTTCACCGATAGTGACGGAAACACGATAGACACCA
GTGAATTTTTCGGTAAGCATGCCCAAAGCGATAAGGCCGACCAGAAGACC
GAAGAAGCAGATCCGAACAGTGATGCCATCGATGAAGAGGTCGACGAGGC
CGCGGAA
>C4
GTGAAAAGCAGTGTCGAGCAGTTGAACCCTACTCGGGTGCGTATCAACGT
GGAAGTACCTTTTACAGAGCTTGAGCCGGATTTTCAGCGGGCCTACAAAG
AGCTGGCCAGACATGTGCAGCTGCCCGGTTTCCGGCCCGGGAAAGTTCCT
GCGCGATTGCTGGAGGCCCGTTTTGGTCGGGAGACGCTGCTCGATCAGGT
CGTCAACGAAGCCATGCCCAGTCGGTACGGGCAGGCGCTGGCGGAGTCTG
AGGTCCAACCGATCGGCCAGCCCGAAATAGAGGTGATCAGAAAGGAGTAC
GGTCAGGATCTGGCTTTCACCGTCGAAGTTGAGGTACGCCCCAAGATCGC
ACTTCCGGATTTCAGCACATTGAAGGTTGTTGTGGATCCGGTCGAGGTCA
GCACCGATGATGTCGAGGCAGAGTTGCGGTCGTTGCGTGCCAGGTTCGGC
ACTCTGATCGGCGTGGACCGACCTGTGGCGCTCGGTGACTTTGTCTCGAT
TGATTTGTCGGCCACCATCAATGGCGAGAAGGTGCCGAACGCCGATGCGG
AGGGGCTGTCTCATGAGGTCGGCTACGGCCGGCTTATCGCAGGTCTCGAC
GATGCGCTCGTCGGTTTGTCCGCTGGTGAGTCGCGAGTCTTCACCACCCA
GTTAGCGACCAGCAAACACGCCGGGCAAGACGCAGAGGTCATCGTCACCG
TCAAGTCGGTCAAGGAACGCGAATTGCCGGAGCCGGATGACGAATTCGCG
CAACTGGTCAGCGAGTTCGACACCATGGCAGAACTACGGGCCAATCTCGG
GGATCAGGTCCGTAAGGCTAAGTACGCCCAGCAAGCGGAGAAAATCCGTG
ACGCGGCTGTGGACGCTTTGCTCGAGCGGGTAGATGTGCCATTGCCGGAA
GGGATTGTGCAAGCCCAGTTCAATAATGCCCTGCATGACGCGCTCAGCGG
CCTGGGCCACGACGAAGCCAAGTTCGCCGAGGTGCTCGCTGAGCGTGGGT
CGTCGCGCGAGGAGTTCGAGGCTGAAGCGCGTAGCGCTGCCGAGAGAGAT
GTCACGAGGCAACTGCTGTTGGATGTAGTGGCTGACGACCAGAAGATCCA
GGTGGGTCAGGATGACCTGAACGAACGCTTGCTCGCCACGTCTCAGCAAT
ACGGCGTCGACGCACAGCAGCTGTTTGGCTTCTTGCGGGAAAACAACCGG
TTATCGTCCTTGGTTACTGACGCGCGGCGCAGGCTGGCGGTCGCAGCTGT
GGTCGAGGCGGCTACGTTCACCGATAGTGACGGAAACACGATAGACACCA
GTGAATTTTTCGGTAAGCATGCCCAAAGCGATAAGGCCGACCAGAAGACC
GAAGAAGCAGATCCGAACAGTGATGCCATCGATGAAGAGGTCGACGAGGC
CGCGGAA
>C5
GTGAAAAGCAGTGTCGAGCAGTTGAACCCTACTCGGGTGCGTATCAACGT
GGAAGTACCTTTTACAGAGCTTGAGCCGGATTTTCAGCGGGCCTACAAAG
AGCTGGCCAGACATGTGCAGCTGCCCGGTTTCCGGCCCGGGAAAGTTCCT
GCGCGATTGCTGGAGGCCCGTTTTGGTCGGGAGACGCTGCTCGATCAGGT
CGTCAACGAAGCCATGCCCAGTCGGTACGGGCAGGCGCTGGCGGAGTCTG
AGGTCCAACCGATCGGCCAGCCCGAAATAGAGGTGATCAGAAAGGAGTAC
GGTCAGGATCTGGCTTTCACCGTCGAAGTTGAGGTACGCCCCAAGATCGC
ACTTCCGGATTTCAGCACATTGAAGGTTGTTGTGGATCCGGTCGAGGTCA
GCACCGATGATGTCGAGGCAGAGTTGCGGTCGTTGCGTGCCAGGTTCGGC
ACTCTGATCGGCGTGGACCGACCTGTGGCGCTCGGTGACTTTGTCTCGAT
TGATTTGTCGGCCACCATCAATGGCGAGAAGGTGCCGAACGCCGATGCGG
AGGGGCTGTCTCATGAGGTCGGCTACGGCCGGCTTATCGCAGGTCTCGAC
GATGCGCTCGTCGGTTTGTCCGCTGGTGAGTCGCGAGTCTTCACCACCCA
GTTAGCGACCAGCAAACACGCCGGGCAAGACGCAGAGGTCATCGTCACCG
TCAAGTCGGTCAAGGAACGCGAATTGCCGGAGCCGGATGACGAATTCGCG
CAACTGGTCAGCGAGTTCGACACCATGGCAGAACTACGGGCCAATCTCGG
GGATCAGGTCCGTAAGGCTAAGTACGCCCAGCAAGCGGAGAAAATCCGTG
ACGCGGCTGTGGACGCTTTGCTCGAGCGGGTAGATGTGCCATTGCCGGAA
GGGATTGTGCAAGCCCAGTTCAATAATGCCCTGCATGACGCGCTCAGCGG
CCTGGGCCACGACGAAGCCAAGTTCGCCGAGGTGCTCGCTGAGCGTGGGT
CGTCGCGCGAGGAGTTCGAGGCTGAAGCGCGTAGCGCTGCCGAGAGAGAT
GTCACGAGGCAACTGCTGTTGGATGTAGTGGCTGACGACCAGAAGATCCA
GGTGGGTCAGGATGACCTGAACGAACGCTTGCTCGCCACGTCTCAGCAAT
ACGGCGTCGACGCACAGCAGCTGTTTGGCTTCTTGCGGGAAAACAACCGG
TTATCGTCCTTGGTTACTGACGCGCGGCGCAGGCTGGCGGTCGCAGCTGT
GGTCGAGGCGGCTACGTTCACCGATAGTGACGGAAACACGATAGACACCA
GTGAATTTTTCGGTAAGCATGCCCAAAGCGATAAGGCCGACCAGAAGACC
GAAGAAGCAGATCCGAACAGTGATGCCATCGATGAAGAGGTCGACGAGGC
CGCGGAA
>C6
GTGAAAAGCAGTGTCGAGCAGTTGAACCCTACTCGGGTGCGTATCAACGT
GGAAGTACCTTTTACAGAGCTTGAGCCGGATTTTCAGCGGGCCTACAAAG
AGCTGGCCAGACATGTGCAGCTGCCCGGTTTCCGGCCCGGGAAAGTTCCT
GCGCGATTGCTGGAGGCCCGTTTTGGTCGGGAGACGCTGCTCGATCAGGT
CGTCAACGAAGCCATGCCCAGTCGGTACGGGCAGGCGCTGGCGGAGTCTG
AGGTCCAACCGATCGGCCAGCCCGAAATAGAGGTGATCAGAAAGGAGTAC
GGTCAGGATCTGGCTTTCACCGTCGAAGTTGAGGTACGCCCCAAGATCGC
ACTTCCGGATTTCAGCACATTGAAGGTTGTTGTGGATCCGGTCGAGGTCA
GCACCGATGATGTCGAGGCAGAGTTGCGGTCGTTGCGTGCCAGGTTCGGC
ACTCTGATCGGCGTGGACCGACCTGTGGCGCTCGGTGACTTTGTCTCGAT
TGATTTGTCGGCCACCATCAATGGCGAGAAGGTGCCGAACGCCGATGCGG
AGGGGCTGTCTCATGAGGTCGGCTACGGCCGGCTTATCGCAGGTCTCGAC
GATGCGCTCGTCGGTTTGTCCGCTGGTGAGTCGCGAGTCTTCACCACCCA
GTTAGCGACCAGCAAACACGCCGGGCAAGACGCAGAGGTCATCGTCACCG
TCAAGTCGGTCAAGGAACGCGAATTGCCGGAGCCGGATGACGAATTCGCG
CAACTGGTCAGCGAGTTCGACACCATGGCAGAACTACGGGCCAATCTCGG
GGATCAGGTCCGTAAGGCTAAGTACGCCCAGCAAGCGGAGAAAATCCGTG
ACGCGGCTGTGGACGCTTTGCTCGAGCGGGTAGATGTGCCATTGCCGGAA
GGGATTGTGCAAGCCCAGTTCAATAATGCCCTGCATGACGCGCTCAGCGG
CCTGGGCCACGACGAAGCCAAGTTCGCCGAGGTGCTCGCTGAGCGTGGGT
CGTCGCGCGAGGAGTTCGAGGCTGAAGCGCGTAGCGCTGCCGAGAGAGAT
GTCACGAGGCAACTGCTGTTGGATGTAGTGGCTGACGACCAGAAGATCCA
GGTGGGTCAGGATGACCTGAACAAACGCTTGCTCGCCACGTCTCAGCAAT
ACGGCGTCGACGCACAGCAGCTGTTTGGCTTCTTGCGGGAAAACAACCGG
TTATCGTCCTTGGTTACTGACGCGCGGCGCAGGCTGGCGGTCGCAGCTGT
GGTCGAGGCGGCTACGTTCACCGATAGTGACGGAAACACGATAGACACCA
GTGAATTTTTCGGTAAGCATGCCCAAAGCGATAAGGCCGACCAGAAGACC
GAAGAAGCAGATCCGAACAGTGATGCCATCGATGAAGAGGTCGACGAGGC
CGCGGAA
>C1
VKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVP
ARLLEARFGRETLLDQVVNEAMPSRYGQALAESEVQPIGQPEIEVIRKEY
GQDLAFTVEVEVRPKIALPDFSTLKVVVDPVEVSTDDVEAELRSLRARFG
TLIGVDRPVALGDFVSIDLSATINGEKVPNADAEGLSHEVGYGRLIAGLD
DALVGLSAGESRVFTTQLATSKHAGQDAEVIVTVKSVKERELPEPDDEFA
QLVSEFDTMAELRANLGDQVRKAKYAQQAEKIRDAAVDALLERVDVPLPE
GIVQAQFNNALHDALSGLGHDEAKFAEVLAERGSSREEFEAEARSAAERD
VTRQLLLDVVADDQKIQVGQDDLNERLLATSQQYGVDAQQLFGFLRENNR
LSSLVTDARRRLAVAAVVEAATFTDSDGNTIDTSEFFGKHAQSDKADQKT
EEADPNSDAIDEEVDEAAE
>C2
VKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVP
ARLLEARFGRETLLDQVVNEAMPSRYGQALAESEVQPIGQPEIEVIRKEY
GQDLAFTVEVEVRPKIALPDFSTLKVVVDPVEVSTDDVEAELRSLRARFG
TLIGVDRPVALGDFVSIDLSATINGEKVPNADAEGLSHEVGYGRLIAGLD
DALVGLSAGESRVFTTQLATSKHAGQDAEVIVTVKSVKERELPEPDDEFA
QLVSEFDTMAELRANLGDQVRKAKYAQQAEKIRDAAVDALLERVDVPLPE
GIVQAQFNNALHDALSGLGHDEAKFAEVLAERGSSREEFEAEARSAAERD
VTRQLLLDVVADDQKIQVGQDDLNERLLATSQQYGVDAQQLFGFLRENNR
LSSLVTDARRRLAVAAVVEAATFTDSDGNTIDTSEFFGKHAQSDKADQKT
EEADPNSDAIDEEVDEAAE
>C3
VKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVP
ARLLEARFGRETLLDQVVNEAMPSRYGQALAESEVQPIGQPEIEVIRKEY
GQDLAFTVEVEVRPKIALPDFSTLKVVVDPVEVSTDDVEAELRSLRARFG
TLIGVDRPVALGDFVSIDLSATINGEKVPNADAEGLSHEVGYGRLIAGLD
DALVGLSAGESRVFTTQLATSKHAGQDAEVIVTVKSVKERELPEPDDEFA
QLVSEFDTMAELRANLGDQVRKAKYAQQAEKIRDAAVDALLERVDVPLPE
GIVQAQFNNALHDALSGLGHDEAKFAEVLAERGSSREEFEAEARSAAERD
VTRQLLLDVVADDQKIQVGQDDLNERLLATSQQYGVDAQQLFGFLRENNR
LSSLVTDARRRLAVAAVVEAATFTDSDGNTIDTSEFFGKHAQSDKADQKT
EEADPNSDAIDEEVDEAAE
>C4
VKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVP
ARLLEARFGRETLLDQVVNEAMPSRYGQALAESEVQPIGQPEIEVIRKEY
GQDLAFTVEVEVRPKIALPDFSTLKVVVDPVEVSTDDVEAELRSLRARFG
TLIGVDRPVALGDFVSIDLSATINGEKVPNADAEGLSHEVGYGRLIAGLD
DALVGLSAGESRVFTTQLATSKHAGQDAEVIVTVKSVKERELPEPDDEFA
QLVSEFDTMAELRANLGDQVRKAKYAQQAEKIRDAAVDALLERVDVPLPE
GIVQAQFNNALHDALSGLGHDEAKFAEVLAERGSSREEFEAEARSAAERD
VTRQLLLDVVADDQKIQVGQDDLNERLLATSQQYGVDAQQLFGFLRENNR
LSSLVTDARRRLAVAAVVEAATFTDSDGNTIDTSEFFGKHAQSDKADQKT
EEADPNSDAIDEEVDEAAE
>C5
VKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVP
ARLLEARFGRETLLDQVVNEAMPSRYGQALAESEVQPIGQPEIEVIRKEY
GQDLAFTVEVEVRPKIALPDFSTLKVVVDPVEVSTDDVEAELRSLRARFG
TLIGVDRPVALGDFVSIDLSATINGEKVPNADAEGLSHEVGYGRLIAGLD
DALVGLSAGESRVFTTQLATSKHAGQDAEVIVTVKSVKERELPEPDDEFA
QLVSEFDTMAELRANLGDQVRKAKYAQQAEKIRDAAVDALLERVDVPLPE
GIVQAQFNNALHDALSGLGHDEAKFAEVLAERGSSREEFEAEARSAAERD
VTRQLLLDVVADDQKIQVGQDDLNERLLATSQQYGVDAQQLFGFLRENNR
LSSLVTDARRRLAVAAVVEAATFTDSDGNTIDTSEFFGKHAQSDKADQKT
EEADPNSDAIDEEVDEAAE
>C6
VKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVP
ARLLEARFGRETLLDQVVNEAMPSRYGQALAESEVQPIGQPEIEVIRKEY
GQDLAFTVEVEVRPKIALPDFSTLKVVVDPVEVSTDDVEAELRSLRARFG
TLIGVDRPVALGDFVSIDLSATINGEKVPNADAEGLSHEVGYGRLIAGLD
DALVGLSAGESRVFTTQLATSKHAGQDAEVIVTVKSVKERELPEPDDEFA
QLVSEFDTMAELRANLGDQVRKAKYAQQAEKIRDAAVDALLERVDVPLPE
GIVQAQFNNALHDALSGLGHDEAKFAEVLAERGSSREEFEAEARSAAERD
VTRQLLLDVVADDQKIQVGQDDLNKRLLATSQQYGVDAQQLFGFLRENNR
LSSLVTDARRRLAVAAVVEAATFTDSDGNTIDTSEFFGKHAQSDKADQKT
EEADPNSDAIDEEVDEAAE


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/12res/tig/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1407 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579790070
      Setting output file names to "/data/12res/tig/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 293391245
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0580225555
      Seed = 139701224
      Swapseed = 1579790070
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 5 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -3152.336312 -- -24.965149
         Chain 2 -- -3152.336312 -- -24.965149
         Chain 3 -- -3152.334763 -- -24.965149
         Chain 4 -- -3152.335767 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -3152.334581 -- -24.965149
         Chain 2 -- -3152.334763 -- -24.965149
         Chain 3 -- -3152.336131 -- -24.965149
         Chain 4 -- -3152.336312 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-3152.336] (-3152.336) (-3152.335) (-3152.336) * [-3152.335] (-3152.335) (-3152.336) (-3152.336) 
        500 -- (-1967.975) (-1965.123) [-1961.342] (-1968.229) * (-1947.349) (-1956.593) [-1941.964] (-1956.591) -- 0:00:00
       1000 -- (-1953.960) (-1939.360) [-1955.266] (-1937.656) * [-1942.294] (-1946.386) (-1943.958) (-1961.864) -- 0:00:00
       1500 -- (-1944.313) (-1939.017) (-1942.397) [-1938.873] * [-1941.887] (-1941.032) (-1941.629) (-1956.466) -- 0:00:00
       2000 -- (-1936.098) [-1937.378] (-1942.598) (-1942.084) * [-1934.151] (-1937.696) (-1941.819) (-1945.556) -- 0:08:19
       2500 -- [-1938.426] (-1945.933) (-1938.883) (-1940.864) * [-1939.439] (-1944.035) (-1936.176) (-1938.284) -- 0:06:39
       3000 -- (-1941.324) (-1944.419) (-1936.426) [-1936.247] * (-1935.768) [-1940.487] (-1941.200) (-1942.406) -- 0:05:32
       3500 -- [-1936.073] (-1940.516) (-1944.625) (-1943.021) * (-1937.818) (-1938.270) [-1942.461] (-1956.188) -- 0:04:44
       4000 -- [-1939.709] (-1939.562) (-1942.671) (-1940.081) * [-1938.028] (-1940.567) (-1938.386) (-1948.579) -- 0:04:09
       4500 -- [-1939.341] (-1939.866) (-1949.076) (-1935.060) * [-1938.604] (-1941.240) (-1934.404) (-1953.316) -- 0:03:41
       5000 -- (-1937.945) (-1937.336) [-1939.925] (-1944.587) * (-1947.263) (-1942.517) [-1939.053] (-1939.271) -- 0:03:19

      Average standard deviation of split frequencies: 0.099995

       5500 -- (-1945.005) [-1942.834] (-1941.741) (-1948.765) * (-1938.945) (-1935.911) [-1936.016] (-1944.368) -- 0:03:00
       6000 -- [-1941.071] (-1938.458) (-1938.668) (-1945.215) * (-1939.131) (-1940.018) (-1938.551) [-1936.417] -- 0:02:45
       6500 -- (-1938.883) [-1935.105] (-1948.796) (-1941.750) * [-1938.757] (-1943.161) (-1938.764) (-1940.801) -- 0:02:32
       7000 -- (-1940.791) [-1939.832] (-1937.040) (-1945.842) * [-1937.451] (-1941.376) (-1939.284) (-1937.933) -- 0:02:21
       7500 -- (-1948.591) (-1941.498) (-1940.985) [-1935.024] * (-1940.718) (-1946.604) [-1943.563] (-1939.563) -- 0:02:12
       8000 -- (-1946.680) (-1940.265) (-1937.221) [-1944.975] * [-1937.298] (-1942.521) (-1936.365) (-1950.477) -- 0:02:04
       8500 -- (-1938.513) (-1934.767) (-1939.175) [-1938.558] * [-1936.404] (-1941.017) (-1938.987) (-1940.410) -- 0:01:56
       9000 -- [-1934.183] (-1938.414) (-1950.668) (-1938.583) * (-1939.454) (-1939.068) [-1947.012] (-1940.582) -- 0:01:50
       9500 -- (-1937.607) (-1938.774) [-1937.442] (-1939.076) * [-1941.171] (-1938.841) (-1941.616) (-1937.417) -- 0:01:44
      10000 -- (-1935.100) [-1943.076] (-1942.861) (-1944.766) * (-1949.584) (-1944.767) (-1940.212) [-1940.275] -- 0:01:39

      Average standard deviation of split frequencies: 0.084371

      10500 -- (-1935.816) (-1934.334) (-1941.072) [-1942.527] * (-1945.908) (-1941.107) [-1939.383] (-1935.337) -- 0:01:34
      11000 -- (-1937.027) [-1935.279] (-1942.263) (-1943.848) * (-1941.943) [-1945.173] (-1943.578) (-1934.635) -- 0:01:29
      11500 -- [-1935.978] (-1939.613) (-1943.258) (-1946.851) * (-1943.535) [-1939.425] (-1942.934) (-1937.242) -- 0:01:25
      12000 -- [-1936.838] (-1949.974) (-1945.454) (-1936.961) * (-1938.217) (-1943.992) (-1944.334) [-1937.717] -- 0:01:22
      12500 -- (-1939.800) (-1941.725) [-1947.939] (-1940.136) * [-1940.211] (-1951.252) (-1947.353) (-1935.310) -- 0:01:19
      13000 -- (-1938.331) (-1943.018) (-1947.348) [-1938.857] * (-1941.467) (-1935.674) (-1939.313) [-1934.865] -- 0:01:15
      13500 -- (-1937.249) (-1934.344) [-1941.485] (-1954.656) * [-1935.673] (-1942.009) (-1948.102) (-1933.869) -- 0:01:13
      14000 -- (-1935.873) [-1937.579] (-1942.297) (-1942.217) * (-1936.099) (-1945.380) [-1939.770] (-1935.657) -- 0:02:20
      14500 -- [-1934.485] (-1941.379) (-1943.546) (-1946.935) * [-1939.602] (-1938.898) (-1936.262) (-1937.826) -- 0:02:15
      15000 -- (-1936.037) (-1947.134) (-1944.612) [-1945.699] * (-1941.937) (-1943.428) [-1936.436] (-1936.675) -- 0:02:11

      Average standard deviation of split frequencies: 0.086752

      15500 -- (-1937.931) [-1937.524] (-1945.285) (-1942.316) * [-1941.552] (-1940.353) (-1939.926) (-1936.941) -- 0:02:07
      16000 -- (-1938.969) [-1938.690] (-1941.251) (-1936.798) * (-1944.538) [-1940.017] (-1938.336) (-1934.747) -- 0:02:03
      16500 -- (-1933.784) [-1942.457] (-1943.770) (-1945.881) * [-1941.263] (-1938.639) (-1949.353) (-1936.962) -- 0:01:59
      17000 -- (-1936.309) [-1936.880] (-1944.023) (-1935.940) * [-1932.537] (-1937.885) (-1946.389) (-1938.520) -- 0:01:55
      17500 -- (-1935.370) [-1937.279] (-1936.040) (-1945.458) * [-1942.416] (-1937.188) (-1942.349) (-1935.925) -- 0:01:52
      18000 -- (-1934.346) [-1939.650] (-1943.988) (-1935.457) * [-1937.392] (-1944.084) (-1949.319) (-1936.642) -- 0:01:49
      18500 -- (-1935.188) (-1949.067) [-1940.044] (-1936.522) * (-1939.270) [-1938.587] (-1941.671) (-1939.304) -- 0:01:46
      19000 -- [-1934.588] (-1944.632) (-1938.801) (-1934.826) * (-1944.540) (-1943.290) [-1940.239] (-1936.071) -- 0:01:43
      19500 -- (-1932.180) [-1941.398] (-1944.875) (-1935.764) * (-1937.403) [-1939.948] (-1944.786) (-1936.766) -- 0:01:40
      20000 -- (-1932.736) [-1936.844] (-1943.087) (-1935.847) * (-1939.363) (-1943.853) [-1942.800] (-1936.838) -- 0:01:38

      Average standard deviation of split frequencies: 0.078034

      20500 -- (-1936.520) (-1937.664) [-1940.203] (-1935.152) * (-1942.095) (-1946.458) (-1942.070) [-1936.975] -- 0:01:35
      21000 -- (-1936.163) (-1945.474) (-1938.642) [-1935.097] * (-1944.707) (-1940.844) (-1936.555) [-1934.171] -- 0:01:33
      21500 -- [-1934.383] (-1937.776) (-1945.999) (-1935.396) * (-1938.185) (-1948.783) [-1936.737] (-1937.030) -- 0:01:31
      22000 -- (-1932.090) (-1942.406) (-1937.100) [-1935.418] * (-1947.761) [-1941.237] (-1947.559) (-1935.416) -- 0:01:28
      22500 -- (-1933.857) [-1940.058] (-1943.545) (-1940.014) * (-1939.162) (-1940.831) [-1935.274] (-1937.054) -- 0:01:26
      23000 -- [-1932.897] (-1936.281) (-1943.393) (-1935.556) * (-1939.989) [-1941.146] (-1958.461) (-1937.012) -- 0:01:24
      23500 -- (-1936.114) (-1941.082) [-1937.230] (-1934.879) * (-1942.751) [-1958.872] (-1941.442) (-1936.505) -- 0:01:23
      24000 -- (-1936.433) (-1935.322) (-1944.144) [-1937.895] * (-1937.610) [-1947.481] (-1942.930) (-1934.878) -- 0:01:21
      24500 -- (-1938.605) (-1938.396) [-1946.824] (-1936.526) * (-1941.388) (-1939.764) [-1944.465] (-1935.475) -- 0:01:19
      25000 -- (-1934.593) (-1938.846) (-1944.984) [-1934.829] * (-1940.085) [-1938.633] (-1943.979) (-1937.868) -- 0:01:18

      Average standard deviation of split frequencies: 0.062552

      25500 -- (-1934.414) (-1942.132) (-1941.089) [-1934.015] * [-1941.117] (-1945.919) (-1947.509) (-1936.844) -- 0:01:16
      26000 -- (-1937.591) [-1937.273] (-1942.676) (-1934.280) * [-1938.388] (-1940.858) (-1940.789) (-1938.456) -- 0:01:14
      26500 -- (-1936.515) [-1937.707] (-1938.231) (-1936.014) * [-1935.554] (-1937.784) (-1950.252) (-1938.647) -- 0:01:50
      27000 -- (-1934.363) (-1938.261) [-1948.656] (-1935.902) * (-1942.889) [-1933.481] (-1935.821) (-1937.243) -- 0:01:48
      27500 -- (-1934.802) (-1942.176) [-1938.310] (-1934.841) * (-1945.121) (-1936.232) (-1943.414) [-1935.889] -- 0:01:46
      28000 -- (-1935.564) (-1941.589) (-1943.334) [-1934.948] * (-1942.691) (-1933.816) [-1936.468] (-1935.769) -- 0:01:44
      28500 -- (-1936.236) [-1935.941] (-1945.509) (-1935.283) * (-1948.484) (-1935.177) (-1946.507) [-1932.724] -- 0:01:42
      29000 -- (-1936.427) [-1939.834] (-1936.728) (-1934.718) * (-1942.210) [-1939.960] (-1939.437) (-1935.434) -- 0:01:40
      29500 -- (-1936.542) (-1935.184) (-1946.816) [-1934.817] * [-1947.981] (-1934.472) (-1942.338) (-1935.426) -- 0:01:38
      30000 -- (-1936.459) [-1939.897] (-1944.581) (-1935.834) * [-1944.707] (-1935.273) (-1942.332) (-1934.670) -- 0:01:37

      Average standard deviation of split frequencies: 0.051496

      30500 -- (-1937.931) [-1936.865] (-1940.677) (-1935.677) * (-1944.293) (-1937.067) [-1938.861] (-1934.562) -- 0:01:35
      31000 -- (-1934.807) (-1941.682) [-1939.964] (-1934.522) * (-1954.244) (-1936.797) [-1937.561] (-1939.174) -- 0:01:33
      31500 -- [-1934.769] (-1955.203) (-1944.611) (-1936.529) * [-1936.841] (-1935.954) (-1945.183) (-1937.515) -- 0:01:32
      32000 -- (-1936.214) (-1944.412) [-1946.030] (-1936.166) * [-1947.478] (-1934.784) (-1940.087) (-1933.911) -- 0:01:30
      32500 -- (-1935.094) (-1936.407) [-1942.950] (-1934.500) * (-1945.280) [-1936.312] (-1940.382) (-1936.119) -- 0:01:29
      33000 -- (-1932.696) (-1939.544) [-1945.442] (-1937.589) * (-1955.351) (-1935.156) [-1936.389] (-1934.695) -- 0:01:27
      33500 -- [-1934.092] (-1944.994) (-1942.120) (-1937.191) * [-1945.138] (-1935.410) (-1948.704) (-1935.050) -- 0:01:26
      34000 -- (-1933.456) (-1947.553) (-1940.028) [-1936.654] * (-1936.981) (-1935.692) [-1947.302] (-1938.015) -- 0:01:25
      34500 -- [-1936.905] (-1946.807) (-1948.416) (-1935.892) * (-1939.889) (-1936.379) (-1934.758) [-1936.118] -- 0:01:23
      35000 -- [-1935.875] (-1949.143) (-1942.939) (-1934.893) * (-1947.454) (-1935.616) (-1933.438) [-1938.496] -- 0:01:22

      Average standard deviation of split frequencies: 0.045486

      35500 -- (-1936.680) (-1941.035) [-1942.071] (-1938.435) * (-1945.656) (-1935.042) [-1933.808] (-1938.750) -- 0:01:21
      36000 -- (-1936.262) (-1942.771) (-1946.774) [-1935.276] * (-1946.068) (-1933.214) [-1935.190] (-1934.427) -- 0:01:20
      36500 -- (-1933.606) (-1943.536) [-1939.290] (-1934.687) * (-1939.146) [-1935.465] (-1937.148) (-1936.720) -- 0:01:19
      37000 -- (-1932.274) [-1938.281] (-1938.233) (-1935.695) * (-1949.381) (-1933.649) (-1935.339) [-1939.911] -- 0:01:18
      37500 -- (-1933.728) (-1938.166) [-1942.512] (-1937.156) * (-1940.327) (-1937.538) [-1935.485] (-1937.155) -- 0:01:17
      38000 -- (-1934.075) (-1940.676) [-1936.474] (-1935.556) * (-1944.647) (-1935.703) (-1935.752) [-1932.994] -- 0:01:15
      38500 -- (-1934.354) (-1937.050) (-1941.082) [-1934.663] * (-1941.888) [-1935.999] (-1938.159) (-1936.411) -- 0:01:14
      39000 -- [-1935.955] (-1951.396) (-1935.760) (-1937.769) * [-1942.568] (-1934.701) (-1935.733) (-1935.848) -- 0:01:13
      39500 -- (-1935.079) [-1939.553] (-1944.767) (-1938.705) * [-1939.364] (-1935.347) (-1937.476) (-1935.510) -- 0:01:12
      40000 -- [-1933.696] (-1938.374) (-1943.824) (-1937.541) * [-1940.768] (-1935.688) (-1934.672) (-1933.058) -- 0:01:36

      Average standard deviation of split frequencies: 0.045208

      40500 -- (-1933.008) [-1939.250] (-1940.699) (-1942.273) * [-1939.718] (-1936.070) (-1940.968) (-1935.247) -- 0:01:34
      41000 -- [-1934.349] (-1942.998) (-1943.570) (-1937.769) * (-1945.409) [-1936.287] (-1938.135) (-1935.893) -- 0:01:33
      41500 -- [-1934.340] (-1939.750) (-1941.306) (-1936.305) * (-1934.353) (-1936.438) [-1938.419] (-1935.045) -- 0:01:32
      42000 -- (-1934.969) [-1939.196] (-1940.773) (-1938.770) * (-1935.467) [-1935.843] (-1935.877) (-1934.758) -- 0:01:31
      42500 -- (-1935.526) (-1940.897) [-1933.676] (-1936.263) * (-1939.305) [-1936.840] (-1937.265) (-1935.767) -- 0:01:30
      43000 -- (-1934.507) (-1941.004) [-1938.132] (-1936.969) * [-1937.798] (-1937.366) (-1936.160) (-1934.875) -- 0:01:29
      43500 -- (-1935.520) [-1938.698] (-1939.681) (-1935.674) * [-1937.610] (-1934.978) (-1936.497) (-1936.879) -- 0:01:27
      44000 -- (-1937.400) [-1937.281] (-1942.761) (-1935.994) * [-1938.009] (-1936.928) (-1939.793) (-1936.838) -- 0:01:26
      44500 -- (-1935.339) [-1938.416] (-1941.909) (-1936.954) * (-1937.853) (-1937.108) (-1934.957) [-1936.804] -- 0:01:25
      45000 -- (-1933.894) [-1939.721] (-1936.231) (-1936.490) * (-1941.160) (-1936.500) [-1935.951] (-1941.958) -- 0:01:24

      Average standard deviation of split frequencies: 0.041968

      45500 -- (-1935.975) [-1937.460] (-1943.642) (-1937.715) * (-1936.750) (-1934.998) [-1937.373] (-1938.066) -- 0:01:23
      46000 -- (-1935.984) [-1937.612] (-1939.741) (-1937.233) * (-1936.677) (-1936.545) (-1934.155) [-1937.490] -- 0:01:22
      46500 -- (-1937.553) [-1935.334] (-1949.292) (-1939.905) * [-1936.307] (-1934.944) (-1937.068) (-1934.716) -- 0:01:22
      47000 -- (-1935.714) (-1943.488) (-1938.574) [-1938.010] * [-1936.629] (-1934.210) (-1939.099) (-1938.934) -- 0:01:21
      47500 -- (-1935.202) (-1939.421) [-1941.516] (-1937.403) * (-1934.480) [-1933.677] (-1937.163) (-1935.790) -- 0:01:20
      48000 -- (-1934.588) (-1942.326) (-1944.619) [-1935.591] * (-1935.258) (-1935.957) [-1933.688] (-1935.244) -- 0:01:19
      48500 -- (-1933.330) (-1944.326) (-1942.479) [-1935.057] * (-1938.437) [-1937.154] (-1934.470) (-1938.408) -- 0:01:18
      49000 -- (-1934.022) [-1942.053] (-1944.283) (-1935.036) * (-1939.826) [-1937.619] (-1934.644) (-1935.258) -- 0:01:17
      49500 -- (-1933.734) (-1938.641) [-1938.726] (-1935.076) * (-1936.095) (-1933.636) (-1933.903) [-1939.946] -- 0:01:16
      50000 -- [-1934.155] (-1938.522) (-1937.297) (-1936.505) * (-1935.389) (-1935.065) (-1936.112) [-1937.398] -- 0:01:16

      Average standard deviation of split frequencies: 0.036773

      50500 -- (-1934.916) (-1942.302) [-1939.155] (-1938.402) * (-1935.056) [-1934.538] (-1936.052) (-1936.345) -- 0:01:15
      51000 -- (-1934.355) (-1941.618) (-1943.500) [-1935.693] * (-1936.254) [-1935.374] (-1935.905) (-1938.211) -- 0:01:14
      51500 -- (-1935.705) [-1935.729] (-1939.769) (-1935.553) * (-1942.208) (-1936.172) (-1935.076) [-1935.858] -- 0:01:13
      52000 -- (-1935.815) (-1939.237) (-1935.512) [-1935.620] * (-1940.102) (-1938.204) [-1935.944] (-1936.912) -- 0:01:12
      52500 -- (-1935.040) (-1949.116) [-1942.926] (-1933.453) * (-1940.840) (-1935.543) (-1936.449) [-1938.387] -- 0:01:12
      53000 -- (-1935.661) (-1941.837) [-1939.839] (-1934.950) * (-1939.496) (-1937.394) (-1936.762) [-1934.958] -- 0:01:11
      53500 -- (-1936.455) [-1941.825] (-1948.392) (-1934.992) * (-1935.563) [-1934.253] (-1935.226) (-1936.048) -- 0:01:28
      54000 -- (-1937.258) (-1938.856) (-1935.789) [-1934.634] * (-1938.865) [-1932.991] (-1933.458) (-1937.086) -- 0:01:27
      54500 -- (-1935.601) (-1940.092) [-1940.324] (-1935.836) * (-1939.165) (-1935.315) (-1933.968) [-1935.998] -- 0:01:26
      55000 -- [-1937.537] (-1950.680) (-1938.255) (-1934.848) * (-1939.676) [-1934.618] (-1937.201) (-1934.613) -- 0:01:25

      Average standard deviation of split frequencies: 0.035275

      55500 -- (-1934.445) (-1947.273) (-1938.726) [-1935.487] * (-1936.094) [-1934.260] (-1935.302) (-1937.838) -- 0:01:25
      56000 -- (-1933.835) (-1940.643) [-1940.829] (-1935.738) * [-1936.832] (-1933.345) (-1935.972) (-1939.210) -- 0:01:24
      56500 -- (-1936.617) (-1944.890) [-1940.749] (-1936.547) * [-1936.398] (-1941.282) (-1937.059) (-1937.681) -- 0:01:23
      57000 -- (-1939.000) (-1935.864) [-1942.785] (-1935.154) * (-1934.292) [-1935.953] (-1934.846) (-1940.642) -- 0:01:22
      57500 -- (-1938.927) [-1935.908] (-1943.736) (-1934.047) * [-1934.131] (-1937.233) (-1936.882) (-1939.129) -- 0:01:21
      58000 -- (-1936.653) [-1934.308] (-1942.778) (-1934.934) * (-1934.810) (-1936.677) (-1936.576) [-1936.418] -- 0:01:21
      58500 -- (-1936.898) [-1936.494] (-1941.454) (-1938.154) * (-1935.604) (-1935.090) (-1935.743) [-1936.084] -- 0:01:20
      59000 -- (-1939.909) [-1933.835] (-1947.392) (-1937.719) * (-1936.160) (-1934.206) (-1937.486) [-1936.828] -- 0:01:19
      59500 -- (-1935.296) (-1934.845) [-1943.732] (-1936.751) * (-1936.032) (-1934.566) (-1933.284) [-1934.850] -- 0:01:19
      60000 -- (-1935.610) (-1935.519) [-1939.225] (-1935.406) * (-1935.297) (-1936.427) [-1934.853] (-1935.354) -- 0:01:18

      Average standard deviation of split frequencies: 0.029916

      60500 -- (-1937.469) (-1935.220) [-1938.655] (-1934.298) * (-1934.873) (-1934.750) [-1935.104] (-1936.714) -- 0:01:17
      61000 -- (-1934.858) [-1934.790] (-1946.601) (-1937.828) * (-1936.736) [-1935.464] (-1935.681) (-1935.486) -- 0:01:16
      61500 -- (-1935.911) (-1935.446) (-1939.135) [-1934.070] * (-1934.779) (-1935.133) (-1935.335) [-1935.623] -- 0:01:16
      62000 -- [-1933.242] (-1936.421) (-1940.644) (-1934.004) * (-1934.820) [-1935.339] (-1933.813) (-1934.242) -- 0:01:15
      62500 -- (-1938.142) [-1936.012] (-1939.040) (-1935.297) * (-1936.046) (-1937.407) (-1934.441) [-1934.206] -- 0:01:15
      63000 -- (-1937.740) (-1937.675) [-1941.016] (-1937.051) * (-1938.919) (-1937.263) (-1935.907) [-1937.467] -- 0:01:14
      63500 -- (-1935.490) (-1939.573) (-1941.158) [-1935.520] * (-1935.541) (-1936.538) (-1933.482) [-1943.911] -- 0:01:13
      64000 -- (-1937.766) (-1935.564) [-1940.935] (-1935.483) * [-1934.941] (-1935.173) (-1934.786) (-1939.299) -- 0:01:13
      64500 -- (-1935.215) (-1935.181) [-1937.784] (-1934.658) * (-1937.178) (-1934.960) [-1934.313] (-1936.699) -- 0:01:12
      65000 -- (-1934.740) (-1936.978) [-1945.528] (-1933.906) * (-1936.784) (-1934.879) [-1934.687] (-1936.779) -- 0:01:11

      Average standard deviation of split frequencies: 0.028927

      65500 -- [-1935.578] (-1935.031) (-1943.430) (-1935.279) * (-1936.516) (-1936.911) (-1933.732) [-1936.039] -- 0:01:11
      66000 -- [-1934.937] (-1935.283) (-1939.793) (-1935.011) * [-1936.967] (-1936.363) (-1935.017) (-1934.823) -- 0:01:10
      66500 -- (-1933.944) [-1936.608] (-1941.998) (-1935.257) * (-1936.803) [-1936.347] (-1935.236) (-1934.261) -- 0:01:10
      67000 -- (-1934.535) [-1938.529] (-1942.746) (-1935.670) * (-1934.893) (-1938.937) (-1941.282) [-1935.696] -- 0:01:09
      67500 -- (-1935.923) (-1935.377) [-1943.422] (-1937.047) * (-1936.240) [-1937.266] (-1939.042) (-1937.391) -- 0:01:09
      68000 -- (-1934.393) (-1935.356) (-1940.496) [-1938.811] * (-1938.293) (-1939.143) [-1938.084] (-1935.366) -- 0:01:22
      68500 -- (-1933.961) [-1935.331] (-1942.172) (-1935.859) * [-1935.515] (-1940.506) (-1947.861) (-1937.424) -- 0:01:21
      69000 -- [-1934.450] (-1937.036) (-1938.789) (-1935.785) * (-1938.198) [-1933.314] (-1936.743) (-1935.878) -- 0:01:20
      69500 -- (-1937.268) (-1935.937) (-1935.261) [-1934.726] * (-1935.696) (-1933.235) [-1933.584] (-1938.781) -- 0:01:20
      70000 -- (-1938.478) [-1935.031] (-1935.040) (-1937.620) * [-1936.476] (-1933.990) (-1936.241) (-1937.508) -- 0:01:19

      Average standard deviation of split frequencies: 0.028272

      70500 -- [-1937.078] (-1937.414) (-1937.808) (-1937.386) * (-1937.454) (-1934.006) (-1936.667) [-1935.509] -- 0:01:19
      71000 -- (-1939.056) (-1938.350) (-1940.578) [-1936.540] * (-1941.837) [-1934.914] (-1937.177) (-1935.669) -- 0:01:18
      71500 -- [-1936.195] (-1937.136) (-1938.903) (-1938.568) * [-1934.223] (-1935.643) (-1936.642) (-1940.036) -- 0:01:17
      72000 -- (-1935.157) [-1936.909] (-1937.320) (-1936.313) * [-1937.027] (-1936.767) (-1934.495) (-1937.761) -- 0:01:17
      72500 -- (-1937.615) (-1937.106) [-1935.481] (-1935.000) * (-1937.660) [-1937.291] (-1938.248) (-1938.089) -- 0:01:16
      73000 -- [-1937.585] (-1935.845) (-1934.668) (-1936.180) * (-1936.449) (-1936.317) (-1938.807) [-1937.099] -- 0:01:16
      73500 -- [-1935.594] (-1936.059) (-1933.652) (-1936.107) * (-1935.187) (-1935.923) [-1934.211] (-1935.391) -- 0:01:15
      74000 -- (-1936.065) (-1938.311) [-1935.079] (-1938.376) * (-1937.111) [-1937.387] (-1933.683) (-1936.204) -- 0:01:15
      74500 -- [-1936.140] (-1936.987) (-1935.288) (-1939.861) * (-1937.859) (-1935.019) [-1937.236] (-1936.166) -- 0:01:14
      75000 -- [-1935.125] (-1936.032) (-1935.460) (-1938.716) * [-1936.829] (-1935.043) (-1936.675) (-1936.595) -- 0:01:14

      Average standard deviation of split frequencies: 0.028060

      75500 -- (-1938.452) (-1935.187) [-1935.546] (-1934.912) * [-1937.836] (-1934.888) (-1935.023) (-1934.431) -- 0:01:13
      76000 -- (-1937.105) (-1936.497) (-1935.546) [-1936.880] * (-1935.711) (-1933.841) (-1939.649) [-1933.671] -- 0:01:12
      76500 -- (-1937.250) (-1935.725) [-1935.856] (-1934.894) * (-1936.908) (-1938.433) (-1939.757) [-1936.104] -- 0:01:12
      77000 -- (-1936.139) [-1939.333] (-1940.747) (-1938.349) * (-1938.400) (-1938.994) (-1938.648) [-1935.088] -- 0:01:11
      77500 -- [-1934.937] (-1935.289) (-1936.782) (-1936.762) * (-1940.247) [-1937.869] (-1932.898) (-1935.108) -- 0:01:11
      78000 -- [-1934.370] (-1938.589) (-1941.245) (-1939.114) * (-1936.641) [-1938.259] (-1934.140) (-1934.811) -- 0:01:10
      78500 -- (-1936.467) (-1936.027) (-1937.845) [-1939.013] * (-1934.906) (-1933.430) [-1934.589] (-1934.770) -- 0:01:10
      79000 -- [-1935.808] (-1935.433) (-1937.312) (-1934.258) * (-1936.532) (-1935.810) [-1933.220] (-1934.616) -- 0:01:09
      79500 -- [-1934.961] (-1935.125) (-1937.576) (-1935.634) * (-1936.819) (-1935.163) [-1936.814] (-1937.690) -- 0:01:09
      80000 -- (-1935.908) (-1937.642) (-1935.958) [-1935.229] * (-1935.326) [-1938.531] (-1939.095) (-1937.581) -- 0:01:09

      Average standard deviation of split frequencies: 0.027550

      80500 -- [-1935.212] (-1936.890) (-1935.660) (-1936.250) * (-1936.583) [-1935.255] (-1938.270) (-1937.003) -- 0:01:08
      81000 -- (-1935.552) (-1937.568) (-1937.551) [-1935.430] * (-1936.562) (-1934.277) (-1934.295) [-1937.447] -- 0:01:08
      81500 -- [-1935.186] (-1935.901) (-1938.724) (-1934.222) * [-1938.127] (-1933.871) (-1934.224) (-1936.724) -- 0:01:07
      82000 -- (-1934.724) (-1936.987) (-1935.639) [-1934.829] * (-1936.451) [-1934.087] (-1937.283) (-1934.798) -- 0:01:18
      82500 -- (-1935.747) (-1941.153) [-1935.585] (-1936.827) * (-1937.521) [-1934.979] (-1939.708) (-1936.322) -- 0:01:17
      83000 -- (-1944.626) (-1939.894) (-1939.497) [-1936.296] * (-1937.581) (-1934.490) (-1933.442) [-1935.747] -- 0:01:17
      83500 -- (-1936.508) (-1939.650) [-1937.032] (-1935.520) * (-1940.677) (-1934.752) [-1934.319] (-1938.134) -- 0:01:16
      84000 -- [-1935.164] (-1935.436) (-1936.109) (-1937.842) * [-1936.805] (-1935.839) (-1935.758) (-1937.183) -- 0:01:16
      84500 -- (-1936.047) (-1936.803) [-1932.411] (-1938.710) * [-1938.356] (-1944.601) (-1935.422) (-1935.909) -- 0:01:15
      85000 -- (-1936.741) (-1937.855) (-1937.005) [-1935.387] * (-1936.829) [-1936.376] (-1935.187) (-1936.179) -- 0:01:15

      Average standard deviation of split frequencies: 0.026102

      85500 -- (-1935.482) [-1936.458] (-1934.100) (-1937.327) * (-1935.982) [-1936.275] (-1937.502) (-1937.709) -- 0:01:14
      86000 -- [-1935.041] (-1936.055) (-1938.485) (-1934.982) * [-1935.262] (-1934.404) (-1934.214) (-1939.223) -- 0:01:14
      86500 -- [-1936.740] (-1936.250) (-1938.093) (-1935.238) * [-1934.628] (-1935.050) (-1934.611) (-1939.116) -- 0:01:13
      87000 -- [-1937.012] (-1935.318) (-1938.143) (-1939.966) * [-1935.084] (-1934.475) (-1934.359) (-1936.408) -- 0:01:13
      87500 -- (-1936.726) (-1937.265) [-1936.350] (-1935.044) * (-1935.556) [-1942.109] (-1935.078) (-1934.519) -- 0:01:13
      88000 -- [-1935.342] (-1935.736) (-1936.344) (-1935.721) * (-1935.567) (-1936.604) [-1934.200] (-1932.851) -- 0:01:12
      88500 -- (-1935.006) (-1937.683) [-1936.047] (-1934.534) * (-1934.983) (-1935.976) [-1933.813] (-1938.981) -- 0:01:12
      89000 -- (-1934.978) (-1938.393) [-1935.118] (-1934.550) * (-1938.227) [-1934.681] (-1934.671) (-1937.610) -- 0:01:11
      89500 -- (-1936.757) (-1935.946) [-1932.094] (-1935.212) * [-1936.868] (-1936.304) (-1934.001) (-1935.852) -- 0:01:11
      90000 -- [-1934.012] (-1934.609) (-1935.915) (-1935.913) * [-1935.068] (-1936.103) (-1934.588) (-1935.340) -- 0:01:10

      Average standard deviation of split frequencies: 0.025217

      90500 -- (-1939.385) (-1942.898) [-1933.568] (-1935.235) * (-1935.642) (-1934.834) (-1932.684) [-1934.873] -- 0:01:10
      91000 -- (-1936.849) (-1938.470) [-1934.643] (-1933.851) * (-1935.642) (-1937.312) [-1934.850] (-1935.666) -- 0:01:09
      91500 -- [-1938.471] (-1935.668) (-1933.702) (-1936.155) * [-1936.923] (-1941.177) (-1934.904) (-1934.810) -- 0:01:09
      92000 -- (-1934.301) [-1936.154] (-1935.969) (-1934.841) * (-1934.759) (-1935.089) [-1932.599] (-1935.731) -- 0:01:09
      92500 -- (-1934.513) [-1937.343] (-1935.910) (-1936.432) * (-1934.681) (-1935.462) [-1934.097] (-1940.084) -- 0:01:08
      93000 -- (-1936.216) (-1935.909) (-1935.928) [-1935.175] * (-1935.332) [-1936.933] (-1932.643) (-1936.173) -- 0:01:08
      93500 -- (-1938.542) [-1933.827] (-1934.633) (-1936.947) * [-1938.991] (-1936.969) (-1935.848) (-1937.314) -- 0:01:07
      94000 -- [-1933.851] (-1935.813) (-1934.288) (-1936.296) * (-1937.940) [-1936.775] (-1936.535) (-1937.375) -- 0:01:07
      94500 -- [-1932.674] (-1936.776) (-1933.653) (-1934.616) * (-1936.307) [-1934.677] (-1937.609) (-1934.270) -- 0:01:07
      95000 -- [-1934.042] (-1935.747) (-1936.761) (-1935.343) * (-1937.952) (-1939.963) (-1937.027) [-1934.668] -- 0:01:06

      Average standard deviation of split frequencies: 0.020869

      95500 -- (-1936.341) [-1935.030] (-1936.801) (-1936.343) * (-1936.979) (-1938.397) (-1935.115) [-1934.662] -- 0:01:06
      96000 -- (-1941.411) (-1935.551) (-1936.119) [-1935.180] * (-1936.169) (-1936.445) [-1934.923] (-1934.204) -- 0:01:05
      96500 -- (-1940.339) (-1936.243) (-1935.733) [-1932.675] * (-1936.923) (-1938.605) [-1935.026] (-1936.172) -- 0:01:14
      97000 -- (-1938.307) (-1936.096) (-1934.907) [-1934.719] * (-1937.650) (-1935.632) (-1938.617) [-1937.756] -- 0:01:14
      97500 -- (-1940.458) (-1933.881) [-1935.954] (-1935.983) * (-1937.080) (-1936.271) [-1936.455] (-1938.089) -- 0:01:14
      98000 -- (-1936.228) (-1936.740) (-1938.817) [-1935.122] * [-1935.481] (-1932.938) (-1935.123) (-1939.147) -- 0:01:13
      98500 -- (-1935.970) (-1934.581) [-1935.398] (-1936.431) * (-1935.268) [-1934.577] (-1935.232) (-1936.456) -- 0:01:13
      99000 -- (-1935.247) [-1934.225] (-1936.435) (-1943.826) * (-1935.780) (-1937.515) (-1936.822) [-1936.490] -- 0:01:12
      99500 -- (-1937.150) (-1935.910) (-1935.953) [-1938.219] * (-1936.460) (-1939.948) (-1935.130) [-1933.730] -- 0:01:12
      100000 -- (-1937.795) [-1936.264] (-1936.521) (-1939.043) * [-1936.312] (-1935.648) (-1935.459) (-1933.659) -- 0:01:12

      Average standard deviation of split frequencies: 0.019434

      100500 -- (-1935.149) (-1935.200) [-1936.107] (-1934.694) * [-1934.944] (-1935.806) (-1936.503) (-1935.380) -- 0:01:11
      101000 -- [-1935.852] (-1936.071) (-1934.669) (-1935.335) * (-1934.696) [-1937.111] (-1934.121) (-1934.102) -- 0:01:11
      101500 -- [-1934.848] (-1939.611) (-1934.370) (-1935.933) * (-1934.527) (-1938.540) [-1933.377] (-1934.279) -- 0:01:10
      102000 -- (-1935.013) (-1943.237) [-1938.005] (-1937.643) * (-1935.019) (-1938.286) (-1934.863) [-1933.005] -- 0:01:10
      102500 -- (-1935.971) [-1936.715] (-1937.131) (-1938.740) * (-1935.680) (-1940.685) (-1936.209) [-1936.284] -- 0:01:10
      103000 -- [-1937.311] (-1936.820) (-1934.322) (-1937.875) * [-1935.477] (-1935.712) (-1934.592) (-1935.505) -- 0:01:09
      103500 -- (-1935.952) [-1936.548] (-1934.824) (-1935.236) * (-1936.585) (-1939.123) (-1936.634) [-1935.553] -- 0:01:09
      104000 -- [-1934.953] (-1936.231) (-1936.319) (-1936.270) * (-1935.823) (-1934.457) [-1933.798] (-1935.762) -- 0:01:08
      104500 -- [-1935.958] (-1937.108) (-1934.163) (-1941.787) * (-1935.519) (-1935.209) (-1936.766) [-1934.951] -- 0:01:08
      105000 -- (-1936.120) (-1934.970) [-1934.807] (-1938.215) * (-1935.820) (-1941.790) (-1935.103) [-1935.579] -- 0:01:08

      Average standard deviation of split frequencies: 0.018678

      105500 -- (-1935.833) [-1934.062] (-1937.532) (-1935.822) * [-1937.266] (-1941.488) (-1934.284) (-1937.428) -- 0:01:07
      106000 -- (-1935.554) (-1938.141) [-1935.243] (-1934.183) * (-1936.965) (-1936.819) (-1938.113) [-1937.492] -- 0:01:07
      106500 -- [-1935.705] (-1934.830) (-1934.695) (-1932.631) * (-1935.767) (-1938.831) [-1936.507] (-1937.949) -- 0:01:07
      107000 -- (-1934.644) (-1935.055) [-1935.051] (-1933.787) * (-1936.447) [-1938.829] (-1935.676) (-1936.783) -- 0:01:06
      107500 -- (-1934.892) (-1934.414) [-1934.067] (-1935.438) * (-1934.343) (-1941.050) [-1936.663] (-1937.699) -- 0:01:06
      108000 -- (-1934.439) (-1935.907) (-1933.750) [-1935.914] * (-1935.047) [-1938.400] (-1936.170) (-1939.168) -- 0:01:06
      108500 -- (-1936.552) [-1938.939] (-1934.206) (-1936.513) * [-1935.612] (-1940.129) (-1935.544) (-1939.203) -- 0:01:05
      109000 -- [-1939.042] (-1935.767) (-1934.129) (-1935.842) * (-1940.667) (-1933.894) [-1935.264] (-1938.055) -- 0:01:05
      109500 -- [-1936.065] (-1936.453) (-1933.810) (-1935.895) * (-1942.656) [-1936.195] (-1935.341) (-1936.128) -- 0:01:05
      110000 -- (-1934.938) (-1936.718) (-1933.251) [-1935.379] * [-1938.220] (-1935.773) (-1935.954) (-1935.126) -- 0:01:04

      Average standard deviation of split frequencies: 0.017985

      110500 -- (-1933.486) (-1935.723) [-1933.191] (-1935.359) * (-1939.698) (-1935.773) (-1937.264) [-1936.072] -- 0:01:04
      111000 -- (-1936.380) [-1935.814] (-1934.384) (-1938.170) * (-1941.089) [-1936.162] (-1935.151) (-1935.288) -- 0:01:12
      111500 -- (-1935.852) (-1935.610) [-1940.203] (-1936.104) * [-1935.828] (-1937.485) (-1936.673) (-1940.322) -- 0:01:11
      112000 -- (-1934.455) (-1933.790) [-1936.276] (-1934.990) * [-1935.482] (-1940.004) (-1936.505) (-1939.021) -- 0:01:11
      112500 -- (-1934.582) (-1935.405) [-1939.112] (-1935.736) * (-1934.930) [-1937.141] (-1936.857) (-1938.766) -- 0:01:11
      113000 -- (-1936.229) (-1934.943) (-1937.157) [-1934.230] * (-1935.903) (-1935.682) [-1936.128] (-1938.824) -- 0:01:10
      113500 -- (-1934.775) (-1935.927) [-1935.122] (-1935.439) * [-1937.822] (-1936.539) (-1935.660) (-1938.673) -- 0:01:10
      114000 -- (-1934.925) [-1938.456] (-1935.633) (-1936.705) * (-1935.147) (-1937.789) [-1936.282] (-1934.922) -- 0:01:09
      114500 -- [-1934.525] (-1938.124) (-1932.639) (-1934.740) * (-1934.641) (-1935.736) [-1935.778] (-1934.743) -- 0:01:09
      115000 -- [-1934.108] (-1935.985) (-1938.817) (-1933.016) * [-1933.854] (-1934.767) (-1936.298) (-1936.310) -- 0:01:09

      Average standard deviation of split frequencies: 0.018513

      115500 -- (-1935.726) (-1936.609) [-1938.701] (-1934.731) * (-1935.539) [-1935.021] (-1935.508) (-1935.106) -- 0:01:08
      116000 -- (-1937.820) (-1935.966) [-1938.691] (-1935.502) * (-1935.901) (-1936.751) [-1934.981] (-1935.845) -- 0:01:08
      116500 -- (-1936.663) [-1941.976] (-1942.135) (-1935.688) * (-1936.278) [-1936.074] (-1941.922) (-1934.976) -- 0:01:08
      117000 -- [-1934.699] (-1936.559) (-1935.912) (-1938.620) * (-1937.652) [-1935.501] (-1936.302) (-1934.025) -- 0:01:07
      117500 -- (-1935.582) [-1937.692] (-1934.087) (-1939.701) * [-1937.797] (-1938.965) (-1934.954) (-1934.243) -- 0:01:07
      118000 -- (-1933.295) (-1937.863) [-1932.174] (-1935.304) * (-1937.332) [-1934.099] (-1935.741) (-1934.286) -- 0:01:07
      118500 -- [-1934.930] (-1937.594) (-1933.528) (-1933.295) * (-1941.853) (-1943.890) [-1936.835] (-1935.810) -- 0:01:06
      119000 -- (-1934.852) (-1934.885) [-1932.773] (-1935.911) * (-1938.823) [-1935.562] (-1936.861) (-1934.134) -- 0:01:06
      119500 -- [-1934.459] (-1935.915) (-1935.990) (-1934.655) * [-1935.902] (-1937.519) (-1938.436) (-1934.189) -- 0:01:06
      120000 -- (-1935.200) [-1936.960] (-1935.782) (-1936.479) * (-1940.599) [-1934.848] (-1935.968) (-1934.728) -- 0:01:06

      Average standard deviation of split frequencies: 0.021372

      120500 -- (-1933.991) [-1933.921] (-1939.372) (-1935.824) * (-1939.527) (-1937.664) [-1936.930] (-1935.639) -- 0:01:05
      121000 -- (-1936.905) (-1935.164) (-1937.149) [-1935.224] * [-1937.921] (-1942.865) (-1936.800) (-1938.648) -- 0:01:05
      121500 -- (-1935.433) [-1934.470] (-1937.785) (-1934.631) * (-1935.531) (-1944.671) (-1935.655) [-1936.413] -- 0:01:05
      122000 -- [-1937.197] (-1934.624) (-1935.341) (-1933.877) * (-1936.709) (-1940.257) [-1936.288] (-1934.863) -- 0:01:04
      122500 -- [-1936.175] (-1938.307) (-1934.975) (-1935.164) * [-1935.974] (-1933.978) (-1935.857) (-1937.997) -- 0:01:04
      123000 -- (-1937.699) (-1942.751) [-1935.099] (-1934.532) * (-1936.418) (-1935.242) (-1936.239) [-1933.841] -- 0:01:04
      123500 -- (-1936.654) [-1936.175] (-1933.915) (-1936.363) * (-1938.832) [-1935.586] (-1935.847) (-1941.914) -- 0:01:03
      124000 -- (-1938.009) (-1935.655) [-1935.135] (-1934.031) * (-1937.757) [-1934.499] (-1935.175) (-1935.702) -- 0:01:03
      124500 -- (-1936.098) (-1933.801) (-1935.762) [-1935.277] * (-1940.095) (-1935.644) (-1935.177) [-1936.343] -- 0:01:03
      125000 -- [-1937.600] (-1938.642) (-1938.503) (-1934.561) * (-1936.997) (-1934.074) (-1935.773) [-1935.215] -- 0:01:10

      Average standard deviation of split frequencies: 0.019829

      125500 -- (-1937.745) (-1939.318) (-1936.306) [-1937.485] * (-1937.438) [-1933.490] (-1938.091) (-1935.442) -- 0:01:09
      126000 -- (-1936.493) [-1934.555] (-1936.428) (-1933.872) * (-1939.485) (-1936.422) [-1935.694] (-1938.480) -- 0:01:09
      126500 -- (-1934.850) [-1934.606] (-1934.657) (-1938.239) * (-1935.704) (-1934.732) (-1935.077) [-1938.768] -- 0:01:09
      127000 -- [-1936.468] (-1936.458) (-1936.637) (-1936.847) * (-1935.207) [-1936.818] (-1936.497) (-1939.976) -- 0:01:08
      127500 -- (-1935.725) (-1940.230) (-1935.211) [-1936.996] * (-1934.651) (-1935.274) (-1936.332) [-1934.452] -- 0:01:08
      128000 -- [-1935.637] (-1937.644) (-1934.594) (-1935.315) * (-1933.904) (-1935.588) (-1936.549) [-1934.723] -- 0:01:08
      128500 -- [-1935.590] (-1942.307) (-1934.738) (-1935.119) * (-1936.455) [-1936.631] (-1936.817) (-1935.245) -- 0:01:07
      129000 -- (-1934.849) [-1937.582] (-1934.955) (-1937.230) * [-1936.494] (-1937.512) (-1940.476) (-1938.515) -- 0:01:07
      129500 -- (-1936.101) (-1939.308) (-1935.214) [-1935.596] * (-1936.687) (-1936.000) [-1938.221] (-1938.431) -- 0:01:07
      130000 -- [-1934.386] (-1937.631) (-1934.834) (-1935.924) * (-1937.910) [-1937.340] (-1935.078) (-1936.533) -- 0:01:06

      Average standard deviation of split frequencies: 0.020507

      130500 -- (-1934.661) (-1939.215) [-1933.413] (-1934.647) * [-1939.639] (-1935.814) (-1935.280) (-1936.203) -- 0:01:06
      131000 -- (-1935.112) (-1935.847) [-1935.470] (-1935.557) * (-1938.575) [-1934.999] (-1936.596) (-1936.115) -- 0:01:06
      131500 -- [-1934.275] (-1937.480) (-1935.080) (-1934.159) * (-1940.077) [-1936.182] (-1935.060) (-1936.403) -- 0:01:06
      132000 -- (-1935.594) (-1937.737) [-1936.679] (-1936.264) * [-1935.693] (-1936.250) (-1936.332) (-1936.921) -- 0:01:05
      132500 -- (-1935.057) (-1937.080) [-1937.827] (-1934.624) * [-1935.023] (-1938.109) (-1935.242) (-1938.495) -- 0:01:05
      133000 -- (-1936.752) (-1935.327) (-1936.124) [-1936.212] * (-1935.545) (-1934.650) (-1937.000) [-1935.740] -- 0:01:05
      133500 -- (-1935.424) (-1935.880) (-1935.821) [-1936.399] * [-1935.356] (-1936.430) (-1936.452) (-1934.600) -- 0:01:04
      134000 -- (-1934.551) (-1936.173) (-1935.393) [-1936.349] * (-1935.663) [-1935.228] (-1935.561) (-1934.670) -- 0:01:04
      134500 -- [-1934.570] (-1937.738) (-1934.945) (-1936.209) * (-1935.535) (-1935.030) (-1937.372) [-1934.712] -- 0:01:04
      135000 -- (-1935.592) (-1938.422) [-1934.170] (-1936.523) * (-1939.036) (-1935.361) (-1939.190) [-1934.709] -- 0:01:04

      Average standard deviation of split frequencies: 0.019411

      135500 -- (-1936.875) (-1937.218) (-1933.543) [-1934.895] * (-1938.099) (-1937.082) (-1940.203) [-1934.019] -- 0:01:03
      136000 -- (-1934.747) (-1937.058) [-1934.549] (-1936.660) * (-1937.678) [-1934.559] (-1939.322) (-1935.169) -- 0:01:03
      136500 -- (-1935.501) [-1940.389] (-1934.632) (-1935.120) * (-1935.262) (-1934.134) (-1937.743) [-1935.829] -- 0:01:03
      137000 -- [-1934.743] (-1936.520) (-1936.134) (-1938.368) * [-1934.153] (-1935.179) (-1935.330) (-1934.851) -- 0:01:02
      137500 -- (-1934.344) [-1935.226] (-1933.377) (-1937.017) * (-1934.159) [-1939.608] (-1935.594) (-1935.051) -- 0:01:02
      138000 -- (-1935.208) (-1935.788) (-1935.727) [-1934.875] * (-1938.974) (-1935.853) [-1935.878] (-1935.563) -- 0:01:02
      138500 -- (-1934.472) [-1935.351] (-1934.611) (-1936.674) * (-1938.844) (-1939.383) [-1935.818] (-1937.141) -- 0:01:02
      139000 -- (-1941.730) (-1937.917) [-1936.536] (-1937.593) * (-1935.981) [-1938.528] (-1939.757) (-1935.897) -- 0:01:01
      139500 -- (-1937.372) (-1935.461) (-1937.061) [-1941.755] * (-1935.160) (-1934.288) (-1935.039) [-1936.087] -- 0:01:07
      140000 -- (-1937.736) (-1935.114) [-1935.120] (-1937.751) * (-1934.742) (-1935.065) (-1939.347) [-1938.331] -- 0:01:07

      Average standard deviation of split frequencies: 0.019755

      140500 -- (-1937.448) (-1936.667) (-1936.409) [-1939.895] * [-1935.414] (-1936.004) (-1938.131) (-1937.307) -- 0:01:07
      141000 -- (-1935.142) (-1936.597) [-1934.532] (-1940.185) * [-1934.125] (-1936.378) (-1937.385) (-1936.997) -- 0:01:07
      141500 -- (-1937.949) (-1936.028) [-1936.919] (-1939.800) * (-1935.695) [-1934.243] (-1941.835) (-1937.407) -- 0:01:06
      142000 -- (-1938.083) [-1935.747] (-1941.630) (-1937.221) * (-1937.257) [-1936.616] (-1936.709) (-1936.407) -- 0:01:06
      142500 -- (-1938.462) (-1935.491) [-1937.755] (-1938.573) * (-1935.972) [-1938.096] (-1936.315) (-1934.808) -- 0:01:06
      143000 -- (-1935.099) (-1936.542) [-1936.420] (-1935.082) * (-1937.299) (-1934.839) (-1937.224) [-1935.112] -- 0:01:05
      143500 -- (-1937.634) (-1936.611) (-1937.270) [-1935.709] * (-1935.510) (-1934.338) (-1936.499) [-1935.020] -- 0:01:05
      144000 -- (-1937.222) (-1938.449) (-1937.232) [-1935.632] * [-1936.690] (-1937.242) (-1934.835) (-1935.338) -- 0:01:05
      144500 -- (-1935.968) [-1934.255] (-1938.913) (-1935.797) * (-1937.120) [-1935.554] (-1935.607) (-1936.866) -- 0:01:05
      145000 -- (-1933.852) (-1934.556) (-1938.808) [-1937.352] * (-1938.333) (-1935.131) (-1938.408) [-1939.088] -- 0:01:04

      Average standard deviation of split frequencies: 0.017920

      145500 -- (-1933.210) (-1935.060) [-1937.304] (-1936.108) * (-1934.947) (-1933.252) [-1935.878] (-1935.599) -- 0:01:04
      146000 -- [-1935.562] (-1936.964) (-1936.832) (-1937.936) * (-1935.984) (-1934.957) [-1936.223] (-1935.826) -- 0:01:04
      146500 -- (-1937.818) [-1932.741] (-1940.178) (-1937.308) * (-1935.098) (-1936.311) [-1935.773] (-1935.129) -- 0:01:04
      147000 -- (-1937.986) (-1935.026) (-1935.483) [-1937.530] * (-1937.136) [-1940.981] (-1936.619) (-1936.164) -- 0:01:03
      147500 -- (-1940.308) (-1934.062) (-1935.423) [-1934.871] * (-1935.533) (-1935.560) (-1937.100) [-1934.207] -- 0:01:03
      148000 -- (-1937.820) [-1934.273] (-1934.755) (-1937.069) * (-1936.900) [-1935.348] (-1938.995) (-1936.085) -- 0:01:03
      148500 -- (-1936.206) (-1936.446) [-1934.446] (-1937.077) * (-1937.874) [-1932.962] (-1937.703) (-1937.015) -- 0:01:03
      149000 -- [-1935.095] (-1933.326) (-1936.198) (-1936.518) * [-1937.468] (-1936.585) (-1940.194) (-1935.700) -- 0:01:02
      149500 -- (-1936.421) (-1934.922) (-1937.977) [-1937.352] * (-1934.344) (-1936.913) (-1936.886) [-1938.127] -- 0:01:02
      150000 -- (-1935.508) (-1937.296) [-1936.927] (-1936.819) * (-1936.084) [-1934.079] (-1934.610) (-1935.666) -- 0:01:02

      Average standard deviation of split frequencies: 0.017382

      150500 -- (-1935.839) [-1939.363] (-1934.644) (-1936.365) * (-1935.600) (-1936.421) [-1934.626] (-1936.134) -- 0:01:02
      151000 -- (-1936.289) [-1934.193] (-1932.738) (-1937.039) * (-1934.506) [-1935.097] (-1935.481) (-1933.014) -- 0:01:01
      151500 -- [-1934.665] (-1933.332) (-1934.767) (-1940.229) * (-1935.180) (-1933.714) (-1936.577) [-1937.075] -- 0:01:01
      152000 -- (-1934.370) [-1935.159] (-1938.179) (-1934.408) * (-1936.691) (-1936.331) (-1936.191) [-1936.136] -- 0:01:01
      152500 -- (-1934.862) (-1934.819) (-1935.735) [-1933.809] * (-1933.792) [-1934.756] (-1936.168) (-1937.263) -- 0:01:01
      153000 -- [-1934.809] (-1936.006) (-1936.217) (-1937.894) * (-1936.552) (-1933.388) [-1938.936] (-1935.028) -- 0:01:00
      153500 -- (-1935.893) [-1938.846] (-1936.093) (-1934.873) * (-1941.024) (-1934.987) [-1936.090] (-1934.425) -- 0:01:06
      154000 -- (-1933.152) (-1937.607) [-1933.866] (-1936.694) * (-1938.140) (-1934.810) (-1934.803) [-1934.645] -- 0:01:05
      154500 -- (-1934.657) [-1933.976] (-1935.076) (-1934.462) * (-1939.884) (-1937.167) [-1935.321] (-1934.289) -- 0:01:05
      155000 -- [-1936.243] (-1933.667) (-1937.806) (-1937.473) * (-1938.975) (-1943.209) (-1935.879) [-1936.145] -- 0:01:05

      Average standard deviation of split frequencies: 0.019978

      155500 -- (-1938.207) [-1935.343] (-1934.741) (-1940.040) * [-1937.505] (-1935.606) (-1935.052) (-1935.632) -- 0:01:05
      156000 -- (-1938.804) (-1936.961) (-1934.387) [-1937.677] * (-1935.723) (-1935.767) (-1935.975) [-1935.840] -- 0:01:04
      156500 -- (-1935.716) (-1937.924) [-1936.915] (-1933.095) * (-1937.208) [-1934.689] (-1936.637) (-1935.865) -- 0:01:04
      157000 -- (-1937.604) [-1936.483] (-1937.425) (-1935.845) * (-1935.895) [-1938.594] (-1939.059) (-1935.772) -- 0:01:04
      157500 -- [-1939.736] (-1938.136) (-1937.176) (-1938.724) * (-1936.845) (-1936.966) [-1938.350] (-1937.990) -- 0:01:04
      158000 -- [-1936.994] (-1937.630) (-1936.472) (-1933.648) * (-1935.405) (-1933.662) [-1936.321] (-1936.740) -- 0:01:03
      158500 -- (-1936.769) (-1937.669) [-1935.990] (-1935.946) * (-1934.256) (-1935.077) (-1937.056) [-1934.258] -- 0:01:03
      159000 -- (-1937.851) [-1935.233] (-1940.571) (-1935.274) * [-1934.044] (-1935.981) (-1938.609) (-1939.279) -- 0:01:03
      159500 -- (-1937.946) (-1934.610) (-1939.916) [-1937.303] * [-1933.742] (-1934.250) (-1938.124) (-1936.485) -- 0:01:03
      160000 -- [-1939.187] (-1935.348) (-1939.381) (-1934.957) * (-1935.527) (-1933.247) (-1935.955) [-1935.138] -- 0:01:02

      Average standard deviation of split frequencies: 0.016224

      160500 -- (-1939.327) [-1937.821] (-1941.899) (-1943.348) * (-1935.740) [-1933.798] (-1935.109) (-1937.237) -- 0:01:02
      161000 -- (-1937.237) (-1936.701) [-1937.672] (-1935.874) * (-1934.564) [-1935.638] (-1936.267) (-1935.147) -- 0:01:02
      161500 -- (-1936.165) [-1937.079] (-1937.478) (-1936.011) * [-1935.404] (-1934.855) (-1938.235) (-1934.819) -- 0:01:02
      162000 -- (-1934.439) [-1935.610] (-1938.607) (-1936.645) * [-1934.547] (-1935.851) (-1934.997) (-1937.561) -- 0:01:02
      162500 -- [-1937.117] (-1936.611) (-1941.467) (-1938.079) * (-1940.161) (-1936.143) [-1935.216] (-1934.506) -- 0:01:01
      163000 -- (-1936.946) (-1937.359) (-1938.247) [-1935.900] * (-1935.387) (-1933.051) (-1935.536) [-1934.395] -- 0:01:01
      163500 -- [-1935.804] (-1934.918) (-1935.724) (-1934.814) * [-1938.587] (-1934.865) (-1938.425) (-1933.850) -- 0:01:01
      164000 -- [-1934.857] (-1934.885) (-1938.250) (-1936.218) * (-1934.310) [-1937.427] (-1938.235) (-1936.305) -- 0:01:01
      164500 -- [-1934.325] (-1933.725) (-1938.448) (-1934.861) * (-1935.189) [-1935.835] (-1938.895) (-1933.678) -- 0:01:00
      165000 -- [-1933.585] (-1936.685) (-1939.161) (-1934.863) * (-1936.131) (-1937.660) [-1937.910] (-1935.406) -- 0:01:00

      Average standard deviation of split frequencies: 0.015934

      165500 -- (-1936.133) [-1937.781] (-1937.035) (-1934.675) * (-1935.006) [-1937.738] (-1934.679) (-1934.617) -- 0:01:00
      166000 -- (-1938.708) [-1936.964] (-1938.108) (-1935.622) * (-1936.138) [-1934.216] (-1934.977) (-1933.994) -- 0:01:00
      166500 -- (-1941.591) (-1937.296) [-1938.114] (-1936.772) * (-1934.683) (-1936.374) (-1935.612) [-1935.573] -- 0:01:00
      167000 -- (-1937.528) [-1935.635] (-1935.699) (-1934.203) * (-1938.285) [-1935.716] (-1937.027) (-1935.028) -- 0:00:59
      167500 -- (-1937.295) [-1934.024] (-1936.422) (-1935.097) * (-1933.730) (-1933.512) (-1937.915) [-1936.807] -- 0:00:59
      168000 -- (-1936.136) (-1933.861) (-1937.681) [-1935.902] * (-1935.650) (-1935.586) [-1939.013] (-1934.332) -- 0:01:04
      168500 -- (-1935.599) [-1934.300] (-1935.313) (-1938.803) * (-1935.034) [-1935.738] (-1938.153) (-1936.378) -- 0:01:04
      169000 -- [-1935.904] (-1934.893) (-1936.507) (-1938.222) * (-1934.990) [-1934.818] (-1938.634) (-1935.230) -- 0:01:03
      169500 -- (-1936.808) (-1936.579) (-1939.979) [-1937.785] * (-1933.774) [-1934.719] (-1934.886) (-1934.890) -- 0:01:03
      170000 -- [-1935.619] (-1940.157) (-1934.694) (-1937.401) * [-1933.922] (-1934.832) (-1937.070) (-1937.416) -- 0:01:03

      Average standard deviation of split frequencies: 0.016410

      170500 -- (-1935.783) (-1938.805) [-1937.252] (-1935.924) * (-1935.157) (-1935.409) (-1937.369) [-1934.185] -- 0:01:03
      171000 -- (-1941.854) (-1940.106) [-1935.883] (-1936.408) * (-1941.269) (-1934.202) [-1938.328] (-1937.461) -- 0:01:03
      171500 -- (-1941.756) (-1938.373) (-1934.706) [-1936.219] * (-1937.981) [-1934.640] (-1937.068) (-1937.774) -- 0:01:02
      172000 -- (-1937.363) (-1936.368) [-1938.604] (-1937.111) * (-1934.996) (-1936.725) (-1936.255) [-1936.170] -- 0:01:02
      172500 -- (-1937.489) [-1933.679] (-1936.517) (-1937.020) * (-1936.487) (-1940.947) (-1934.502) [-1940.095] -- 0:01:02
      173000 -- (-1936.933) [-1934.937] (-1935.574) (-1937.203) * (-1936.641) (-1941.136) (-1934.695) [-1934.500] -- 0:01:02
      173500 -- (-1936.552) (-1935.148) (-1935.685) [-1935.453] * [-1935.622] (-1939.663) (-1934.925) (-1937.384) -- 0:01:01
      174000 -- (-1935.983) (-1934.156) [-1935.100] (-1935.090) * [-1936.052] (-1936.094) (-1935.855) (-1936.536) -- 0:01:01
      174500 -- [-1944.745] (-1934.608) (-1938.031) (-1938.056) * (-1933.423) (-1936.251) [-1937.429] (-1934.304) -- 0:01:01
      175000 -- (-1938.873) (-1934.504) [-1934.227] (-1936.216) * [-1932.542] (-1934.628) (-1937.667) (-1934.518) -- 0:01:01

      Average standard deviation of split frequencies: 0.016228

      175500 -- (-1938.508) (-1934.597) [-1935.835] (-1937.333) * (-1934.077) (-1935.378) (-1938.196) [-1937.108] -- 0:01:01
      176000 -- (-1936.270) (-1936.014) (-1934.578) [-1937.805] * (-1933.401) (-1935.590) (-1935.990) [-1939.569] -- 0:01:00
      176500 -- (-1936.280) (-1934.513) [-1936.528] (-1938.604) * (-1934.912) [-1935.624] (-1937.882) (-1936.378) -- 0:01:00
      177000 -- [-1935.309] (-1936.859) (-1934.937) (-1934.776) * [-1933.412] (-1933.200) (-1936.660) (-1935.674) -- 0:01:00
      177500 -- [-1935.644] (-1939.516) (-1934.400) (-1935.407) * [-1934.350] (-1934.429) (-1938.101) (-1937.114) -- 0:01:00
      178000 -- (-1935.770) [-1937.190] (-1936.580) (-1934.993) * (-1935.519) (-1934.671) [-1934.510] (-1935.105) -- 0:01:00
      178500 -- [-1935.499] (-1939.275) (-1940.248) (-1939.027) * (-1935.575) [-1935.288] (-1939.176) (-1937.016) -- 0:00:59
      179000 -- [-1935.282] (-1937.540) (-1938.138) (-1938.140) * (-1939.029) [-1935.208] (-1935.557) (-1936.715) -- 0:00:59
      179500 -- (-1937.186) [-1939.991] (-1937.268) (-1935.191) * (-1936.686) [-1934.054] (-1936.449) (-1936.544) -- 0:00:59
      180000 -- (-1936.547) (-1938.490) [-1934.744] (-1934.099) * (-1941.756) [-1937.340] (-1934.145) (-1936.467) -- 0:00:59

      Average standard deviation of split frequencies: 0.014121

      180500 -- [-1934.170] (-1935.960) (-1934.539) (-1935.728) * (-1936.770) (-1935.531) (-1933.736) [-1935.482] -- 0:00:59
      181000 -- (-1934.071) [-1935.714] (-1935.684) (-1935.014) * [-1933.681] (-1936.904) (-1935.830) (-1938.412) -- 0:00:58
      181500 -- [-1936.786] (-1937.332) (-1935.775) (-1935.685) * (-1937.839) (-1936.514) (-1935.267) [-1935.102] -- 0:00:58
      182000 -- (-1936.411) (-1935.228) [-1936.536] (-1935.535) * (-1934.185) [-1936.633] (-1934.810) (-1935.136) -- 0:00:58
      182500 -- (-1933.494) [-1933.369] (-1935.572) (-1935.720) * [-1934.770] (-1935.620) (-1936.363) (-1937.121) -- 0:01:02
      183000 -- (-1934.178) (-1936.370) (-1934.769) [-1936.581] * (-1938.610) (-1935.915) [-1935.243] (-1940.052) -- 0:01:02
      183500 -- (-1935.766) (-1936.225) (-1935.016) [-1934.471] * (-1938.596) (-1939.477) [-1935.063] (-1937.304) -- 0:01:02
      184000 -- (-1934.602) [-1937.620] (-1934.424) (-1935.388) * (-1936.254) (-1936.277) (-1937.303) [-1937.605] -- 0:01:02
      184500 -- (-1933.288) [-1935.823] (-1934.781) (-1936.183) * (-1935.360) (-1936.330) (-1939.352) [-1935.399] -- 0:01:01
      185000 -- (-1934.943) (-1934.986) [-1934.320] (-1937.522) * (-1938.978) [-1936.042] (-1937.686) (-1935.215) -- 0:01:01

      Average standard deviation of split frequencies: 0.013473

      185500 -- (-1935.601) (-1936.999) [-1935.440] (-1936.156) * (-1934.839) (-1937.135) [-1937.529] (-1934.192) -- 0:01:01
      186000 -- [-1933.381] (-1937.136) (-1938.177) (-1935.682) * [-1935.527] (-1935.790) (-1942.133) (-1939.864) -- 0:01:01
      186500 -- (-1933.713) (-1938.018) (-1935.787) [-1938.137] * (-1933.790) (-1936.399) (-1936.515) [-1935.724] -- 0:01:01
      187000 -- [-1933.262] (-1936.678) (-1934.956) (-1935.532) * (-1936.049) [-1935.262] (-1939.023) (-1934.780) -- 0:01:00
      187500 -- (-1937.509) (-1936.657) (-1934.505) [-1934.592] * (-1936.351) [-1937.446] (-1938.330) (-1937.994) -- 0:01:00
      188000 -- (-1937.543) (-1936.095) (-1936.195) [-1935.217] * [-1937.074] (-1940.360) (-1936.573) (-1938.418) -- 0:01:00
      188500 -- [-1936.296] (-1934.806) (-1935.427) (-1934.228) * (-1939.570) [-1938.285] (-1939.385) (-1941.066) -- 0:01:00
      189000 -- (-1939.995) [-1932.689] (-1935.873) (-1935.899) * [-1938.407] (-1939.237) (-1937.886) (-1934.828) -- 0:01:00
      189500 -- (-1936.515) [-1936.846] (-1934.638) (-1935.145) * [-1938.953] (-1936.011) (-1935.476) (-1935.303) -- 0:00:59
      190000 -- (-1934.754) (-1935.254) (-1935.963) [-1936.807] * (-1935.662) [-1935.383] (-1935.582) (-1936.655) -- 0:00:59

      Average standard deviation of split frequencies: 0.014010

      190500 -- (-1934.420) (-1938.547) (-1939.613) [-1935.157] * (-1936.086) (-1935.036) [-1934.209] (-1937.887) -- 0:00:59
      191000 -- (-1935.885) [-1934.943] (-1936.202) (-1936.471) * (-1935.148) (-1937.251) (-1932.996) [-1937.759] -- 0:00:59
      191500 -- [-1934.914] (-1935.619) (-1935.298) (-1938.175) * [-1935.285] (-1936.748) (-1933.449) (-1937.518) -- 0:00:59
      192000 -- (-1933.936) (-1938.781) [-1933.698] (-1936.853) * (-1935.028) (-1936.512) (-1934.301) [-1937.885] -- 0:00:58
      192500 -- (-1932.807) [-1936.903] (-1934.318) (-1940.023) * (-1936.111) [-1933.383] (-1933.386) (-1936.364) -- 0:00:58
      193000 -- (-1934.630) (-1943.012) (-1936.311) [-1937.996] * (-1936.225) (-1936.590) (-1934.673) [-1936.980] -- 0:00:58
      193500 -- (-1934.621) (-1938.704) (-1934.416) [-1935.921] * (-1938.366) (-1936.457) [-1937.506] (-1935.340) -- 0:00:58
      194000 -- (-1937.511) [-1936.751] (-1936.561) (-1938.164) * (-1936.238) (-1937.886) [-1934.750] (-1934.181) -- 0:00:58
      194500 -- (-1935.575) (-1935.424) [-1936.968] (-1934.274) * (-1937.968) (-1936.284) (-1935.607) [-1935.352] -- 0:00:57
      195000 -- (-1936.616) (-1940.054) (-1935.321) [-1935.900] * (-1938.874) [-1934.152] (-1935.732) (-1933.284) -- 0:00:57

      Average standard deviation of split frequencies: 0.013980

      195500 -- (-1935.870) (-1942.353) [-1938.311] (-1938.820) * [-1939.782] (-1937.502) (-1936.859) (-1934.177) -- 0:00:57
      196000 -- (-1935.258) [-1937.568] (-1936.136) (-1935.478) * (-1935.117) (-1937.082) [-1935.740] (-1934.888) -- 0:00:57
      196500 -- (-1933.634) [-1934.430] (-1936.001) (-1936.181) * (-1935.029) [-1935.936] (-1936.948) (-1938.850) -- 0:00:57
      197000 -- (-1938.553) [-1937.015] (-1937.285) (-1937.100) * (-1935.554) (-1937.230) (-1937.963) [-1938.590] -- 0:01:01
      197500 -- (-1939.325) (-1934.855) (-1934.795) [-1936.258] * (-1935.520) [-1935.081] (-1936.145) (-1937.924) -- 0:01:00
      198000 -- (-1936.716) (-1936.277) (-1934.420) [-1934.706] * [-1934.807] (-1936.181) (-1936.141) (-1934.546) -- 0:01:00
      198500 -- (-1934.193) [-1934.778] (-1936.441) (-1934.176) * (-1934.912) (-1935.034) [-1937.186] (-1934.570) -- 0:01:00
      199000 -- (-1935.249) (-1936.054) [-1936.374] (-1934.832) * (-1935.529) (-1935.223) [-1933.971] (-1935.044) -- 0:01:00
      199500 -- (-1935.588) [-1935.751] (-1935.163) (-1940.255) * (-1938.426) (-1932.464) [-1934.345] (-1937.717) -- 0:01:00
      200000 -- [-1934.454] (-1936.590) (-1938.710) (-1937.983) * (-1935.181) (-1934.070) [-1936.028] (-1936.958) -- 0:00:59

      Average standard deviation of split frequencies: 0.013957

      200500 -- (-1935.703) (-1937.931) [-1938.921] (-1936.792) * (-1944.346) (-1935.464) [-1934.263] (-1937.118) -- 0:00:59
      201000 -- [-1935.592] (-1935.148) (-1936.952) (-1937.149) * (-1938.037) [-1935.338] (-1935.426) (-1935.756) -- 0:00:59
      201500 -- [-1937.406] (-1936.038) (-1937.302) (-1934.731) * (-1935.802) [-1934.034] (-1936.008) (-1935.593) -- 0:00:59
      202000 -- (-1934.813) (-1935.294) (-1937.803) [-1933.446] * (-1933.978) (-1934.677) (-1935.050) [-1934.574] -- 0:00:59
      202500 -- (-1936.151) (-1935.114) [-1934.648] (-1935.639) * (-1934.822) (-1934.005) [-1937.869] (-1934.717) -- 0:00:59
      203000 -- (-1935.019) (-1937.504) [-1935.504] (-1937.165) * (-1936.133) (-1935.224) (-1938.780) [-1935.310] -- 0:00:58
      203500 -- (-1938.173) (-1936.560) [-1934.885] (-1938.124) * (-1937.032) (-1934.923) (-1937.043) [-1937.404] -- 0:00:58
      204000 -- (-1938.183) (-1932.720) (-1938.303) [-1939.300] * (-1939.100) (-1938.857) [-1936.332] (-1935.605) -- 0:00:58
      204500 -- [-1939.982] (-1935.073) (-1936.947) (-1937.188) * (-1935.756) (-1935.595) (-1937.798) [-1935.774] -- 0:00:58
      205000 -- [-1937.366] (-1936.775) (-1936.212) (-1936.635) * (-1936.141) [-1935.890] (-1934.960) (-1936.488) -- 0:00:58

      Average standard deviation of split frequencies: 0.015510

      205500 -- (-1934.853) [-1935.949] (-1934.155) (-1937.452) * [-1935.004] (-1935.132) (-1934.698) (-1934.343) -- 0:00:57
      206000 -- (-1938.494) [-1936.697] (-1935.907) (-1937.960) * (-1939.362) (-1936.743) [-1935.059] (-1938.156) -- 0:00:57
      206500 -- (-1935.216) (-1940.217) (-1934.712) [-1936.931] * (-1945.167) [-1937.417] (-1935.661) (-1936.801) -- 0:00:57
      207000 -- [-1935.570] (-1938.947) (-1937.349) (-1937.055) * (-1935.487) [-1937.149] (-1937.014) (-1941.434) -- 0:00:57
      207500 -- (-1937.729) (-1936.551) (-1935.680) [-1934.272] * (-1936.949) (-1937.468) (-1937.956) [-1937.195] -- 0:00:57
      208000 -- (-1935.307) (-1938.422) (-1937.579) [-1934.542] * (-1935.697) [-1935.826] (-1937.027) (-1936.164) -- 0:00:57
      208500 -- (-1939.534) [-1935.236] (-1936.485) (-1939.075) * [-1935.378] (-1936.572) (-1936.916) (-1936.188) -- 0:00:56
      209000 -- (-1934.557) (-1936.612) [-1933.971] (-1939.197) * (-1936.372) (-1934.373) [-1936.361] (-1936.894) -- 0:00:56
      209500 -- [-1935.511] (-1935.252) (-1936.090) (-1936.117) * (-1935.302) (-1937.513) (-1937.574) [-1935.409] -- 0:00:56
      210000 -- (-1936.731) [-1937.310] (-1936.037) (-1939.468) * (-1936.717) (-1939.220) (-1936.420) [-1938.013] -- 0:00:56

      Average standard deviation of split frequencies: 0.014084

      210500 -- (-1934.787) [-1936.746] (-1934.756) (-1935.886) * (-1937.145) (-1937.771) [-1935.483] (-1935.859) -- 0:00:56
      211000 -- (-1934.848) [-1936.911] (-1934.120) (-1936.749) * [-1936.249] (-1938.462) (-1935.019) (-1935.330) -- 0:00:56
      211500 -- (-1935.490) (-1937.763) [-1934.874] (-1935.568) * (-1935.577) [-1935.951] (-1934.808) (-1935.242) -- 0:00:59
      212000 -- (-1938.698) (-1939.293) (-1940.158) [-1937.874] * (-1936.114) [-1935.239] (-1934.754) (-1936.568) -- 0:00:59
      212500 -- (-1943.710) (-1934.393) (-1934.940) [-1937.003] * (-1935.674) (-1935.042) [-1935.723] (-1937.263) -- 0:00:59
      213000 -- [-1937.727] (-1935.177) (-1935.823) (-1936.812) * (-1941.861) (-1936.967) (-1934.515) [-1935.647] -- 0:00:59
      213500 -- [-1937.351] (-1938.447) (-1935.608) (-1936.678) * (-1937.613) (-1935.039) [-1936.282] (-1936.710) -- 0:00:58
      214000 -- [-1936.398] (-1935.499) (-1935.872) (-1934.906) * (-1937.109) (-1934.812) [-1936.153] (-1936.583) -- 0:00:58
      214500 -- (-1937.458) [-1935.458] (-1936.171) (-1937.110) * (-1934.914) [-1933.649] (-1935.711) (-1936.005) -- 0:00:58
      215000 -- (-1941.268) (-1936.418) [-1936.477] (-1935.589) * (-1936.156) [-1933.908] (-1933.668) (-1934.133) -- 0:00:58

      Average standard deviation of split frequencies: 0.013351

      215500 -- (-1938.849) (-1939.135) [-1940.298] (-1935.847) * (-1936.566) (-1935.310) [-1935.950] (-1935.456) -- 0:00:58
      216000 -- (-1935.524) [-1936.710] (-1939.225) (-1935.290) * (-1936.325) (-1938.241) (-1936.306) [-1935.266] -- 0:00:58
      216500 -- (-1935.338) [-1935.417] (-1941.550) (-1933.369) * [-1935.151] (-1936.835) (-1935.349) (-1934.923) -- 0:00:57
      217000 -- [-1935.460] (-1936.880) (-1937.545) (-1934.477) * (-1935.933) (-1939.470) [-1935.700] (-1935.265) -- 0:00:57
      217500 -- [-1935.265] (-1934.199) (-1942.539) (-1937.237) * [-1935.828] (-1935.293) (-1936.799) (-1935.810) -- 0:00:57
      218000 -- (-1934.686) (-1938.210) [-1936.680] (-1936.205) * (-1935.691) (-1935.698) (-1935.485) [-1935.650] -- 0:00:57
      218500 -- (-1934.626) (-1937.588) [-1936.583] (-1936.986) * [-1934.879] (-1936.543) (-1935.223) (-1934.793) -- 0:00:57
      219000 -- (-1934.961) (-1934.879) [-1935.233] (-1938.945) * (-1934.931) (-1936.541) [-1935.187] (-1935.861) -- 0:00:57
      219500 -- [-1933.509] (-1935.960) (-1935.439) (-1934.542) * (-1936.602) (-1937.937) [-1934.291] (-1935.931) -- 0:00:56
      220000 -- [-1934.465] (-1939.314) (-1934.800) (-1935.247) * (-1934.568) (-1936.033) [-1935.873] (-1937.606) -- 0:00:56

      Average standard deviation of split frequencies: 0.014717

      220500 -- (-1936.178) [-1935.120] (-1935.958) (-1935.485) * [-1934.670] (-1934.991) (-1934.633) (-1935.460) -- 0:00:56
      221000 -- (-1937.866) (-1935.006) [-1935.608] (-1935.557) * (-1936.862) (-1936.012) (-1934.956) [-1935.693] -- 0:00:56
      221500 -- (-1936.089) (-1934.316) [-1935.996] (-1935.918) * (-1934.498) (-1938.752) [-1935.925] (-1935.297) -- 0:00:56
      222000 -- [-1935.042] (-1935.553) (-1935.973) (-1941.489) * (-1934.456) (-1937.921) [-1936.413] (-1936.636) -- 0:00:56
      222500 -- (-1939.147) [-1935.537] (-1935.357) (-1937.436) * (-1934.133) (-1935.383) (-1934.625) [-1935.992] -- 0:00:55
      223000 -- (-1938.070) (-1936.890) [-1936.945] (-1941.240) * [-1935.430] (-1935.347) (-1935.291) (-1939.939) -- 0:00:55
      223500 -- (-1934.326) (-1934.991) [-1935.977] (-1933.586) * (-1938.039) [-1936.326] (-1936.945) (-1939.270) -- 0:00:55
      224000 -- (-1935.046) [-1933.815] (-1935.139) (-1934.619) * [-1935.746] (-1936.692) (-1935.359) (-1935.810) -- 0:00:55
      224500 -- (-1934.779) (-1940.838) (-1934.330) [-1935.331] * [-1937.747] (-1935.411) (-1936.256) (-1934.354) -- 0:00:55
      225000 -- (-1934.661) (-1936.352) (-1935.183) [-1933.912] * [-1937.037] (-1936.339) (-1936.635) (-1935.767) -- 0:00:55

      Average standard deviation of split frequencies: 0.014369

      225500 -- (-1934.777) (-1937.863) (-1936.443) [-1937.174] * (-1935.600) [-1935.590] (-1935.474) (-1936.215) -- 0:00:54
      226000 -- (-1934.662) (-1937.764) [-1935.245] (-1936.441) * (-1937.000) (-1935.030) (-1932.906) [-1933.500] -- 0:00:58
      226500 -- (-1934.964) (-1940.595) (-1934.280) [-1937.970] * (-1935.531) [-1935.159] (-1933.970) (-1937.344) -- 0:00:58
      227000 -- (-1934.891) [-1935.691] (-1935.328) (-1937.482) * (-1934.744) (-1936.154) (-1934.884) [-1935.369] -- 0:00:57
      227500 -- (-1935.829) (-1941.969) (-1937.887) [-1937.789] * (-1934.691) (-1936.883) [-1936.587] (-1934.128) -- 0:00:57
      228000 -- (-1933.463) (-1939.179) (-1938.719) [-1934.494] * (-1940.654) (-1935.137) (-1939.325) [-1940.053] -- 0:00:57
      228500 -- (-1937.193) (-1934.570) [-1937.709] (-1935.215) * [-1941.034] (-1935.391) (-1936.190) (-1939.596) -- 0:00:57
      229000 -- [-1934.514] (-1938.032) (-1935.733) (-1939.657) * (-1934.638) [-1933.860] (-1940.213) (-1942.559) -- 0:00:57
      229500 -- (-1936.031) (-1937.428) [-1935.615] (-1939.795) * (-1934.137) (-1936.545) (-1936.119) [-1942.809] -- 0:00:57
      230000 -- (-1935.847) (-1937.735) [-1935.325] (-1938.117) * (-1934.699) [-1935.244] (-1934.352) (-1941.799) -- 0:00:56

      Average standard deviation of split frequencies: 0.014192

      230500 -- [-1935.343] (-1935.488) (-1936.506) (-1935.439) * [-1935.129] (-1933.167) (-1936.403) (-1937.491) -- 0:00:56
      231000 -- (-1937.473) [-1936.933] (-1935.313) (-1936.580) * (-1936.289) (-1935.393) [-1934.074] (-1935.327) -- 0:00:56
      231500 -- (-1933.413) (-1939.211) [-1933.904] (-1938.840) * [-1935.689] (-1935.989) (-1935.284) (-1935.222) -- 0:00:56
      232000 -- (-1935.079) [-1936.593] (-1936.729) (-1938.271) * (-1934.658) (-1937.571) (-1937.844) [-1936.143] -- 0:00:56
      232500 -- (-1933.528) (-1936.607) (-1934.874) [-1938.176] * (-1935.739) [-1936.529] (-1937.569) (-1939.831) -- 0:00:56
      233000 -- (-1936.703) (-1937.808) (-1935.094) [-1936.853] * (-1934.366) (-1940.313) (-1936.057) [-1935.158] -- 0:00:55
      233500 -- (-1936.188) [-1936.366] (-1937.056) (-1936.852) * (-1937.849) (-1942.545) (-1934.007) [-1936.877] -- 0:00:55
      234000 -- (-1939.106) [-1934.891] (-1934.880) (-1936.152) * (-1935.582) [-1938.886] (-1938.271) (-1935.608) -- 0:00:55
      234500 -- (-1933.743) [-1935.273] (-1936.886) (-1935.762) * [-1935.431] (-1937.744) (-1941.732) (-1938.270) -- 0:00:55
      235000 -- [-1935.275] (-1937.093) (-1934.057) (-1936.208) * [-1935.307] (-1934.931) (-1934.960) (-1938.397) -- 0:00:55

      Average standard deviation of split frequencies: 0.014093

      235500 -- (-1937.435) (-1937.324) [-1933.417] (-1936.057) * [-1934.931] (-1933.848) (-1934.108) (-1935.557) -- 0:00:55
      236000 -- (-1939.579) (-1936.237) [-1934.155] (-1940.583) * (-1935.291) [-1935.067] (-1933.991) (-1935.694) -- 0:00:55
      236500 -- [-1938.469] (-1936.902) (-1933.954) (-1937.719) * (-1935.266) (-1935.288) [-1935.417] (-1936.333) -- 0:00:54
      237000 -- [-1934.594] (-1935.026) (-1939.732) (-1938.523) * (-1934.931) (-1938.719) [-1936.223] (-1944.628) -- 0:00:54
      237500 -- (-1935.796) [-1938.495] (-1938.266) (-1938.102) * (-1933.414) (-1934.795) [-1934.148] (-1935.540) -- 0:00:54
      238000 -- (-1937.687) (-1938.447) [-1934.237] (-1934.193) * (-1938.224) (-1935.073) (-1941.100) [-1936.395] -- 0:00:54
      238500 -- [-1933.863] (-1938.131) (-1933.056) (-1935.774) * [-1934.142] (-1938.125) (-1941.452) (-1942.847) -- 0:00:54
      239000 -- [-1934.036] (-1939.336) (-1934.828) (-1936.325) * [-1935.023] (-1934.873) (-1933.965) (-1936.327) -- 0:00:54
      239500 -- [-1935.879] (-1938.584) (-1940.392) (-1934.787) * (-1939.741) (-1934.882) [-1934.808] (-1935.722) -- 0:00:53
      240000 -- (-1936.763) (-1937.230) (-1934.901) [-1935.886] * (-1937.583) (-1935.165) (-1933.729) [-1937.899] -- 0:00:53

      Average standard deviation of split frequencies: 0.012213

      240500 -- (-1937.202) (-1939.319) [-1934.817] (-1938.740) * [-1936.717] (-1935.178) (-1935.189) (-1936.746) -- 0:00:56
      241000 -- (-1934.869) (-1936.859) [-1934.794] (-1941.535) * (-1939.809) (-1934.788) [-1934.253] (-1936.689) -- 0:00:56
      241500 -- (-1935.995) (-1936.642) (-1936.804) [-1937.655] * (-1935.164) [-1934.789] (-1935.123) (-1936.243) -- 0:00:56
      242000 -- (-1934.678) (-1937.149) (-1935.439) [-1937.751] * (-1937.162) [-1933.534] (-1934.114) (-1935.897) -- 0:00:56
      242500 -- [-1934.464] (-1937.039) (-1936.464) (-1936.438) * [-1936.110] (-1934.854) (-1938.925) (-1934.768) -- 0:00:56
      243000 -- (-1936.066) (-1936.380) [-1938.840] (-1935.504) * [-1936.329] (-1938.497) (-1937.877) (-1938.145) -- 0:00:56
      243500 -- (-1936.024) [-1935.102] (-1935.211) (-1935.480) * (-1934.748) (-1937.456) (-1938.341) [-1939.730] -- 0:00:55
      244000 -- (-1936.722) (-1935.229) (-1935.870) [-1937.014] * (-1935.741) [-1936.918] (-1934.696) (-1935.567) -- 0:00:55
      244500 -- [-1935.212] (-1935.348) (-1936.070) (-1935.984) * (-1937.441) (-1934.940) [-1935.041] (-1936.372) -- 0:00:55
      245000 -- (-1935.545) [-1934.678] (-1939.641) (-1940.632) * (-1935.012) (-1937.759) (-1934.335) [-1935.423] -- 0:00:55

      Average standard deviation of split frequencies: 0.012174

      245500 -- (-1935.029) (-1937.454) (-1935.111) [-1936.885] * [-1934.876] (-1936.347) (-1937.428) (-1937.856) -- 0:00:55
      246000 -- (-1934.358) (-1935.632) [-1934.439] (-1935.160) * (-1935.450) (-1934.780) [-1936.908] (-1936.601) -- 0:00:55
      246500 -- (-1934.559) (-1936.978) [-1935.224] (-1936.800) * (-1934.068) (-1936.645) [-1937.099] (-1936.218) -- 0:00:55
      247000 -- [-1933.597] (-1938.625) (-1935.214) (-1937.659) * [-1935.883] (-1937.312) (-1936.667) (-1938.415) -- 0:00:54
      247500 -- (-1935.481) (-1936.558) (-1935.278) [-1936.088] * (-1940.755) (-1936.871) [-1933.355] (-1939.011) -- 0:00:54
      248000 -- (-1935.647) [-1934.959] (-1936.655) (-1936.793) * (-1938.326) (-1936.020) [-1934.743] (-1938.287) -- 0:00:54
      248500 -- [-1934.012] (-1935.382) (-1936.217) (-1935.627) * (-1934.189) (-1937.979) [-1937.034] (-1938.060) -- 0:00:54
      249000 -- (-1934.755) [-1934.844] (-1938.203) (-1934.242) * (-1934.727) (-1934.215) [-1935.018] (-1934.607) -- 0:00:54
      249500 -- (-1935.602) (-1934.830) (-1938.362) [-1935.727] * [-1937.620] (-1938.541) (-1937.800) (-1934.729) -- 0:00:54
      250000 -- (-1935.526) [-1937.167] (-1936.449) (-1935.359) * (-1937.004) (-1936.183) (-1936.494) [-1935.547] -- 0:00:54

      Average standard deviation of split frequencies: 0.012169

      250500 -- (-1935.086) (-1936.109) [-1935.739] (-1936.112) * (-1935.554) (-1935.065) (-1935.803) [-1935.369] -- 0:00:53
      251000 -- (-1935.756) (-1935.811) (-1936.038) [-1936.587] * (-1934.915) (-1938.234) [-1938.471] (-1933.784) -- 0:00:53
      251500 -- (-1935.537) (-1936.898) [-1935.716] (-1935.230) * (-1935.333) (-1936.139) (-1938.639) [-1935.206] -- 0:00:53
      252000 -- [-1935.601] (-1934.278) (-1934.435) (-1935.880) * [-1936.416] (-1934.375) (-1938.477) (-1934.169) -- 0:00:53
      252500 -- (-1933.360) (-1933.970) (-1935.002) [-1935.981] * (-1937.075) (-1934.660) (-1936.608) [-1936.025] -- 0:00:53
      253000 -- (-1933.460) [-1934.624] (-1935.019) (-1937.914) * (-1936.245) (-1934.801) (-1934.751) [-1935.744] -- 0:00:53
      253500 -- [-1934.163] (-1935.645) (-1937.402) (-1938.767) * [-1936.120] (-1934.832) (-1935.782) (-1936.548) -- 0:00:53
      254000 -- (-1936.425) (-1936.677) [-1938.697] (-1939.032) * (-1935.701) (-1935.931) [-1935.798] (-1934.789) -- 0:00:52
      254500 -- (-1935.604) (-1935.497) [-1936.643] (-1939.177) * (-1934.717) (-1937.044) [-1935.420] (-1935.104) -- 0:00:52
      255000 -- [-1935.961] (-1935.767) (-1934.945) (-1936.544) * (-1941.084) (-1935.500) (-1939.970) [-1934.851] -- 0:00:55

      Average standard deviation of split frequencies: 0.012992

      255500 -- (-1938.924) (-1934.564) (-1934.776) [-1939.265] * (-1934.873) (-1934.042) (-1938.980) [-1934.898] -- 0:00:55
      256000 -- (-1939.778) (-1934.756) [-1935.598] (-1934.844) * (-1934.123) [-1934.507] (-1934.702) (-1933.899) -- 0:00:55
      256500 -- [-1940.352] (-1938.409) (-1941.040) (-1938.413) * [-1934.785] (-1936.089) (-1936.758) (-1935.372) -- 0:00:55
      257000 -- (-1939.032) (-1935.880) [-1934.847] (-1941.789) * (-1934.914) [-1933.936] (-1934.749) (-1935.127) -- 0:00:54
      257500 -- [-1941.105] (-1932.688) (-1942.161) (-1936.787) * (-1933.178) (-1936.917) [-1936.454] (-1934.124) -- 0:00:54
      258000 -- [-1934.988] (-1933.914) (-1937.091) (-1935.120) * (-1935.844) (-1939.266) (-1940.725) [-1935.033] -- 0:00:54
      258500 -- [-1938.074] (-1935.201) (-1935.723) (-1936.677) * [-1932.704] (-1940.774) (-1937.461) (-1935.303) -- 0:00:54
      259000 -- (-1935.912) (-1936.056) [-1935.532] (-1936.714) * [-1933.102] (-1941.457) (-1938.861) (-1934.025) -- 0:00:54
      259500 -- [-1938.283] (-1937.054) (-1935.637) (-1936.122) * [-1934.647] (-1934.528) (-1934.113) (-1933.867) -- 0:00:54
      260000 -- [-1937.133] (-1935.804) (-1935.077) (-1936.419) * (-1934.472) (-1935.787) [-1934.607] (-1935.673) -- 0:00:54

      Average standard deviation of split frequencies: 0.012207

      260500 -- (-1934.700) (-1935.559) (-1938.795) [-1936.173] * (-1935.871) (-1934.941) (-1937.666) [-1933.315] -- 0:00:53
      261000 -- (-1937.941) (-1937.171) [-1935.749] (-1935.514) * (-1933.493) (-1935.009) (-1938.992) [-1935.117] -- 0:00:53
      261500 -- (-1939.153) (-1938.779) (-1937.634) [-1936.274] * (-1935.298) (-1932.445) (-1937.351) [-1936.828] -- 0:00:53
      262000 -- (-1937.406) [-1935.341] (-1936.399) (-1935.096) * (-1938.298) [-1935.067] (-1936.652) (-1936.089) -- 0:00:53
      262500 -- [-1933.847] (-1937.335) (-1934.990) (-1937.246) * (-1936.433) [-1935.670] (-1935.121) (-1936.458) -- 0:00:53
      263000 -- (-1936.468) [-1938.218] (-1938.654) (-1939.090) * [-1935.311] (-1936.088) (-1937.504) (-1938.633) -- 0:00:53
      263500 -- (-1937.632) (-1937.287) [-1936.656] (-1937.755) * (-1935.610) [-1935.054] (-1935.184) (-1937.695) -- 0:00:53
      264000 -- (-1934.481) [-1933.527] (-1934.682) (-1938.687) * [-1935.375] (-1937.341) (-1936.551) (-1936.293) -- 0:00:52
      264500 -- [-1939.105] (-1937.815) (-1936.834) (-1936.793) * [-1933.944] (-1934.550) (-1938.068) (-1935.381) -- 0:00:52
      265000 -- (-1939.621) (-1938.424) [-1936.136] (-1935.045) * (-1935.661) (-1936.084) [-1937.047] (-1934.948) -- 0:00:52

      Average standard deviation of split frequencies: 0.011050

      265500 -- (-1938.884) [-1936.939] (-1939.429) (-1939.709) * (-1937.459) (-1934.980) [-1936.714] (-1934.989) -- 0:00:52
      266000 -- (-1940.681) (-1935.305) [-1935.363] (-1935.932) * (-1935.277) [-1934.476] (-1935.085) (-1936.326) -- 0:00:52
      266500 -- (-1937.916) (-1939.044) [-1940.020] (-1936.481) * [-1933.883] (-1937.167) (-1936.866) (-1937.611) -- 0:00:52
      267000 -- (-1938.565) (-1935.722) (-1938.419) [-1935.807] * [-1933.792] (-1936.104) (-1938.866) (-1941.757) -- 0:00:52
      267500 -- (-1935.064) (-1936.175) (-1937.716) [-1939.403] * (-1936.699) (-1935.043) (-1937.894) [-1939.286] -- 0:00:52
      268000 -- (-1936.150) [-1933.231] (-1937.868) (-1936.611) * [-1936.491] (-1936.825) (-1942.693) (-1936.623) -- 0:00:51
      268500 -- (-1935.341) [-1935.533] (-1935.528) (-1935.780) * (-1938.918) [-1938.584] (-1938.654) (-1937.049) -- 0:00:51
      269000 -- (-1934.255) [-1933.741] (-1934.622) (-1937.006) * (-1940.823) (-1935.891) (-1934.865) [-1936.299] -- 0:00:54
      269500 -- (-1936.476) (-1934.749) [-1936.166] (-1937.295) * (-1935.449) (-1934.276) (-1936.559) [-1934.613] -- 0:00:54
      270000 -- (-1938.287) [-1933.952] (-1935.032) (-1935.420) * (-1933.141) (-1935.687) (-1937.635) [-1935.105] -- 0:00:54

      Average standard deviation of split frequencies: 0.011417

      270500 -- (-1934.579) (-1939.125) (-1934.666) [-1935.212] * (-1934.008) (-1933.279) [-1937.925] (-1936.215) -- 0:00:53
      271000 -- [-1935.573] (-1936.915) (-1934.747) (-1935.933) * (-1933.989) [-1933.139] (-1939.096) (-1933.462) -- 0:00:53
      271500 -- (-1935.483) [-1934.289] (-1936.008) (-1936.784) * [-1933.294] (-1935.073) (-1938.953) (-1936.939) -- 0:00:53
      272000 -- (-1935.387) (-1936.502) [-1932.363] (-1937.516) * [-1935.112] (-1933.377) (-1939.218) (-1937.006) -- 0:00:53
      272500 -- [-1934.523] (-1936.473) (-1935.154) (-1937.773) * [-1933.349] (-1933.589) (-1937.735) (-1936.180) -- 0:00:53
      273000 -- (-1937.378) (-1937.145) [-1936.239] (-1936.072) * (-1935.517) (-1935.821) [-1940.749] (-1938.181) -- 0:00:53
      273500 -- (-1937.688) [-1936.538] (-1935.665) (-1935.778) * (-1936.844) (-1936.640) (-1938.931) [-1934.165] -- 0:00:53
      274000 -- (-1937.604) (-1937.471) [-1937.054] (-1936.755) * (-1936.280) (-1934.708) [-1941.208] (-1935.010) -- 0:00:52
      274500 -- (-1934.868) (-1936.031) [-1937.415] (-1940.165) * (-1938.352) [-1935.060] (-1934.842) (-1933.866) -- 0:00:52
      275000 -- (-1935.480) [-1936.918] (-1936.041) (-1936.492) * (-1938.928) [-1935.170] (-1936.267) (-1933.932) -- 0:00:52

      Average standard deviation of split frequencies: 0.012961

      275500 -- (-1936.342) (-1937.015) [-1934.018] (-1942.716) * (-1935.002) [-1935.424] (-1936.319) (-1935.754) -- 0:00:52
      276000 -- [-1936.347] (-1939.768) (-1935.613) (-1938.199) * (-1937.081) [-1935.164] (-1935.059) (-1934.354) -- 0:00:52
      276500 -- (-1934.729) (-1937.880) [-1936.015] (-1934.522) * [-1937.749] (-1937.782) (-1936.145) (-1935.181) -- 0:00:52
      277000 -- (-1934.912) (-1935.496) (-1940.060) [-1934.315] * (-1936.381) [-1934.248] (-1940.420) (-1936.633) -- 0:00:52
      277500 -- (-1935.134) [-1934.679] (-1937.823) (-1936.347) * (-1936.505) [-1935.171] (-1941.529) (-1937.301) -- 0:00:52
      278000 -- (-1934.909) [-1937.674] (-1937.151) (-1937.550) * (-1934.918) (-1938.384) (-1933.134) [-1935.525] -- 0:00:51
      278500 -- [-1935.505] (-1935.825) (-1940.344) (-1939.069) * (-1938.198) (-1938.079) [-1935.458] (-1935.243) -- 0:00:51
      279000 -- (-1936.153) [-1937.762] (-1935.616) (-1939.123) * (-1938.221) (-1938.166) (-1935.101) [-1934.669] -- 0:00:51
      279500 -- (-1942.521) (-1935.543) [-1936.229] (-1940.060) * (-1935.691) [-1935.176] (-1936.770) (-1935.151) -- 0:00:51
      280000 -- [-1936.909] (-1935.127) (-1939.477) (-1939.574) * (-1935.171) [-1934.700] (-1935.049) (-1935.848) -- 0:00:51

      Average standard deviation of split frequencies: 0.012807

      280500 -- (-1937.251) [-1936.169] (-1934.922) (-1935.837) * [-1935.397] (-1936.068) (-1935.462) (-1937.116) -- 0:00:51
      281000 -- (-1936.761) (-1935.982) [-1935.318] (-1936.742) * (-1936.227) [-1936.005] (-1934.897) (-1939.335) -- 0:00:51
      281500 -- (-1937.222) [-1937.026] (-1935.982) (-1933.559) * [-1937.157] (-1936.623) (-1935.517) (-1935.417) -- 0:00:51
      282000 -- (-1938.064) (-1935.630) (-1936.230) [-1936.397] * (-1934.375) (-1935.157) (-1937.952) [-1938.467] -- 0:00:50
      282500 -- (-1936.234) (-1936.651) (-1935.988) [-1937.326] * (-1933.393) (-1936.786) [-1937.203] (-1935.725) -- 0:00:50
      283000 -- (-1935.917) [-1936.654] (-1934.932) (-1939.499) * (-1936.728) (-1937.887) [-1936.738] (-1936.048) -- 0:00:53
      283500 -- (-1936.767) (-1937.665) (-1937.134) [-1944.405] * (-1937.060) (-1935.130) [-1936.721] (-1934.536) -- 0:00:53
      284000 -- (-1936.917) (-1936.491) (-1937.282) [-1934.743] * (-1936.948) [-1933.932] (-1938.381) (-1935.448) -- 0:00:52
      284500 -- [-1937.070] (-1938.583) (-1937.481) (-1937.446) * (-1939.483) (-1937.321) [-1937.691] (-1935.654) -- 0:00:52
      285000 -- [-1938.622] (-1935.636) (-1935.132) (-1936.125) * [-1937.048] (-1937.180) (-1937.159) (-1936.178) -- 0:00:52

      Average standard deviation of split frequencies: 0.011721

      285500 -- [-1938.388] (-1936.420) (-1936.063) (-1934.841) * [-1932.855] (-1935.321) (-1935.301) (-1934.944) -- 0:00:52
      286000 -- (-1938.049) [-1935.752] (-1936.471) (-1934.148) * (-1937.014) [-1934.558] (-1938.479) (-1937.383) -- 0:00:52
      286500 -- (-1936.167) [-1934.773] (-1935.911) (-1938.429) * (-1940.029) (-1935.246) [-1935.979] (-1939.239) -- 0:00:52
      287000 -- (-1937.538) [-1938.755] (-1937.094) (-1936.267) * (-1934.997) [-1934.777] (-1935.295) (-1939.434) -- 0:00:52
      287500 -- (-1939.404) (-1937.864) [-1934.230] (-1936.933) * (-1934.317) (-1937.253) (-1938.179) [-1934.027] -- 0:00:52
      288000 -- (-1938.431) [-1937.527] (-1934.374) (-1936.315) * (-1936.939) (-1936.009) (-1937.228) [-1937.966] -- 0:00:51
      288500 -- (-1936.996) [-1933.453] (-1933.662) (-1935.389) * (-1935.989) (-1934.731) (-1936.363) [-1935.883] -- 0:00:51
      289000 -- (-1936.243) (-1936.697) [-1935.896] (-1934.916) * (-1933.926) [-1940.098] (-1936.140) (-1938.107) -- 0:00:51
      289500 -- (-1934.243) (-1933.972) [-1936.160] (-1934.782) * [-1935.176] (-1937.059) (-1934.948) (-1938.238) -- 0:00:51
      290000 -- (-1935.007) (-1937.121) (-1935.459) [-1937.761] * (-1935.755) [-1936.700] (-1939.245) (-1936.782) -- 0:00:51

      Average standard deviation of split frequencies: 0.011257

      290500 -- [-1938.100] (-1935.671) (-1936.969) (-1936.470) * [-1935.448] (-1935.824) (-1939.703) (-1935.966) -- 0:00:51
      291000 -- (-1938.128) [-1934.691] (-1939.991) (-1934.243) * (-1935.161) (-1934.318) [-1936.054] (-1935.456) -- 0:00:51
      291500 -- [-1938.015] (-1935.358) (-1936.183) (-1937.316) * [-1935.205] (-1935.698) (-1939.613) (-1936.600) -- 0:00:51
      292000 -- (-1935.599) (-1936.011) [-1936.565] (-1935.294) * [-1940.455] (-1935.166) (-1939.947) (-1936.517) -- 0:00:50
      292500 -- (-1937.982) [-1935.343] (-1934.570) (-1935.540) * (-1936.288) (-1934.865) [-1935.851] (-1935.619) -- 0:00:50
      293000 -- (-1937.054) (-1935.996) [-1939.532] (-1933.197) * (-1935.971) (-1934.938) [-1934.891] (-1936.567) -- 0:00:50
      293500 -- (-1936.116) (-1939.992) [-1936.374] (-1934.966) * (-1932.555) [-1933.835] (-1935.772) (-1941.436) -- 0:00:50
      294000 -- (-1935.802) (-1938.926) (-1934.168) [-1936.593] * (-1934.686) (-1934.039) (-1934.963) [-1935.038] -- 0:00:50
      294500 -- (-1935.457) (-1938.162) [-1935.316] (-1935.155) * [-1933.554] (-1934.386) (-1936.126) (-1935.588) -- 0:00:50
      295000 -- (-1935.282) (-1934.798) (-1937.355) [-1935.409] * [-1936.129] (-1935.582) (-1937.039) (-1934.889) -- 0:00:50

      Average standard deviation of split frequencies: 0.011845

      295500 -- [-1937.061] (-1935.123) (-1936.596) (-1937.215) * (-1935.810) [-1935.375] (-1934.376) (-1936.771) -- 0:00:50
      296000 -- (-1936.041) [-1936.071] (-1939.502) (-1935.077) * (-1935.076) (-1933.971) [-1936.986] (-1933.965) -- 0:00:49
      296500 -- (-1939.326) [-1938.968] (-1936.967) (-1936.590) * [-1934.448] (-1934.093) (-1934.519) (-1935.038) -- 0:00:49
      297000 -- (-1937.422) (-1937.748) [-1935.902] (-1935.144) * (-1935.195) [-1935.253] (-1935.475) (-1935.272) -- 0:00:49
      297500 -- (-1936.573) (-1936.509) (-1935.241) [-1935.940] * (-1932.980) (-1937.035) (-1935.253) [-1935.732] -- 0:00:51
      298000 -- (-1937.755) [-1939.765] (-1935.468) (-1937.819) * [-1934.590] (-1936.192) (-1937.702) (-1935.659) -- 0:00:51
      298500 -- (-1934.406) [-1935.980] (-1935.886) (-1941.821) * (-1934.876) (-1934.658) (-1935.214) [-1937.524] -- 0:00:51
      299000 -- (-1935.144) [-1935.435] (-1935.213) (-1937.239) * (-1935.570) (-1939.028) (-1935.399) [-1938.984] -- 0:00:51
      299500 -- (-1934.917) (-1935.862) [-1932.786] (-1936.797) * (-1935.805) (-1939.407) [-1934.353] (-1937.807) -- 0:00:51
      300000 -- [-1937.054] (-1933.579) (-1935.077) (-1936.499) * (-1934.874) (-1939.533) (-1935.626) [-1937.363] -- 0:00:51

      Average standard deviation of split frequencies: 0.010681

      300500 -- (-1937.008) (-1936.523) (-1935.013) [-1935.740] * (-1937.520) (-1937.303) [-1935.487] (-1935.567) -- 0:00:51
      301000 -- (-1936.762) (-1934.763) (-1935.317) [-1935.701] * (-1939.424) (-1934.386) (-1935.575) [-1934.875] -- 0:00:51
      301500 -- (-1934.874) [-1936.661] (-1932.687) (-1935.085) * (-1937.551) (-1937.984) [-1937.916] (-1936.515) -- 0:00:50
      302000 -- (-1934.893) (-1938.088) (-1934.373) [-1936.382] * (-1936.387) (-1935.446) [-1939.205] (-1937.269) -- 0:00:50
      302500 -- (-1937.853) [-1934.458] (-1935.963) (-1937.056) * (-1936.842) [-1939.909] (-1935.971) (-1936.330) -- 0:00:50
      303000 -- (-1937.012) (-1934.210) (-1936.788) [-1935.231] * (-1938.660) (-1937.868) (-1937.254) [-1936.881] -- 0:00:50
      303500 -- (-1937.665) (-1934.973) (-1935.895) [-1934.246] * (-1937.147) (-1938.357) [-1934.617] (-1935.936) -- 0:00:50
      304000 -- (-1937.472) (-1934.229) (-1937.418) [-1935.661] * (-1937.774) (-1940.793) [-1933.487] (-1935.956) -- 0:00:50
      304500 -- [-1936.525] (-1935.874) (-1937.139) (-1937.112) * (-1935.686) (-1936.933) [-1934.159] (-1935.957) -- 0:00:50
      305000 -- (-1934.354) [-1935.894] (-1937.850) (-1937.260) * [-1935.219] (-1936.105) (-1936.397) (-1937.666) -- 0:00:50

      Average standard deviation of split frequencies: 0.010240

      305500 -- [-1934.615] (-1936.809) (-1937.285) (-1935.187) * (-1936.231) [-1935.887] (-1934.269) (-1937.255) -- 0:00:50
      306000 -- [-1933.509] (-1936.714) (-1936.855) (-1940.029) * (-1938.212) (-1935.639) [-1936.700] (-1938.309) -- 0:00:49
      306500 -- (-1933.604) [-1936.359] (-1935.169) (-1942.256) * (-1941.899) (-1935.537) [-1938.385] (-1936.717) -- 0:00:49
      307000 -- [-1934.098] (-1936.794) (-1935.415) (-1941.237) * (-1937.444) (-1934.514) [-1934.079] (-1936.883) -- 0:00:49
      307500 -- (-1934.196) [-1935.251] (-1935.505) (-1935.815) * [-1935.334] (-1937.722) (-1936.883) (-1936.206) -- 0:00:49
      308000 -- (-1934.966) (-1936.230) (-1934.552) [-1936.191] * (-1938.134) [-1936.333] (-1935.066) (-1936.355) -- 0:00:49
      308500 -- [-1934.907] (-1933.059) (-1935.322) (-1941.867) * (-1937.424) (-1937.748) [-1936.175] (-1934.400) -- 0:00:49
      309000 -- (-1936.358) [-1934.896] (-1936.184) (-1935.021) * (-1936.608) (-1935.837) (-1935.237) [-1935.243] -- 0:00:49
      309500 -- (-1936.045) [-1933.656] (-1936.594) (-1940.931) * (-1935.741) (-1940.055) (-1935.886) [-1934.981] -- 0:00:49
      310000 -- (-1935.898) (-1934.922) (-1937.305) [-1937.996] * (-1934.618) (-1935.531) (-1934.513) [-1935.250] -- 0:00:48

      Average standard deviation of split frequencies: 0.010354

      310500 -- [-1935.085] (-1935.255) (-1936.629) (-1939.988) * (-1935.709) [-1935.570] (-1934.082) (-1952.158) -- 0:00:48
      311000 -- (-1938.656) (-1938.361) [-1936.124] (-1935.282) * (-1934.442) (-1935.402) [-1936.995] (-1935.121) -- 0:00:48
      311500 -- [-1935.273] (-1936.275) (-1936.297) (-1937.121) * (-1934.100) (-1935.079) [-1935.757] (-1935.381) -- 0:00:48
      312000 -- [-1935.024] (-1937.456) (-1936.525) (-1940.331) * (-1932.807) (-1936.770) (-1936.337) [-1935.401] -- 0:00:50
      312500 -- (-1936.690) [-1936.507] (-1936.094) (-1936.487) * (-1935.814) [-1934.897] (-1935.989) (-1935.509) -- 0:00:50
      313000 -- (-1940.510) (-1935.591) [-1937.543] (-1937.884) * (-1936.484) (-1935.050) [-1936.734] (-1935.804) -- 0:00:50
      313500 -- (-1937.366) (-1935.008) [-1935.579] (-1936.889) * [-1935.295] (-1935.663) (-1936.691) (-1935.631) -- 0:00:50
      314000 -- (-1936.891) (-1935.468) [-1935.887] (-1934.597) * (-1937.795) (-1936.225) [-1935.437] (-1935.650) -- 0:00:50
      314500 -- (-1935.597) [-1935.076] (-1936.240) (-1935.082) * (-1934.056) (-1935.886) (-1935.353) [-1936.052] -- 0:00:50
      315000 -- [-1937.299] (-1937.431) (-1936.195) (-1935.025) * (-1936.112) (-1941.382) [-1934.358] (-1937.283) -- 0:00:50

      Average standard deviation of split frequencies: 0.009976

      315500 -- (-1937.869) (-1935.386) [-1935.723] (-1935.067) * (-1935.927) (-1936.935) (-1936.013) [-1936.260] -- 0:00:49
      316000 -- (-1934.858) (-1935.391) [-1934.526] (-1936.656) * (-1936.101) (-1939.733) (-1936.634) [-1935.622] -- 0:00:49
      316500 -- (-1936.023) (-1938.338) [-1938.122] (-1940.943) * (-1935.784) [-1937.078] (-1936.866) (-1935.201) -- 0:00:49
      317000 -- [-1934.485] (-1937.250) (-1933.811) (-1936.021) * (-1935.603) [-1935.804] (-1934.695) (-1936.131) -- 0:00:49
      317500 -- (-1934.346) (-1937.301) (-1936.147) [-1937.230] * (-1939.051) (-1936.824) (-1933.312) [-1936.530] -- 0:00:49
      318000 -- [-1938.632] (-1935.747) (-1936.817) (-1936.916) * (-1936.277) [-1934.239] (-1937.797) (-1938.586) -- 0:00:49
      318500 -- (-1938.599) [-1934.597] (-1936.999) (-1937.856) * (-1936.747) [-1935.619] (-1935.835) (-1936.601) -- 0:00:49
      319000 -- (-1938.182) (-1936.439) [-1936.188] (-1935.131) * (-1933.848) [-1934.699] (-1938.448) (-1935.721) -- 0:00:49
      319500 -- (-1935.332) (-1934.580) [-1933.925] (-1933.271) * (-1937.356) (-1935.292) [-1935.439] (-1935.359) -- 0:00:48
      320000 -- (-1937.031) (-1936.238) [-1935.333] (-1934.776) * [-1935.396] (-1939.790) (-1935.123) (-1935.956) -- 0:00:48

      Average standard deviation of split frequencies: 0.009555

      320500 -- (-1935.856) (-1935.299) [-1935.968] (-1936.306) * (-1934.306) (-1938.493) [-1936.984] (-1936.122) -- 0:00:48
      321000 -- [-1935.719] (-1936.793) (-1938.656) (-1935.900) * (-1936.548) (-1937.166) [-1939.040] (-1936.921) -- 0:00:48
      321500 -- [-1937.798] (-1935.489) (-1938.641) (-1937.502) * (-1934.322) (-1936.384) [-1941.933] (-1936.297) -- 0:00:48
      322000 -- (-1937.437) (-1934.489) [-1940.355] (-1936.584) * (-1935.245) [-1937.386] (-1941.944) (-1936.091) -- 0:00:48
      322500 -- (-1936.479) (-1932.862) (-1936.951) [-1934.966] * (-1934.716) [-1938.760] (-1937.055) (-1937.337) -- 0:00:48
      323000 -- (-1934.078) (-1933.868) (-1938.967) [-1934.624] * (-1938.555) (-1934.714) [-1933.123] (-1938.120) -- 0:00:48
      323500 -- [-1935.560] (-1934.070) (-1935.857) (-1942.619) * (-1938.209) (-1935.036) [-1934.229] (-1938.115) -- 0:00:48
      324000 -- (-1933.769) [-1936.418] (-1935.574) (-1937.393) * (-1937.720) (-1933.857) [-1933.977] (-1936.628) -- 0:00:47
      324500 -- (-1934.958) (-1937.781) [-1936.541] (-1937.732) * (-1939.011) [-1934.048] (-1936.187) (-1935.150) -- 0:00:47
      325000 -- [-1935.132] (-1936.774) (-1937.098) (-1936.669) * (-1938.749) (-1936.561) [-1935.926] (-1935.128) -- 0:00:47

      Average standard deviation of split frequencies: 0.008315

      325500 -- (-1936.450) (-1935.718) [-1936.189] (-1935.034) * (-1936.550) (-1934.654) [-1937.694] (-1934.115) -- 0:00:47
      326000 -- (-1938.612) (-1933.766) [-1938.745] (-1936.325) * (-1937.083) [-1937.190] (-1938.420) (-1936.173) -- 0:00:49
      326500 -- (-1936.177) [-1939.672] (-1935.099) (-1937.006) * (-1937.413) [-1939.278] (-1935.399) (-1937.616) -- 0:00:49
      327000 -- (-1934.847) [-1936.792] (-1936.942) (-1935.088) * (-1935.289) [-1936.760] (-1938.534) (-1936.591) -- 0:00:49
      327500 -- (-1934.495) [-1936.374] (-1939.443) (-1936.174) * [-1934.746] (-1939.920) (-1936.756) (-1936.641) -- 0:00:49
      328000 -- (-1934.469) [-1937.332] (-1941.462) (-1938.064) * (-1937.924) (-1933.934) (-1937.320) [-1934.846] -- 0:00:49
      328500 -- (-1935.840) (-1939.812) [-1937.162] (-1934.935) * [-1936.484] (-1934.118) (-1934.880) (-1937.368) -- 0:00:49
      329000 -- (-1936.269) (-1940.313) (-1935.131) [-1936.570] * [-1934.052] (-1935.404) (-1934.282) (-1933.424) -- 0:00:48
      329500 -- (-1937.402) (-1936.570) (-1936.976) [-1935.667] * (-1935.135) (-1937.831) [-1936.693] (-1936.474) -- 0:00:48
      330000 -- [-1940.342] (-1934.867) (-1938.182) (-1938.604) * (-1936.237) (-1937.437) (-1937.362) [-1934.564] -- 0:00:48

      Average standard deviation of split frequencies: 0.008821

      330500 -- [-1937.548] (-1935.241) (-1936.715) (-1934.783) * [-1935.984] (-1935.402) (-1936.118) (-1936.836) -- 0:00:48
      331000 -- (-1936.813) [-1937.336] (-1939.107) (-1939.875) * (-1935.369) [-1934.159] (-1936.310) (-1937.074) -- 0:00:48
      331500 -- (-1936.563) (-1935.064) (-1940.782) [-1935.226] * [-1934.984] (-1933.192) (-1937.152) (-1934.182) -- 0:00:48
      332000 -- [-1935.307] (-1937.984) (-1937.531) (-1933.820) * (-1933.906) [-1933.841] (-1936.657) (-1938.207) -- 0:00:48
      332500 -- (-1935.641) [-1935.230] (-1937.771) (-1936.121) * (-1936.133) [-1938.019] (-1936.132) (-1937.020) -- 0:00:48
      333000 -- [-1934.337] (-1937.852) (-1936.186) (-1937.407) * (-1935.611) [-1937.012] (-1935.561) (-1936.613) -- 0:00:48
      333500 -- (-1935.260) (-1937.710) [-1935.698] (-1935.135) * (-1936.394) (-1934.768) (-1935.368) [-1935.051] -- 0:00:47
      334000 -- (-1935.179) [-1937.462] (-1937.582) (-1934.253) * (-1936.960) [-1933.612] (-1935.252) (-1939.033) -- 0:00:47
      334500 -- (-1935.112) (-1937.805) (-1938.739) [-1938.099] * (-1937.161) (-1935.155) (-1935.658) [-1934.270] -- 0:00:47
      335000 -- [-1935.751] (-1937.436) (-1935.874) (-1935.054) * (-1937.018) (-1938.664) [-1935.889] (-1935.141) -- 0:00:47

      Average standard deviation of split frequencies: 0.009295

      335500 -- (-1935.273) (-1933.952) [-1937.102] (-1938.025) * [-1936.034] (-1939.275) (-1940.356) (-1940.241) -- 0:00:47
      336000 -- (-1934.572) (-1937.227) [-1934.194] (-1936.487) * (-1939.487) (-1935.841) (-1940.394) [-1937.545] -- 0:00:47
      336500 -- (-1936.096) (-1937.704) (-1935.027) [-1936.709] * (-1939.371) [-1935.133] (-1937.575) (-1934.061) -- 0:00:47
      337000 -- (-1934.807) (-1936.095) (-1936.529) [-1935.510] * (-1935.846) [-1934.958] (-1934.178) (-1935.366) -- 0:00:47
      337500 -- (-1936.630) (-1939.185) (-1936.183) [-1934.509] * (-1935.484) [-1934.119] (-1937.647) (-1938.369) -- 0:00:47
      338000 -- (-1937.449) (-1938.252) (-1934.767) [-1937.795] * (-1934.792) (-1937.697) [-1939.793] (-1938.775) -- 0:00:47
      338500 -- (-1934.168) [-1935.220] (-1937.098) (-1933.898) * (-1933.536) [-1935.906] (-1937.965) (-1938.835) -- 0:00:46
      339000 -- [-1937.498] (-1937.145) (-1936.978) (-1934.982) * (-1934.830) (-1934.852) [-1936.340] (-1935.982) -- 0:00:46
      339500 -- (-1942.562) [-1934.898] (-1936.109) (-1936.278) * [-1933.716] (-1938.488) (-1937.948) (-1936.108) -- 0:00:46
      340000 -- (-1935.506) (-1934.358) (-1941.782) [-1937.012] * [-1934.099] (-1937.558) (-1939.291) (-1938.327) -- 0:00:46

      Average standard deviation of split frequencies: 0.011330

      340500 -- (-1934.919) (-1935.503) [-1935.288] (-1937.785) * (-1935.177) (-1935.950) (-1938.430) [-1935.350] -- 0:00:48
      341000 -- (-1933.515) (-1936.330) [-1934.812] (-1935.832) * (-1935.161) (-1935.820) [-1936.918] (-1936.117) -- 0:00:48
      341500 -- [-1934.244] (-1939.709) (-1936.136) (-1935.433) * [-1937.187] (-1935.941) (-1937.389) (-1935.843) -- 0:00:48
      342000 -- (-1936.131) [-1934.931] (-1935.678) (-1935.542) * (-1937.024) [-1935.848] (-1936.999) (-1934.007) -- 0:00:48
      342500 -- (-1934.905) (-1935.651) (-1935.783) [-1937.157] * (-1936.400) [-1935.269] (-1934.863) (-1935.935) -- 0:00:47
      343000 -- [-1935.403] (-1934.178) (-1935.411) (-1936.541) * (-1937.480) [-1935.144] (-1936.130) (-1938.705) -- 0:00:47
      343500 -- (-1933.793) [-1933.984] (-1934.092) (-1938.169) * (-1933.342) [-1941.191] (-1938.470) (-1940.247) -- 0:00:47
      344000 -- (-1935.957) (-1936.888) (-1937.100) [-1936.837] * (-1934.164) [-1938.151] (-1936.389) (-1937.817) -- 0:00:47
      344500 -- (-1935.770) (-1933.461) (-1935.824) [-1932.771] * (-1935.446) (-1939.124) (-1940.994) [-1935.460] -- 0:00:47
      345000 -- (-1936.309) (-1937.740) (-1935.814) [-1933.697] * [-1938.577] (-1939.555) (-1935.186) (-1933.413) -- 0:00:47

      Average standard deviation of split frequencies: 0.011941

      345500 -- (-1934.726) (-1935.875) (-1936.729) [-1936.472] * [-1936.968] (-1938.691) (-1937.610) (-1937.039) -- 0:00:47
      346000 -- (-1935.238) (-1933.471) (-1936.740) [-1934.604] * (-1936.239) (-1937.388) [-1935.728] (-1937.746) -- 0:00:47
      346500 -- (-1937.925) [-1933.641] (-1939.395) (-1937.247) * (-1936.218) [-1937.515] (-1937.657) (-1936.326) -- 0:00:47
      347000 -- (-1934.468) (-1933.844) [-1939.242] (-1937.011) * [-1935.536] (-1935.159) (-1936.940) (-1935.926) -- 0:00:47
      347500 -- (-1934.784) (-1933.208) (-1939.821) [-1936.463] * (-1936.167) (-1933.701) (-1935.947) [-1934.848] -- 0:00:46
      348000 -- (-1934.596) [-1934.527] (-1942.174) (-1935.288) * (-1937.748) (-1937.195) [-1937.155] (-1935.541) -- 0:00:46
      348500 -- [-1935.450] (-1935.723) (-1937.126) (-1934.533) * [-1937.325] (-1934.833) (-1942.269) (-1936.283) -- 0:00:46
      349000 -- (-1935.707) (-1935.505) [-1935.291] (-1933.511) * [-1935.043] (-1941.366) (-1936.310) (-1937.548) -- 0:00:46
      349500 -- (-1935.265) (-1936.573) (-1933.649) [-1934.524] * [-1936.307] (-1936.957) (-1941.649) (-1939.344) -- 0:00:46
      350000 -- [-1936.698] (-1935.790) (-1937.219) (-1935.677) * [-1934.774] (-1936.910) (-1938.177) (-1936.534) -- 0:00:46

      Average standard deviation of split frequencies: 0.010586

      350500 -- (-1939.184) (-1935.945) (-1936.548) [-1934.243] * (-1934.708) (-1934.839) [-1936.198] (-1938.330) -- 0:00:46
      351000 -- (-1936.399) [-1939.173] (-1935.305) (-1935.378) * (-1935.680) (-1938.877) [-1935.576] (-1935.366) -- 0:00:46
      351500 -- (-1937.026) (-1938.806) [-1943.144] (-1936.091) * [-1943.042] (-1933.455) (-1940.539) (-1936.343) -- 0:00:46
      352000 -- [-1936.063] (-1935.250) (-1936.928) (-1935.092) * [-1935.164] (-1936.783) (-1938.149) (-1933.566) -- 0:00:46
      352500 -- [-1936.944] (-1936.484) (-1935.398) (-1933.326) * (-1936.742) [-1935.694] (-1938.926) (-1933.832) -- 0:00:45
      353000 -- (-1936.394) (-1933.760) (-1934.801) [-1934.322] * [-1935.842] (-1937.053) (-1938.885) (-1934.141) -- 0:00:45
      353500 -- (-1935.919) [-1934.725] (-1934.801) (-1933.938) * (-1935.853) [-1937.564] (-1937.874) (-1940.571) -- 0:00:45
      354000 -- (-1936.405) [-1936.421] (-1935.886) (-1934.225) * (-1934.678) (-1938.625) [-1934.669] (-1936.336) -- 0:00:45
      354500 -- (-1934.974) (-1936.001) (-1935.730) [-1935.746] * [-1934.076] (-1935.488) (-1934.743) (-1933.896) -- 0:00:45
      355000 -- (-1935.265) (-1935.414) [-1939.288] (-1936.234) * [-1934.140] (-1936.720) (-1941.507) (-1934.601) -- 0:00:47

      Average standard deviation of split frequencies: 0.011564

      355500 -- (-1935.314) [-1937.156] (-1935.006) (-1937.149) * (-1937.331) (-1936.431) [-1936.115] (-1935.092) -- 0:00:47
      356000 -- (-1935.503) [-1933.199] (-1935.035) (-1936.154) * (-1938.142) [-1934.968] (-1936.265) (-1937.896) -- 0:00:47
      356500 -- (-1936.317) (-1933.582) (-1938.237) [-1935.158] * [-1935.716] (-1939.135) (-1936.726) (-1936.938) -- 0:00:46
      357000 -- (-1934.675) (-1937.972) [-1932.932] (-1938.791) * (-1936.155) (-1938.207) [-1937.861] (-1935.852) -- 0:00:46
      357500 -- [-1933.665] (-1937.658) (-1935.404) (-1937.023) * (-1934.018) (-1936.997) (-1935.893) [-1935.238] -- 0:00:46
      358000 -- (-1934.092) [-1939.623] (-1934.674) (-1935.671) * (-1937.303) (-1933.700) [-1937.718] (-1938.554) -- 0:00:46
      358500 -- (-1937.535) [-1934.417] (-1935.543) (-1936.083) * (-1934.330) (-1935.497) [-1938.038] (-1936.459) -- 0:00:46
      359000 -- (-1934.035) [-1936.000] (-1933.926) (-1934.580) * [-1934.644] (-1934.937) (-1935.514) (-1934.738) -- 0:00:46
      359500 -- (-1934.348) [-1934.143] (-1933.776) (-1936.051) * (-1938.172) (-1936.449) [-1939.654] (-1935.291) -- 0:00:46
      360000 -- (-1936.696) (-1934.259) (-1935.980) [-1935.616] * (-1934.845) [-1936.035] (-1941.328) (-1936.917) -- 0:00:46

      Average standard deviation of split frequencies: 0.011273

      360500 -- (-1934.946) (-1940.054) (-1939.672) [-1934.434] * (-1934.605) (-1936.986) [-1933.468] (-1934.899) -- 0:00:46
      361000 -- (-1936.919) [-1935.876] (-1937.557) (-1933.037) * (-1935.637) (-1936.070) (-1932.927) [-1938.839] -- 0:00:46
      361500 -- (-1938.407) (-1937.158) (-1936.894) [-1935.151] * (-1936.416) (-1937.721) [-1936.340] (-1935.943) -- 0:00:45
      362000 -- (-1933.573) (-1934.459) (-1933.889) [-1934.711] * [-1934.227] (-1938.539) (-1935.743) (-1935.559) -- 0:00:45
      362500 -- [-1936.957] (-1935.085) (-1935.542) (-1938.030) * (-1933.912) (-1935.267) [-1934.008] (-1938.281) -- 0:00:45
      363000 -- (-1937.603) [-1936.178] (-1935.974) (-1945.332) * (-1933.780) (-1933.573) (-1934.193) [-1937.286] -- 0:00:45
      363500 -- [-1934.186] (-1934.714) (-1934.512) (-1939.085) * (-1935.020) (-1936.554) (-1935.648) [-1936.600] -- 0:00:45
      364000 -- [-1934.096] (-1936.713) (-1938.100) (-1935.763) * (-1937.422) (-1934.770) [-1933.117] (-1938.548) -- 0:00:45
      364500 -- (-1935.506) (-1938.456) [-1938.779] (-1936.091) * (-1938.184) (-1935.985) (-1933.533) [-1936.035] -- 0:00:45
      365000 -- (-1935.032) (-1936.731) (-1937.931) [-1932.508] * (-1937.577) (-1939.229) [-1935.044] (-1938.873) -- 0:00:45

      Average standard deviation of split frequencies: 0.010465

      365500 -- (-1935.506) [-1935.437] (-1937.892) (-1935.148) * [-1936.488] (-1937.129) (-1934.510) (-1938.822) -- 0:00:45
      366000 -- [-1934.323] (-1934.936) (-1937.991) (-1933.855) * (-1935.810) [-1936.842] (-1935.312) (-1939.290) -- 0:00:45
      366500 -- (-1934.139) [-1935.183] (-1939.023) (-1938.658) * (-1935.707) [-1936.242] (-1938.662) (-1938.105) -- 0:00:44
      367000 -- [-1935.754] (-1937.719) (-1942.557) (-1937.292) * (-1934.756) (-1937.769) (-1939.366) [-1943.080] -- 0:00:44
      367500 -- [-1934.882] (-1938.119) (-1936.275) (-1937.443) * (-1935.269) (-1937.159) [-1935.964] (-1937.374) -- 0:00:44
      368000 -- (-1941.276) (-1934.817) (-1936.543) [-1936.454] * (-1935.801) (-1941.364) (-1943.062) [-1936.940] -- 0:00:44
      368500 -- (-1940.790) [-1937.756] (-1936.979) (-1936.258) * [-1935.764] (-1942.481) (-1937.107) (-1936.084) -- 0:00:44
      369000 -- [-1935.572] (-1934.982) (-1937.067) (-1935.769) * (-1934.608) (-1939.796) (-1936.079) [-1940.759] -- 0:00:44
      369500 -- (-1934.901) (-1936.647) [-1934.948] (-1935.996) * (-1935.479) (-1936.123) [-1935.129] (-1938.467) -- 0:00:46
      370000 -- (-1934.812) (-1936.176) [-1934.825] (-1935.634) * (-1939.339) (-1934.934) [-1932.974] (-1936.129) -- 0:00:45

      Average standard deviation of split frequencies: 0.011684

      370500 -- (-1934.979) (-1936.733) [-1933.354] (-1935.638) * [-1937.401] (-1935.788) (-1936.507) (-1934.545) -- 0:00:45
      371000 -- [-1934.501] (-1936.320) (-1934.649) (-1937.492) * [-1936.953] (-1935.759) (-1934.474) (-1936.000) -- 0:00:45
      371500 -- [-1935.819] (-1936.954) (-1934.291) (-1936.135) * [-1934.504] (-1935.744) (-1933.327) (-1935.310) -- 0:00:45
      372000 -- (-1936.797) (-1937.448) (-1936.179) [-1935.731] * (-1936.258) (-1934.734) (-1936.254) [-1935.239] -- 0:00:45
      372500 -- [-1938.034] (-1937.323) (-1938.804) (-1936.484) * (-1936.740) [-1933.778] (-1936.520) (-1935.763) -- 0:00:45
      373000 -- (-1943.545) [-1935.624] (-1938.926) (-1939.337) * (-1934.328) (-1935.435) [-1937.467] (-1937.493) -- 0:00:45
      373500 -- (-1939.505) [-1935.242] (-1934.791) (-1934.474) * [-1935.437] (-1938.616) (-1935.985) (-1937.325) -- 0:00:45
      374000 -- (-1934.507) (-1934.631) [-1932.850] (-1936.198) * (-1938.014) (-1934.484) [-1936.508] (-1936.270) -- 0:00:45
      374500 -- (-1940.240) (-1936.887) (-1936.089) [-1937.766] * [-1935.478] (-1935.711) (-1935.421) (-1940.578) -- 0:00:45
      375000 -- [-1937.027] (-1935.092) (-1937.538) (-1940.082) * [-1933.538] (-1935.066) (-1935.290) (-1940.786) -- 0:00:45

      Average standard deviation of split frequencies: 0.010970

      375500 -- [-1933.788] (-1935.106) (-1938.579) (-1938.385) * (-1936.811) (-1938.503) (-1937.934) [-1942.828] -- 0:00:44
      376000 -- (-1935.412) (-1934.840) (-1935.169) [-1935.090] * [-1934.080] (-1938.062) (-1938.834) (-1939.864) -- 0:00:44
      376500 -- (-1935.717) (-1934.405) (-1936.448) [-1935.645] * (-1934.355) (-1936.963) (-1936.786) [-1939.408] -- 0:00:44
      377000 -- (-1939.631) (-1935.373) (-1935.133) [-1935.555] * (-1934.206) (-1938.440) (-1936.499) [-1939.529] -- 0:00:44
      377500 -- (-1935.610) [-1935.148] (-1935.516) (-1933.559) * (-1936.115) [-1935.213] (-1937.407) (-1934.543) -- 0:00:44
      378000 -- [-1936.212] (-1936.484) (-1935.642) (-1934.699) * (-1935.778) [-1933.808] (-1938.814) (-1935.024) -- 0:00:44
      378500 -- (-1939.104) [-1933.679] (-1936.150) (-1935.579) * [-1938.426] (-1937.332) (-1938.099) (-1939.259) -- 0:00:44
      379000 -- (-1935.932) (-1936.182) [-1936.472] (-1936.136) * [-1935.441] (-1936.584) (-1935.424) (-1941.140) -- 0:00:44
      379500 -- (-1937.486) [-1936.500] (-1935.751) (-1937.587) * (-1935.192) (-1936.312) [-1934.059] (-1941.278) -- 0:00:44
      380000 -- [-1937.126] (-1936.156) (-193