--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:37:59 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/topA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/12res/topA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/topA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/12res/topA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -3883.18         -3886.51
2      -3883.19         -3885.76
--------------------------------------
TOTAL    -3883.19         -3886.20
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/12res/topA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/topA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/topA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.894441    0.085407    0.374144    1.474479    0.869245   1423.70   1462.35    1.000
r(A<->C){all}   0.171850    0.021120    0.000054    0.461412    0.135646    167.46    196.03    1.000
r(A<->G){all}   0.156648    0.018009    0.000130    0.433578    0.119493    169.99    233.51    1.001
r(A<->T){all}   0.174681    0.022373    0.000009    0.480530    0.136053    312.35    312.41    1.005
r(C<->G){all}   0.163141    0.019250    0.000073    0.445442    0.130037    243.13    289.83    1.007
r(C<->T){all}   0.170421    0.018709    0.000035    0.445491    0.139758    259.10    289.11    1.009
r(G<->T){all}   0.163259    0.020057    0.000042    0.447016    0.124811    173.80    192.52    1.004
pi(A){all}      0.209146    0.000058    0.194831    0.224306    0.209204   1253.97   1377.48    1.000
pi(C){all}      0.288027    0.000074    0.270819    0.304158    0.287947   1084.01   1241.05    1.000
pi(G){all}      0.309888    0.000077    0.292609    0.326139    0.309715   1266.78   1295.88    1.000
pi(T){all}      0.192940    0.000056    0.178213    0.207694    0.192878    977.35   1019.78    1.000
alpha{1,2}      0.425505    0.219183    0.000106    1.373300    0.258970   1375.71   1397.15    1.000
alpha{3}        0.473168    0.243128    0.000202    1.458095    0.310808   1250.41   1375.70    1.000
pinvar{all}     0.999498    0.000000    0.998418    1.000000    0.999695    846.53    922.46    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-3771.201696
Model 2: PositiveSelection	-3771.20212
Model 0: one-ratio	-3771.202115
Model 7: beta	-3771.201696
Model 8: beta&w>1	-3771.201697


Model 0 vs 1	8.379999999306165E-4

Model 2 vs 1	8.479999996779952E-4

Model 8 vs 7	1.99999976757681E-6
>C1
MKGPRGSRSGRNGSPRRLVIVESPTKARKLSGYLGSAYIVESSRGHIRDL
PRTAADVPAKFKSEPWARLGVNVDADFEPLYIITPEKKSTVTELKGLLQG
VDELYLATDGDREGEAIAWHLMQTLKPRVPVKRMVFHEITEHAILAAAAH
PRELDIDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRI
IVQRERDRMAFCSAVYWDIVAKLDASVSDPTAQPLTFVARLTAVDGLRVA
TGRDFGAMGTLRGDCEVSKIIVLDDLTATTLAAGLRGAQLTVASAEEKLY
TRRPYPPFMTSTLQQEAGRKLRFSAERTMSIAQRLYENGYITYMRTDSTT
LSESAINAARTQARQLYGEEYVSDSPRQYTRKVKNAQEAHEAIRPAGETF
ATPDAVCNELDGDEFRIYELVWRRTVASQMADARGTTLSLRIEGRAGEQH
VVFSASGRTLTFPGFLKAYVETVDELAGGEADDAERRLPHLTSGQLLDVI
DLTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTVQDRGYVQK
KGSALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIANGNEQRTN
WLNNFYFGGNHGVSDSIARSGGLKKLVGVNIEGIDAREVNSIKLFDDEHG
RPVYVRVGKTGPYLERLLAGDDGELTPQRANLNGTLTPDELTLEVAEELF
ATPHEGRVLGVDPETGHEIVAKDGRYGPYVTEVLPKHDDDYGAADQGTKK
TKKGRRASASQGPKPRTGSLLRSMDLQTITLEDALKLLLLPRVVGVDPAS
GEEITAQNGRYGPYLKRGKDSRPLTTEDQMFIITLDEALKIYAEPKRAGR
QSTSPPPLRELGTDPTSGKPMLIKDGRFGPYVTDGETNASLRKGDDVVSI
TDERAAELLADRRARGPVKRPAKKARKVPAKKAARLAPARGISQSPR
>C2
MKGPRGSRSGRNGSPRRLVIVESPTKARKLSGYLGSAYIVESSRGHIRDL
PRTAADVPAKFKSEPWARLGVNVDADFEPLYIITPEKKSTVTELKGLLQG
VDELYLATDGDREGEAIAWHLMQTLKPRVPVKRMVFHEITEHAILAAAAH
PRELDIDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRI
IVQRERDRMAFCSAVYWDIVAKLDASVSDPTAQPLTFVARLTAVDGLRVA
TGRDFGAMGTLRGDCEVSKIIVLDDLTATTLAAGLRGAQLTVASAEEKLY
TRRPYPPFMTSTLQQEAGRKLRFSAERTMSIAQRLYENGYITYMRTDSTT
LSESAINAARTQARQLYGEEYVSDSPRQYTRKVKNAQEAHEAIRPAGETF
ATPDAVCNELDGDEFRIYELVWRRTVASQMADARGTTLSLRIEGRAGEQH
VVFSASGRTLTFPGFLKAYVETVDELAGGEADDAERRLPHLTSGQLLDVI
DLTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTVQDRGYVQK
KGSALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIANGNEQRTN
WLNNFYFGGNHGVSDSIARSGGLKKLVGVNIEGIDAREVNSIKLFDDEHG
RPVYVRVGKTGPYLERLLAGDDGELTPQRANLNGTLTPDELTLEVAEELF
ATPHEGRVLGVDPETGHEIVAKDGRYGPYVTEVLPKHDDDYGAADQGTKK
TKKGRRASASQGPKPRTGSLLRSMDLQTITLEDALKLLLLPRVVGVDPAS
GEEITAQNGRYGPYLKRGKDSRPLTTEDQMFIITLDEALKIYAEPKRAGR
QSTSPPPLRELGTDPTSGKPMLIKDGRFGPYVTDGETNASLRKGDDVVSI
TDERAAELLADRRARGPVKRPAKKARKVPAKKAARLAPARGISQSPR
>C3
MKGPRGSRSGRNGSPRRLVIVESPTKARKLSGYLGSAYIVESSRGHIRDL
PRTAADVPAKFKSEPWARLGVNVDADFEPLYIITPEKKSTVTELKGLLQG
VDELYLATDGDREGEAIAWHLMQTLKPRVPVKRMVFHEITEHAILAAAAH
PRELDIDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRI
IVQRERDRMAFCSAVYWDIVAKLDASVSDPTAQPLTFVARLTAVDGLRVA
TGRDFGAMGTLRGDCEVSKIIVLDDLTATTLAAGLRGAQLTVASAEEKLY
TRRPYPPFMTSTLQQEAGRKLRFSAERTMSIAQRLYENGYITYMRTDSTT
LSESAINAARTQARQLYGEEYVSDSPRQYTRKVKNAQEAHEAIRPAGETF
ATPDAVCNELDGDEFRIYELVWRRTVASQMADARGTTLSLRIEGRAGEQH
VVFSASGRTLTFPGFLKAYVETVDELAGGEADDAERRLPHLTSGQLLDVI
DLTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTVQDRGYVQK
KGSALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIANGNEQRTN
WLNNFYFGGNHGVSDSIARSGGLKKLVGVNIEGIDAREVNSIKLFDDEHG
RPVYVRVGKTGPYLERLLAGDDGELTPQRANLNGTLTPDELTLEVAEELF
ATPHEGRVLGVDPETGHEIVAKDGRYGPYVTEVLPKHDDDYGAADQGTKK
TKKGRRASASQGPKPRTGSLLRSMDLQTITLEDALKLLLLPRVVGVDPAS
GEEITAQNGRYGPYLKRGKDSRPLTTEDQMFIITLDEALKIYAEPKRAGR
QSTSPPPLRELGTDPTSGKPMLIKDGRFGPYVTDGETNASLRKGDDVVSI
TDERAAELLADRRARGPVKRPAKKARKVPAKKAARLAPARGISQSPR
>C4
MKGPRGSRSGRNGSPRRLVIVESPTKARKLSGYLGSAYIVESSRGHIRDL
PRTAADVPAKFKSEPWARLGVNVDADFEPLYIITPEKKSTVTELKGLLQG
VDELYLATDGDREGEAIAWHLMQTLKPRVPVKRMVFHEITEHAILAAAAH
PRELDIDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRI
IVQRERDRMAFCSAVYWDIVAKLDASVSDPTAQPLTFVARLTAVDGLRVA
TGRDFGAMGTLRGDCEVSKIIVLDDLTATTLAAGLRGAQLTVASAEEKLY
TRRPYPPFMTSTLQQEAGRKLRFSAERTMSIAQRLYENGYITYMRTDSTT
LSESAINAARTQARQLYGEEYVSDSPRQYTRKVKNAQEAHEAIRPAGETF
ATPDAVCNELDGDEFRIYELVWRRTVASQMADARGTTLSLRIEGRAGEQH
VVFSASGRTLTFPGFLKAYVETVDELAGGEADDAERRLPHLTSGQLLDVI
DLTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTVQDRGYVQK
KGSALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIANGNEQRTN
WLNNFYFGGNHGVSDSIARSGGLKKLVGVNIEGIDAREVNSIKLFDDEHG
RPVYVRVGKTGPYLERLLAGDDGELTPQRANLNGTLTPDELTLEVAEELF
ATPHEGRVLGVDPETGHEIVAKDGRYGPYVTEVLPKHDDDYGAADQGTKK
TKKGRRASASQGPKPRTGSLLRSMDLQTITLEDALKLLLLPRVVGVDPAS
GEEITAQNGRYGPYLKRGKDSRPLTTEDQMFIITLDEALKIYAEPKRAGR
QSTSPPPLRELGTDPTSGKPMLIKDGRFGPYVTDGETNASLRKGDDVVSI
TDERAAELLADRRARGPVKRPAKKARKVPAKKAARLAPARGISQSPR
>C5
MKGPRGSRSGRNGSPRRLVIVESPTKARKLSGYLGSAYIVESSRGHIRDL
PRTAADVPAKFKSEPWARLGVNVDADFEPLYIITPEKKSTVTELKGLLQG
VDELYLATDGDREGEAIAWHLMQTLKPRVPVKRMVFHEITEHAILAAAAH
PRELDIDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRI
IVQRERDRMAFCSAVYWDIVAKLDASVSDPTAQPLTFVARLTAVDGLRVA
TGRDFGAMGTLRGDCEVSKIIVLDDLTATTLAAGLRGAQLTVASAEEKLY
TRRPYPPFMTSTLQQEAGRKLRFSAERTMSIAQRLYENGYITYMRTDSTT
LSESAINAARTQARQLYGEEYVSDSPRQYTRKVKNAQEAHEAIRPAGETF
ATPDAVCNELDGDEFRIYELVWRRTVASQMADARGTTLSLRIEGRAGEQH
VVFSASGRTLTFPGFLKAYVETVDELAGGEADDAERRLPHLTSGQLLDVI
DLTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTVQDRGYVQK
KGSALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIANGNEQRTN
WLNNFYFGGNHGVSDSIARSGGLKKLVGVNIEGIDAREVNSIKLFDDEHG
RPVYVRVGKTGPYLERLLAGDDGELTPQRANLNGTLTPDELTLEVAEELF
ATPHEGRVLGVDPETGHEIVAKDGRYGPYVTEVLPKHDDDYGAADQGTKK
TKKGRRASASQGPKPRTGSLLRSMDLQTITLEDALKLLLLPRVVGVDPAS
GEEITAQNGRYGPYLKRGKDSRPLTTEDQMFIITLDEALKIYAEPKRAGR
QSTSPPPLRELGTDPTSGKPMLIKDGRFGPYVTDGETNASLRKGDDVVSI
TDERAAELLADRRARGPVKRPAKKARKVPAKKAARLAPARGISQSPR
>C6
MKGPRGSRSGRNGSPRRLVIVESPTKARKLSGYLGSAYIVESSRGHIRDL
PRTAADVPAKFKSEPWARLGVNVDADFEPLYIITPEKKSTVTELKGLLQG
VDELYLATDGDREGEAIAWHLMQTLKPRVPVKRMVFHEITEHAILAAAAH
PRELDIDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRI
IVQRERDRMAFCSAVYWDIVAKLDASVSDPTAQPLTFVARLTAVDGLRVA
TGRDFGAMGTLRGDCEVSKIIVLDDLTATTLAAGLRGAQLTVASAEEKLY
TRRPYPPFMTSTLQQEAGRKLRFSAERTMSIAQRLYENGYITYMRTDSTT
LSESAINAARTQARQLYGEEYVSDSPRQYTRKVKNAQEAHEAIRPAGETF
ATPDAVCNELDGDEFRIYELVWRRTVASQMADARGTTLSLRIEGRAGEQH
VVFSASGRTLTFPGFLKAYVETVDELAGGEADDAERRLPHLTSGQLLDVI
DLTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTVQDRGYVQK
KGSALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIANGNEQRTN
WLNNFYFGGNHGVSDSIARSGGLKKLVGVNIEGIDAREVNSIKLFDDEHG
RPVYVRVGKTGPYLERLLAGDDGELTPQRANLNGTLTPDELTLEVAEELF
ATPHEGRVLGVDPETGHEIVAKDGRYGPYVTEVLPKHDDDYGAADQGTKK
TKKGRRASASQGPKPRTGSLLRSMDLQTITLEDALKLLLLPRVVGVDPAS
GEEITAQNGRYGPYLKRGKDSRPLTTEDQMFIITLDEALKIYAEPKRAGR
QSTSPPPLRELGTDPTSGKPMLIKDGRFGPYVTDGETNASLRKGDDVVSI
TDERAAELLADRRARGPVKRPAKKARKVPAKKAARLAPARGISQSPR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=947 

C1              MKGPRGSRSGRNGSPRRLVIVESPTKARKLSGYLGSAYIVESSRGHIRDL
C2              MKGPRGSRSGRNGSPRRLVIVESPTKARKLSGYLGSAYIVESSRGHIRDL
C3              MKGPRGSRSGRNGSPRRLVIVESPTKARKLSGYLGSAYIVESSRGHIRDL
C4              MKGPRGSRSGRNGSPRRLVIVESPTKARKLSGYLGSAYIVESSRGHIRDL
C5              MKGPRGSRSGRNGSPRRLVIVESPTKARKLSGYLGSAYIVESSRGHIRDL
C6              MKGPRGSRSGRNGSPRRLVIVESPTKARKLSGYLGSAYIVESSRGHIRDL
                **************************************************

C1              PRTAADVPAKFKSEPWARLGVNVDADFEPLYIITPEKKSTVTELKGLLQG
C2              PRTAADVPAKFKSEPWARLGVNVDADFEPLYIITPEKKSTVTELKGLLQG
C3              PRTAADVPAKFKSEPWARLGVNVDADFEPLYIITPEKKSTVTELKGLLQG
C4              PRTAADVPAKFKSEPWARLGVNVDADFEPLYIITPEKKSTVTELKGLLQG
C5              PRTAADVPAKFKSEPWARLGVNVDADFEPLYIITPEKKSTVTELKGLLQG
C6              PRTAADVPAKFKSEPWARLGVNVDADFEPLYIITPEKKSTVTELKGLLQG
                **************************************************

C1              VDELYLATDGDREGEAIAWHLMQTLKPRVPVKRMVFHEITEHAILAAAAH
C2              VDELYLATDGDREGEAIAWHLMQTLKPRVPVKRMVFHEITEHAILAAAAH
C3              VDELYLATDGDREGEAIAWHLMQTLKPRVPVKRMVFHEITEHAILAAAAH
C4              VDELYLATDGDREGEAIAWHLMQTLKPRVPVKRMVFHEITEHAILAAAAH
C5              VDELYLATDGDREGEAIAWHLMQTLKPRVPVKRMVFHEITEHAILAAAAH
C6              VDELYLATDGDREGEAIAWHLMQTLKPRVPVKRMVFHEITEHAILAAAAH
                **************************************************

C1              PRELDIDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRI
C2              PRELDIDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRI
C3              PRELDIDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRI
C4              PRELDIDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRI
C5              PRELDIDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRI
C6              PRELDIDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRI
                **************************************************

C1              IVQRERDRMAFCSAVYWDIVAKLDASVSDPTAQPLTFVARLTAVDGLRVA
C2              IVQRERDRMAFCSAVYWDIVAKLDASVSDPTAQPLTFVARLTAVDGLRVA
C3              IVQRERDRMAFCSAVYWDIVAKLDASVSDPTAQPLTFVARLTAVDGLRVA
C4              IVQRERDRMAFCSAVYWDIVAKLDASVSDPTAQPLTFVARLTAVDGLRVA
C5              IVQRERDRMAFCSAVYWDIVAKLDASVSDPTAQPLTFVARLTAVDGLRVA
C6              IVQRERDRMAFCSAVYWDIVAKLDASVSDPTAQPLTFVARLTAVDGLRVA
                **************************************************

C1              TGRDFGAMGTLRGDCEVSKIIVLDDLTATTLAAGLRGAQLTVASAEEKLY
C2              TGRDFGAMGTLRGDCEVSKIIVLDDLTATTLAAGLRGAQLTVASAEEKLY
C3              TGRDFGAMGTLRGDCEVSKIIVLDDLTATTLAAGLRGAQLTVASAEEKLY
C4              TGRDFGAMGTLRGDCEVSKIIVLDDLTATTLAAGLRGAQLTVASAEEKLY
C5              TGRDFGAMGTLRGDCEVSKIIVLDDLTATTLAAGLRGAQLTVASAEEKLY
C6              TGRDFGAMGTLRGDCEVSKIIVLDDLTATTLAAGLRGAQLTVASAEEKLY
                **************************************************

C1              TRRPYPPFMTSTLQQEAGRKLRFSAERTMSIAQRLYENGYITYMRTDSTT
C2              TRRPYPPFMTSTLQQEAGRKLRFSAERTMSIAQRLYENGYITYMRTDSTT
C3              TRRPYPPFMTSTLQQEAGRKLRFSAERTMSIAQRLYENGYITYMRTDSTT
C4              TRRPYPPFMTSTLQQEAGRKLRFSAERTMSIAQRLYENGYITYMRTDSTT
C5              TRRPYPPFMTSTLQQEAGRKLRFSAERTMSIAQRLYENGYITYMRTDSTT
C6              TRRPYPPFMTSTLQQEAGRKLRFSAERTMSIAQRLYENGYITYMRTDSTT
                **************************************************

C1              LSESAINAARTQARQLYGEEYVSDSPRQYTRKVKNAQEAHEAIRPAGETF
C2              LSESAINAARTQARQLYGEEYVSDSPRQYTRKVKNAQEAHEAIRPAGETF
C3              LSESAINAARTQARQLYGEEYVSDSPRQYTRKVKNAQEAHEAIRPAGETF
C4              LSESAINAARTQARQLYGEEYVSDSPRQYTRKVKNAQEAHEAIRPAGETF
C5              LSESAINAARTQARQLYGEEYVSDSPRQYTRKVKNAQEAHEAIRPAGETF
C6              LSESAINAARTQARQLYGEEYVSDSPRQYTRKVKNAQEAHEAIRPAGETF
                **************************************************

C1              ATPDAVCNELDGDEFRIYELVWRRTVASQMADARGTTLSLRIEGRAGEQH
C2              ATPDAVCNELDGDEFRIYELVWRRTVASQMADARGTTLSLRIEGRAGEQH
C3              ATPDAVCNELDGDEFRIYELVWRRTVASQMADARGTTLSLRIEGRAGEQH
C4              ATPDAVCNELDGDEFRIYELVWRRTVASQMADARGTTLSLRIEGRAGEQH
C5              ATPDAVCNELDGDEFRIYELVWRRTVASQMADARGTTLSLRIEGRAGEQH
C6              ATPDAVCNELDGDEFRIYELVWRRTVASQMADARGTTLSLRIEGRAGEQH
                **************************************************

C1              VVFSASGRTLTFPGFLKAYVETVDELAGGEADDAERRLPHLTSGQLLDVI
C2              VVFSASGRTLTFPGFLKAYVETVDELAGGEADDAERRLPHLTSGQLLDVI
C3              VVFSASGRTLTFPGFLKAYVETVDELAGGEADDAERRLPHLTSGQLLDVI
C4              VVFSASGRTLTFPGFLKAYVETVDELAGGEADDAERRLPHLTSGQLLDVI
C5              VVFSASGRTLTFPGFLKAYVETVDELAGGEADDAERRLPHLTSGQLLDVI
C6              VVFSASGRTLTFPGFLKAYVETVDELAGGEADDAERRLPHLTSGQLLDVI
                **************************************************

C1              DLTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTVQDRGYVQK
C2              DLTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTVQDRGYVQK
C3              DLTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTVQDRGYVQK
C4              DLTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTVQDRGYVQK
C5              DLTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTVQDRGYVQK
C6              DLTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTVQDRGYVQK
                **************************************************

C1              KGSALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIANGNEQRTN
C2              KGSALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIANGNEQRTN
C3              KGSALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIANGNEQRTN
C4              KGSALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIANGNEQRTN
C5              KGSALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIANGNEQRTN
C6              KGSALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIANGNEQRTN
                **************************************************

C1              WLNNFYFGGNHGVSDSIARSGGLKKLVGVNIEGIDAREVNSIKLFDDEHG
C2              WLNNFYFGGNHGVSDSIARSGGLKKLVGVNIEGIDAREVNSIKLFDDEHG
C3              WLNNFYFGGNHGVSDSIARSGGLKKLVGVNIEGIDAREVNSIKLFDDEHG
C4              WLNNFYFGGNHGVSDSIARSGGLKKLVGVNIEGIDAREVNSIKLFDDEHG
C5              WLNNFYFGGNHGVSDSIARSGGLKKLVGVNIEGIDAREVNSIKLFDDEHG
C6              WLNNFYFGGNHGVSDSIARSGGLKKLVGVNIEGIDAREVNSIKLFDDEHG
                **************************************************

C1              RPVYVRVGKTGPYLERLLAGDDGELTPQRANLNGTLTPDELTLEVAEELF
C2              RPVYVRVGKTGPYLERLLAGDDGELTPQRANLNGTLTPDELTLEVAEELF
C3              RPVYVRVGKTGPYLERLLAGDDGELTPQRANLNGTLTPDELTLEVAEELF
C4              RPVYVRVGKTGPYLERLLAGDDGELTPQRANLNGTLTPDELTLEVAEELF
C5              RPVYVRVGKTGPYLERLLAGDDGELTPQRANLNGTLTPDELTLEVAEELF
C6              RPVYVRVGKTGPYLERLLAGDDGELTPQRANLNGTLTPDELTLEVAEELF
                **************************************************

C1              ATPHEGRVLGVDPETGHEIVAKDGRYGPYVTEVLPKHDDDYGAADQGTKK
C2              ATPHEGRVLGVDPETGHEIVAKDGRYGPYVTEVLPKHDDDYGAADQGTKK
C3              ATPHEGRVLGVDPETGHEIVAKDGRYGPYVTEVLPKHDDDYGAADQGTKK
C4              ATPHEGRVLGVDPETGHEIVAKDGRYGPYVTEVLPKHDDDYGAADQGTKK
C5              ATPHEGRVLGVDPETGHEIVAKDGRYGPYVTEVLPKHDDDYGAADQGTKK
C6              ATPHEGRVLGVDPETGHEIVAKDGRYGPYVTEVLPKHDDDYGAADQGTKK
                **************************************************

C1              TKKGRRASASQGPKPRTGSLLRSMDLQTITLEDALKLLLLPRVVGVDPAS
C2              TKKGRRASASQGPKPRTGSLLRSMDLQTITLEDALKLLLLPRVVGVDPAS
C3              TKKGRRASASQGPKPRTGSLLRSMDLQTITLEDALKLLLLPRVVGVDPAS
C4              TKKGRRASASQGPKPRTGSLLRSMDLQTITLEDALKLLLLPRVVGVDPAS
C5              TKKGRRASASQGPKPRTGSLLRSMDLQTITLEDALKLLLLPRVVGVDPAS
C6              TKKGRRASASQGPKPRTGSLLRSMDLQTITLEDALKLLLLPRVVGVDPAS
                **************************************************

C1              GEEITAQNGRYGPYLKRGKDSRPLTTEDQMFIITLDEALKIYAEPKRAGR
C2              GEEITAQNGRYGPYLKRGKDSRPLTTEDQMFIITLDEALKIYAEPKRAGR
C3              GEEITAQNGRYGPYLKRGKDSRPLTTEDQMFIITLDEALKIYAEPKRAGR
C4              GEEITAQNGRYGPYLKRGKDSRPLTTEDQMFIITLDEALKIYAEPKRAGR
C5              GEEITAQNGRYGPYLKRGKDSRPLTTEDQMFIITLDEALKIYAEPKRAGR
C6              GEEITAQNGRYGPYLKRGKDSRPLTTEDQMFIITLDEALKIYAEPKRAGR
                **************************************************

C1              QSTSPPPLRELGTDPTSGKPMLIKDGRFGPYVTDGETNASLRKGDDVVSI
C2              QSTSPPPLRELGTDPTSGKPMLIKDGRFGPYVTDGETNASLRKGDDVVSI
C3              QSTSPPPLRELGTDPTSGKPMLIKDGRFGPYVTDGETNASLRKGDDVVSI
C4              QSTSPPPLRELGTDPTSGKPMLIKDGRFGPYVTDGETNASLRKGDDVVSI
C5              QSTSPPPLRELGTDPTSGKPMLIKDGRFGPYVTDGETNASLRKGDDVVSI
C6              QSTSPPPLRELGTDPTSGKPMLIKDGRFGPYVTDGETNASLRKGDDVVSI
                **************************************************

C1              TDERAAELLADRRARGPVKRPAKKARKVPAKKAARLAPARGISQSPR
C2              TDERAAELLADRRARGPVKRPAKKARKVPAKKAARLAPARGISQSPR
C3              TDERAAELLADRRARGPVKRPAKKARKVPAKKAARLAPARGISQSPR
C4              TDERAAELLADRRARGPVKRPAKKARKVPAKKAARLAPARGISQSPR
C5              TDERAAELLADRRARGPVKRPAKKARKVPAKKAARLAPARGISQSPR
C6              TDERAAELLADRRARGPVKRPAKKARKVPAKKAARLAPARGISQSPR
                ***********************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  947 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  947 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28410]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [28410]--->[28410]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.664 Mb, Max= 31.673 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MKGPRGSRSGRNGSPRRLVIVESPTKARKLSGYLGSAYIVESSRGHIRDL
C2              MKGPRGSRSGRNGSPRRLVIVESPTKARKLSGYLGSAYIVESSRGHIRDL
C3              MKGPRGSRSGRNGSPRRLVIVESPTKARKLSGYLGSAYIVESSRGHIRDL
C4              MKGPRGSRSGRNGSPRRLVIVESPTKARKLSGYLGSAYIVESSRGHIRDL
C5              MKGPRGSRSGRNGSPRRLVIVESPTKARKLSGYLGSAYIVESSRGHIRDL
C6              MKGPRGSRSGRNGSPRRLVIVESPTKARKLSGYLGSAYIVESSRGHIRDL
                **************************************************

C1              PRTAADVPAKFKSEPWARLGVNVDADFEPLYIITPEKKSTVTELKGLLQG
C2              PRTAADVPAKFKSEPWARLGVNVDADFEPLYIITPEKKSTVTELKGLLQG
C3              PRTAADVPAKFKSEPWARLGVNVDADFEPLYIITPEKKSTVTELKGLLQG
C4              PRTAADVPAKFKSEPWARLGVNVDADFEPLYIITPEKKSTVTELKGLLQG
C5              PRTAADVPAKFKSEPWARLGVNVDADFEPLYIITPEKKSTVTELKGLLQG
C6              PRTAADVPAKFKSEPWARLGVNVDADFEPLYIITPEKKSTVTELKGLLQG
                **************************************************

C1              VDELYLATDGDREGEAIAWHLMQTLKPRVPVKRMVFHEITEHAILAAAAH
C2              VDELYLATDGDREGEAIAWHLMQTLKPRVPVKRMVFHEITEHAILAAAAH
C3              VDELYLATDGDREGEAIAWHLMQTLKPRVPVKRMVFHEITEHAILAAAAH
C4              VDELYLATDGDREGEAIAWHLMQTLKPRVPVKRMVFHEITEHAILAAAAH
C5              VDELYLATDGDREGEAIAWHLMQTLKPRVPVKRMVFHEITEHAILAAAAH
C6              VDELYLATDGDREGEAIAWHLMQTLKPRVPVKRMVFHEITEHAILAAAAH
                **************************************************

C1              PRELDIDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRI
C2              PRELDIDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRI
C3              PRELDIDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRI
C4              PRELDIDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRI
C5              PRELDIDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRI
C6              PRELDIDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRI
                **************************************************

C1              IVQRERDRMAFCSAVYWDIVAKLDASVSDPTAQPLTFVARLTAVDGLRVA
C2              IVQRERDRMAFCSAVYWDIVAKLDASVSDPTAQPLTFVARLTAVDGLRVA
C3              IVQRERDRMAFCSAVYWDIVAKLDASVSDPTAQPLTFVARLTAVDGLRVA
C4              IVQRERDRMAFCSAVYWDIVAKLDASVSDPTAQPLTFVARLTAVDGLRVA
C5              IVQRERDRMAFCSAVYWDIVAKLDASVSDPTAQPLTFVARLTAVDGLRVA
C6              IVQRERDRMAFCSAVYWDIVAKLDASVSDPTAQPLTFVARLTAVDGLRVA
                **************************************************

C1              TGRDFGAMGTLRGDCEVSKIIVLDDLTATTLAAGLRGAQLTVASAEEKLY
C2              TGRDFGAMGTLRGDCEVSKIIVLDDLTATTLAAGLRGAQLTVASAEEKLY
C3              TGRDFGAMGTLRGDCEVSKIIVLDDLTATTLAAGLRGAQLTVASAEEKLY
C4              TGRDFGAMGTLRGDCEVSKIIVLDDLTATTLAAGLRGAQLTVASAEEKLY
C5              TGRDFGAMGTLRGDCEVSKIIVLDDLTATTLAAGLRGAQLTVASAEEKLY
C6              TGRDFGAMGTLRGDCEVSKIIVLDDLTATTLAAGLRGAQLTVASAEEKLY
                **************************************************

C1              TRRPYPPFMTSTLQQEAGRKLRFSAERTMSIAQRLYENGYITYMRTDSTT
C2              TRRPYPPFMTSTLQQEAGRKLRFSAERTMSIAQRLYENGYITYMRTDSTT
C3              TRRPYPPFMTSTLQQEAGRKLRFSAERTMSIAQRLYENGYITYMRTDSTT
C4              TRRPYPPFMTSTLQQEAGRKLRFSAERTMSIAQRLYENGYITYMRTDSTT
C5              TRRPYPPFMTSTLQQEAGRKLRFSAERTMSIAQRLYENGYITYMRTDSTT
C6              TRRPYPPFMTSTLQQEAGRKLRFSAERTMSIAQRLYENGYITYMRTDSTT
                **************************************************

C1              LSESAINAARTQARQLYGEEYVSDSPRQYTRKVKNAQEAHEAIRPAGETF
C2              LSESAINAARTQARQLYGEEYVSDSPRQYTRKVKNAQEAHEAIRPAGETF
C3              LSESAINAARTQARQLYGEEYVSDSPRQYTRKVKNAQEAHEAIRPAGETF
C4              LSESAINAARTQARQLYGEEYVSDSPRQYTRKVKNAQEAHEAIRPAGETF
C5              LSESAINAARTQARQLYGEEYVSDSPRQYTRKVKNAQEAHEAIRPAGETF
C6              LSESAINAARTQARQLYGEEYVSDSPRQYTRKVKNAQEAHEAIRPAGETF
                **************************************************

C1              ATPDAVCNELDGDEFRIYELVWRRTVASQMADARGTTLSLRIEGRAGEQH
C2              ATPDAVCNELDGDEFRIYELVWRRTVASQMADARGTTLSLRIEGRAGEQH
C3              ATPDAVCNELDGDEFRIYELVWRRTVASQMADARGTTLSLRIEGRAGEQH
C4              ATPDAVCNELDGDEFRIYELVWRRTVASQMADARGTTLSLRIEGRAGEQH
C5              ATPDAVCNELDGDEFRIYELVWRRTVASQMADARGTTLSLRIEGRAGEQH
C6              ATPDAVCNELDGDEFRIYELVWRRTVASQMADARGTTLSLRIEGRAGEQH
                **************************************************

C1              VVFSASGRTLTFPGFLKAYVETVDELAGGEADDAERRLPHLTSGQLLDVI
C2              VVFSASGRTLTFPGFLKAYVETVDELAGGEADDAERRLPHLTSGQLLDVI
C3              VVFSASGRTLTFPGFLKAYVETVDELAGGEADDAERRLPHLTSGQLLDVI
C4              VVFSASGRTLTFPGFLKAYVETVDELAGGEADDAERRLPHLTSGQLLDVI
C5              VVFSASGRTLTFPGFLKAYVETVDELAGGEADDAERRLPHLTSGQLLDVI
C6              VVFSASGRTLTFPGFLKAYVETVDELAGGEADDAERRLPHLTSGQLLDVI
                **************************************************

C1              DLTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTVQDRGYVQK
C2              DLTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTVQDRGYVQK
C3              DLTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTVQDRGYVQK
C4              DLTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTVQDRGYVQK
C5              DLTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTVQDRGYVQK
C6              DLTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTVQDRGYVQK
                **************************************************

C1              KGSALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIANGNEQRTN
C2              KGSALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIANGNEQRTN
C3              KGSALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIANGNEQRTN
C4              KGSALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIANGNEQRTN
C5              KGSALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIANGNEQRTN
C6              KGSALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIANGNEQRTN
                **************************************************

C1              WLNNFYFGGNHGVSDSIARSGGLKKLVGVNIEGIDAREVNSIKLFDDEHG
C2              WLNNFYFGGNHGVSDSIARSGGLKKLVGVNIEGIDAREVNSIKLFDDEHG
C3              WLNNFYFGGNHGVSDSIARSGGLKKLVGVNIEGIDAREVNSIKLFDDEHG
C4              WLNNFYFGGNHGVSDSIARSGGLKKLVGVNIEGIDAREVNSIKLFDDEHG
C5              WLNNFYFGGNHGVSDSIARSGGLKKLVGVNIEGIDAREVNSIKLFDDEHG
C6              WLNNFYFGGNHGVSDSIARSGGLKKLVGVNIEGIDAREVNSIKLFDDEHG
                **************************************************

C1              RPVYVRVGKTGPYLERLLAGDDGELTPQRANLNGTLTPDELTLEVAEELF
C2              RPVYVRVGKTGPYLERLLAGDDGELTPQRANLNGTLTPDELTLEVAEELF
C3              RPVYVRVGKTGPYLERLLAGDDGELTPQRANLNGTLTPDELTLEVAEELF
C4              RPVYVRVGKTGPYLERLLAGDDGELTPQRANLNGTLTPDELTLEVAEELF
C5              RPVYVRVGKTGPYLERLLAGDDGELTPQRANLNGTLTPDELTLEVAEELF
C6              RPVYVRVGKTGPYLERLLAGDDGELTPQRANLNGTLTPDELTLEVAEELF
                **************************************************

C1              ATPHEGRVLGVDPETGHEIVAKDGRYGPYVTEVLPKHDDDYGAADQGTKK
C2              ATPHEGRVLGVDPETGHEIVAKDGRYGPYVTEVLPKHDDDYGAADQGTKK
C3              ATPHEGRVLGVDPETGHEIVAKDGRYGPYVTEVLPKHDDDYGAADQGTKK
C4              ATPHEGRVLGVDPETGHEIVAKDGRYGPYVTEVLPKHDDDYGAADQGTKK
C5              ATPHEGRVLGVDPETGHEIVAKDGRYGPYVTEVLPKHDDDYGAADQGTKK
C6              ATPHEGRVLGVDPETGHEIVAKDGRYGPYVTEVLPKHDDDYGAADQGTKK
                **************************************************

C1              TKKGRRASASQGPKPRTGSLLRSMDLQTITLEDALKLLLLPRVVGVDPAS
C2              TKKGRRASASQGPKPRTGSLLRSMDLQTITLEDALKLLLLPRVVGVDPAS
C3              TKKGRRASASQGPKPRTGSLLRSMDLQTITLEDALKLLLLPRVVGVDPAS
C4              TKKGRRASASQGPKPRTGSLLRSMDLQTITLEDALKLLLLPRVVGVDPAS
C5              TKKGRRASASQGPKPRTGSLLRSMDLQTITLEDALKLLLLPRVVGVDPAS
C6              TKKGRRASASQGPKPRTGSLLRSMDLQTITLEDALKLLLLPRVVGVDPAS
                **************************************************

C1              GEEITAQNGRYGPYLKRGKDSRPLTTEDQMFIITLDEALKIYAEPKRAGR
C2              GEEITAQNGRYGPYLKRGKDSRPLTTEDQMFIITLDEALKIYAEPKRAGR
C3              GEEITAQNGRYGPYLKRGKDSRPLTTEDQMFIITLDEALKIYAEPKRAGR
C4              GEEITAQNGRYGPYLKRGKDSRPLTTEDQMFIITLDEALKIYAEPKRAGR
C5              GEEITAQNGRYGPYLKRGKDSRPLTTEDQMFIITLDEALKIYAEPKRAGR
C6              GEEITAQNGRYGPYLKRGKDSRPLTTEDQMFIITLDEALKIYAEPKRAGR
                **************************************************

C1              QSTSPPPLRELGTDPTSGKPMLIKDGRFGPYVTDGETNASLRKGDDVVSI
C2              QSTSPPPLRELGTDPTSGKPMLIKDGRFGPYVTDGETNASLRKGDDVVSI
C3              QSTSPPPLRELGTDPTSGKPMLIKDGRFGPYVTDGETNASLRKGDDVVSI
C4              QSTSPPPLRELGTDPTSGKPMLIKDGRFGPYVTDGETNASLRKGDDVVSI
C5              QSTSPPPLRELGTDPTSGKPMLIKDGRFGPYVTDGETNASLRKGDDVVSI
C6              QSTSPPPLRELGTDPTSGKPMLIKDGRFGPYVTDGETNASLRKGDDVVSI
                **************************************************

C1              TDERAAELLADRRARGPVKRPAKKARKVPAKKAARLAPARGISQSPR
C2              TDERAAELLADRRARGPVKRPAKKARKVPAKKAARLAPARGISQSPR
C3              TDERAAELLADRRARGPVKRPAKKARKVPAKKAARLAPARGISQSPR
C4              TDERAAELLADRRARGPVKRPAKKARKVPAKKAARLAPARGISQSPR
C5              TDERAAELLADRRARGPVKRPAKKARKVPAKKAARLAPARGISQSPR
C6              TDERAAELLADRRARGPVKRPAKKARKVPAKKAARLAPARGISQSPR
                ***********************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGAAGGGCCCCAGGGGTTCTAGGAGCGGCAGAAATGGGAGCCCGCGGCG
C2              ATGAAGGGCCCCAGGGGTTCTAGGAGCGGCAGAAATGGGAGCCCGCGGCG
C3              ATGAAGGGCCCCAGGGGTTCTAGGAGCGGCAGAAATGGGAGCCCGCGGCG
C4              ATGAAGGGCCCCAGGGGTTCTAGGAGCGGCAGAAATGGGAGCCCGCGGCG
C5              ATGAAGGGCCCCAGGGGTTCTAGGAGCGGCAGAAATGGGAGCCCGCGGCG
C6              ATGAAGGGCCCCAGGGGTTCTAGGAGCGGCAGAAATGGGAGCCCGCGGCG
                **************************************************

C1              ACTTGTTATAGTCGAGTCGCCGACGAAAGCGCGCAAATTGTCCGGCTATC
C2              ACTTGTTATAGTCGAGTCGCCGACGAAAGCGCGCAAATTGTCCGGCTATC
C3              ACTTGTTATAGTCGAGTCGCCGACGAAAGCGCGCAAATTGTCCGGCTATC
C4              ACTTGTTATAGTCGAGTCGCCGACGAAAGCGCGCAAATTGTCCGGCTATC
C5              ACTTGTTATAGTCGAGTCGCCGACGAAAGCGCGCAAATTGTCCGGCTATC
C6              ACTTGTTATAGTCGAGTCGCCGACGAAAGCGCGCAAATTGTCCGGCTATC
                **************************************************

C1              TAGGATCTGCGTACATAGTCGAATCATCCCGGGGGCATATCCGTGACCTG
C2              TAGGATCTGCGTACATAGTCGAATCATCCCGGGGGCATATCCGTGACCTG
C3              TAGGATCTGCGTACATAGTCGAATCATCCCGGGGGCATATCCGTGACCTG
C4              TAGGATCTGCGTACATAGTCGAATCATCCCGGGGGCATATCCGTGACCTG
C5              TAGGATCTGCGTACATAGTCGAATCATCCCGGGGGCATATCCGTGACCTG
C6              TAGGATCTGCGTACATAGTCGAATCATCCCGGGGGCATATCCGTGACCTG
                **************************************************

C1              CCGCGGACGGCGGCTGATGTGCCCGCGAAGTTCAAGTCTGAGCCGTGGGC
C2              CCGCGGACGGCGGCTGATGTGCCCGCGAAGTTCAAGTCTGAGCCGTGGGC
C3              CCGCGGACGGCGGCTGATGTGCCCGCGAAGTTCAAGTCTGAGCCGTGGGC
C4              CCGCGGACGGCGGCTGATGTGCCCGCGAAGTTCAAGTCTGAGCCGTGGGC
C5              CCGCGGACGGCGGCTGATGTGCCCGCGAAGTTCAAGTCTGAGCCGTGGGC
C6              CCGCGGACGGCGGCTGATGTGCCCGCGAAGTTCAAGTCTGAGCCGTGGGC
                **************************************************

C1              TCGGCTGGGCGTAAACGTCGACGCAGACTTTGAACCGCTCTACATCATCA
C2              TCGGCTGGGCGTAAACGTCGACGCAGACTTTGAACCGCTCTACATCATCA
C3              TCGGCTGGGCGTAAACGTCGACGCAGACTTTGAACCGCTCTACATCATCA
C4              TCGGCTGGGCGTAAACGTCGACGCAGACTTTGAACCGCTCTACATCATCA
C5              TCGGCTGGGCGTAAACGTCGACGCAGACTTTGAACCGCTCTACATCATCA
C6              TCGGCTGGGCGTAAACGTCGACGCAGACTTTGAACCGCTCTACATCATCA
                **************************************************

C1              CCCCCGAGAAGAAGAGCACCGTCACTGAACTCAAAGGTCTGCTCCAAGGA
C2              CCCCCGAGAAGAAGAGCACCGTCACTGAACTCAAAGGTCTGCTCCAAGGA
C3              CCCCCGAGAAGAAGAGCACCGTCACTGAACTCAAAGGTCTGCTCCAAGGA
C4              CCCCCGAGAAGAAGAGCACCGTCACTGAACTCAAAGGTCTGCTCCAAGGA
C5              CCCCCGAGAAGAAGAGCACCGTCACTGAACTCAAAGGTCTGCTCCAAGGA
C6              CCCCCGAGAAGAAGAGCACCGTCACTGAACTCAAAGGTCTGCTCCAAGGA
                **************************************************

C1              GTCGACGAGCTCTATCTGGCCACAGATGGTGACCGCGAGGGCGAAGCCAT
C2              GTCGACGAGCTCTATCTGGCCACAGATGGTGACCGCGAGGGCGAAGCCAT
C3              GTCGACGAGCTCTATCTGGCCACAGATGGTGACCGCGAGGGCGAAGCCAT
C4              GTCGACGAGCTCTATCTGGCCACAGATGGTGACCGCGAGGGCGAAGCCAT
C5              GTCGACGAGCTCTATCTGGCCACAGATGGTGACCGCGAGGGCGAAGCCAT
C6              GTCGACGAGCTCTATCTGGCCACAGATGGTGACCGCGAGGGCGAAGCCAT
                **************************************************

C1              CGCCTGGCACCTGATGCAGACTCTGAAACCGCGAGTTCCGGTCAAGCGGA
C2              CGCCTGGCACCTGATGCAGACTCTGAAACCGCGAGTTCCGGTCAAGCGGA
C3              CGCCTGGCACCTGATGCAGACTCTGAAACCGCGAGTTCCGGTCAAGCGGA
C4              CGCCTGGCACCTGATGCAGACTCTGAAACCGCGAGTTCCGGTCAAGCGGA
C5              CGCCTGGCACCTGATGCAGACTCTGAAACCGCGAGTTCCGGTCAAGCGGA
C6              CGCCTGGCACCTGATGCAGACTCTGAAACCGCGAGTTCCGGTCAAGCGGA
                **************************************************

C1              TGGTTTTCCACGAGATCACCGAGCACGCGATCCTCGCCGCCGCTGCGCAT
C2              TGGTTTTCCACGAGATCACCGAGCACGCGATCCTCGCCGCCGCTGCGCAT
C3              TGGTTTTCCACGAGATCACCGAGCACGCGATCCTCGCCGCCGCTGCGCAT
C4              TGGTTTTCCACGAGATCACCGAGCACGCGATCCTCGCCGCCGCTGCGCAT
C5              TGGTTTTCCACGAGATCACCGAGCACGCGATCCTCGCCGCCGCTGCGCAT
C6              TGGTTTTCCACGAGATCACCGAGCACGCGATCCTCGCCGCCGCTGCGCAT
                **************************************************

C1              CCCCGTGAACTGGATATTGACCTGGTTGACGCGCAGGAGACCCGACGCAT
C2              CCCCGTGAACTGGATATTGACCTGGTTGACGCGCAGGAGACCCGACGCAT
C3              CCCCGTGAACTGGATATTGACCTGGTTGACGCGCAGGAGACCCGACGCAT
C4              CCCCGTGAACTGGATATTGACCTGGTTGACGCGCAGGAGACCCGACGCAT
C5              CCCCGTGAACTGGATATTGACCTGGTTGACGCGCAGGAGACCCGACGCAT
C6              CCCCGTGAACTGGATATTGACCTGGTTGACGCGCAGGAGACCCGACGCAT
                **************************************************

C1              CCTGGACCGGCTGTACGGGTATGAAGTTAGTCCGGTACTGTGGAAGAAGG
C2              CCTGGACCGGCTGTACGGGTATGAAGTTAGTCCGGTACTGTGGAAGAAGG
C3              CCTGGACCGGCTGTACGGGTATGAAGTTAGTCCGGTACTGTGGAAGAAGG
C4              CCTGGACCGGCTGTACGGGTATGAAGTTAGTCCGGTACTGTGGAAGAAGG
C5              CCTGGACCGGCTGTACGGGTATGAAGTTAGTCCGGTACTGTGGAAGAAGG
C6              CCTGGACCGGCTGTACGGGTATGAAGTTAGTCCGGTACTGTGGAAGAAGG
                **************************************************

C1              TAGCGCCTAAGCTTTCGGCGGGCCGAGTGCAATCGGTGGCCACCCGCATC
C2              TAGCGCCTAAGCTTTCGGCGGGCCGAGTGCAATCGGTGGCCACCCGCATC
C3              TAGCGCCTAAGCTTTCGGCGGGCCGAGTGCAATCGGTGGCCACCCGCATC
C4              TAGCGCCTAAGCTTTCGGCGGGCCGAGTGCAATCGGTGGCCACCCGCATC
C5              TAGCGCCTAAGCTTTCGGCGGGCCGAGTGCAATCGGTGGCCACCCGCATC
C6              TAGCGCCTAAGCTTTCGGCGGGCCGAGTGCAATCGGTGGCCACCCGCATC
                **************************************************

C1              ATCGTGCAGCGTGAACGCGACCGGATGGCGTTCTGCAGCGCGGTGTACTG
C2              ATCGTGCAGCGTGAACGCGACCGGATGGCGTTCTGCAGCGCGGTGTACTG
C3              ATCGTGCAGCGTGAACGCGACCGGATGGCGTTCTGCAGCGCGGTGTACTG
C4              ATCGTGCAGCGTGAACGCGACCGGATGGCGTTCTGCAGCGCGGTGTACTG
C5              ATCGTGCAGCGTGAACGCGACCGGATGGCGTTCTGCAGCGCGGTGTACTG
C6              ATCGTGCAGCGTGAACGCGACCGGATGGCGTTCTGCAGCGCGGTGTACTG
                **************************************************

C1              GGACATTGTTGCCAAGCTGGACGCCAGCGTGTCCGATCCGACCGCCCAGC
C2              GGACATTGTTGCCAAGCTGGACGCCAGCGTGTCCGATCCGACCGCCCAGC
C3              GGACATTGTTGCCAAGCTGGACGCCAGCGTGTCCGATCCGACCGCCCAGC
C4              GGACATTGTTGCCAAGCTGGACGCCAGCGTGTCCGATCCGACCGCCCAGC
C5              GGACATTGTTGCCAAGCTGGACGCCAGCGTGTCCGATCCGACCGCCCAGC
C6              GGACATTGTTGCCAAGCTGGACGCCAGCGTGTCCGATCCGACCGCCCAGC
                **************************************************

C1              CGCTCACCTTTGTCGCCCGTCTGACGGCTGTAGATGGCTTGCGGGTCGCC
C2              CGCTCACCTTTGTCGCCCGTCTGACGGCTGTAGATGGCTTGCGGGTCGCC
C3              CGCTCACCTTTGTCGCCCGTCTGACGGCTGTAGATGGCTTGCGGGTCGCC
C4              CGCTCACCTTTGTCGCCCGTCTGACGGCTGTAGATGGCTTGCGGGTCGCC
C5              CGCTCACCTTTGTCGCCCGTCTGACGGCTGTAGATGGCTTGCGGGTCGCC
C6              CGCTCACCTTTGTCGCCCGTCTGACGGCTGTAGATGGCTTGCGGGTCGCC
                **************************************************

C1              ACCGGCCGCGATTTCGGTGCGATGGGCACGCTGCGTGGAGACTGTGAGGT
C2              ACCGGCCGCGATTTCGGTGCGATGGGCACGCTGCGTGGAGACTGTGAGGT
C3              ACCGGCCGCGATTTCGGTGCGATGGGCACGCTGCGTGGAGACTGTGAGGT
C4              ACCGGCCGCGATTTCGGTGCGATGGGCACGCTGCGTGGAGACTGTGAGGT
C5              ACCGGCCGCGATTTCGGTGCGATGGGCACGCTGCGTGGAGACTGTGAGGT
C6              ACCGGCCGCGATTTCGGTGCGATGGGCACGCTGCGTGGAGACTGTGAGGT
                **************************************************

C1              CTCCAAAATCATTGTCCTCGACGACCTGACCGCAACCACGTTGGCCGCAG
C2              CTCCAAAATCATTGTCCTCGACGACCTGACCGCAACCACGTTGGCCGCAG
C3              CTCCAAAATCATTGTCCTCGACGACCTGACCGCAACCACGTTGGCCGCAG
C4              CTCCAAAATCATTGTCCTCGACGACCTGACCGCAACCACGTTGGCCGCAG
C5              CTCCAAAATCATTGTCCTCGACGACCTGACCGCAACCACGTTGGCCGCAG
C6              CTCCAAAATCATTGTCCTCGACGACCTGACCGCAACCACGTTGGCCGCAG
                **************************************************

C1              GATTGCGCGGCGCTCAGCTTACCGTGGCCTCAGCGGAAGAGAAGCTCTAC
C2              GATTGCGCGGCGCTCAGCTTACCGTGGCCTCAGCGGAAGAGAAGCTCTAC
C3              GATTGCGCGGCGCTCAGCTTACCGTGGCCTCAGCGGAAGAGAAGCTCTAC
C4              GATTGCGCGGCGCTCAGCTTACCGTGGCCTCAGCGGAAGAGAAGCTCTAC
C5              GATTGCGCGGCGCTCAGCTTACCGTGGCCTCAGCGGAAGAGAAGCTCTAC
C6              GATTGCGCGGCGCTCAGCTTACCGTGGCCTCAGCGGAAGAGAAGCTCTAC
                **************************************************

C1              ACTCGGCGACCGTATCCGCCATTCATGACGTCGACGCTGCAACAGGAAGC
C2              ACTCGGCGACCGTATCCGCCATTCATGACGTCGACGCTGCAACAGGAAGC
C3              ACTCGGCGACCGTATCCGCCATTCATGACGTCGACGCTGCAACAGGAAGC
C4              ACTCGGCGACCGTATCCGCCATTCATGACGTCGACGCTGCAACAGGAAGC
C5              ACTCGGCGACCGTATCCGCCATTCATGACGTCGACGCTGCAACAGGAAGC
C6              ACTCGGCGACCGTATCCGCCATTCATGACGTCGACGCTGCAACAGGAAGC
                **************************************************

C1              CGGACGCAAGTTGCGATTCTCTGCGGAACGCACGATGAGCATCGCCCAGC
C2              CGGACGCAAGTTGCGATTCTCTGCGGAACGCACGATGAGCATCGCCCAGC
C3              CGGACGCAAGTTGCGATTCTCTGCGGAACGCACGATGAGCATCGCCCAGC
C4              CGGACGCAAGTTGCGATTCTCTGCGGAACGCACGATGAGCATCGCCCAGC
C5              CGGACGCAAGTTGCGATTCTCTGCGGAACGCACGATGAGCATCGCCCAGC
C6              CGGACGCAAGTTGCGATTCTCTGCGGAACGCACGATGAGCATCGCCCAGC
                **************************************************

C1              GGCTATATGAGAACGGTTACATTACCTACATGCGTACCGACTCGACCACG
C2              GGCTATATGAGAACGGTTACATTACCTACATGCGTACCGACTCGACCACG
C3              GGCTATATGAGAACGGTTACATTACCTACATGCGTACCGACTCGACCACG
C4              GGCTATATGAGAACGGTTACATTACCTACATGCGTACCGACTCGACCACG
C5              GGCTATATGAGAACGGTTACATTACCTACATGCGTACCGACTCGACCACG
C6              GGCTATATGAGAACGGTTACATTACCTACATGCGTACCGACTCGACCACG
                **************************************************

C1              TTGTCTGAGTCGGCTATCAACGCCGCTCGTACGCAGGCGCGTCAGCTCTA
C2              TTGTCTGAGTCGGCTATCAACGCCGCTCGTACGCAGGCGCGTCAGCTCTA
C3              TTGTCTGAGTCGGCTATCAACGCCGCTCGTACGCAGGCGCGTCAGCTCTA
C4              TTGTCTGAGTCGGCTATCAACGCCGCTCGTACGCAGGCGCGTCAGCTCTA
C5              TTGTCTGAGTCGGCTATCAACGCCGCTCGTACGCAGGCGCGTCAGCTCTA
C6              TTGTCTGAGTCGGCTATCAACGCCGCTCGTACGCAGGCGCGTCAGCTCTA
                **************************************************

C1              CGGCGAGGAGTACGTCTCTGACTCGCCGCGTCAGTACACCCGCAAGGTAA
C2              CGGCGAGGAGTACGTCTCTGACTCGCCGCGTCAGTACACCCGCAAGGTAA
C3              CGGCGAGGAGTACGTCTCTGACTCGCCGCGTCAGTACACCCGCAAGGTAA
C4              CGGCGAGGAGTACGTCTCTGACTCGCCGCGTCAGTACACCCGCAAGGTAA
C5              CGGCGAGGAGTACGTCTCTGACTCGCCGCGTCAGTACACCCGCAAGGTAA
C6              CGGCGAGGAGTACGTCTCTGACTCGCCGCGTCAGTACACCCGCAAGGTAA
                **************************************************

C1              AGAACGCACAGGAAGCCCACGAGGCCATCCGGCCTGCAGGAGAGACGTTC
C2              AGAACGCACAGGAAGCCCACGAGGCCATCCGGCCTGCAGGAGAGACGTTC
C3              AGAACGCACAGGAAGCCCACGAGGCCATCCGGCCTGCAGGAGAGACGTTC
C4              AGAACGCACAGGAAGCCCACGAGGCCATCCGGCCTGCAGGAGAGACGTTC
C5              AGAACGCACAGGAAGCCCACGAGGCCATCCGGCCTGCAGGAGAGACGTTC
C6              AGAACGCACAGGAAGCCCACGAGGCCATCCGGCCTGCAGGAGAGACGTTC
                **************************************************

C1              GCTACCCCGGACGCGGTGTGTAATGAACTCGACGGTGACGAATTCCGGAT
C2              GCTACCCCGGACGCGGTGTGTAATGAACTCGACGGTGACGAATTCCGGAT
C3              GCTACCCCGGACGCGGTGTGTAATGAACTCGACGGTGACGAATTCCGGAT
C4              GCTACCCCGGACGCGGTGTGTAATGAACTCGACGGTGACGAATTCCGGAT
C5              GCTACCCCGGACGCGGTGTGTAATGAACTCGACGGTGACGAATTCCGGAT
C6              GCTACCCCGGACGCGGTGTGTAATGAACTCGACGGTGACGAATTCCGGAT
                **************************************************

C1              CTACGAGCTGGTATGGCGGCGTACTGTAGCTTCTCAGATGGCCGACGCTC
C2              CTACGAGCTGGTATGGCGGCGTACTGTAGCTTCTCAGATGGCCGACGCTC
C3              CTACGAGCTGGTATGGCGGCGTACTGTAGCTTCTCAGATGGCCGACGCTC
C4              CTACGAGCTGGTATGGCGGCGTACTGTAGCTTCTCAGATGGCCGACGCTC
C5              CTACGAGCTGGTATGGCGGCGTACTGTAGCTTCTCAGATGGCCGACGCTC
C6              CTACGAGCTGGTATGGCGGCGTACTGTAGCTTCTCAGATGGCCGACGCTC
                **************************************************

C1              GCGGTACCACGCTGAGCTTGCGGATCGAGGGCCGAGCCGGCGAGCAACAC
C2              GCGGTACCACGCTGAGCTTGCGGATCGAGGGCCGAGCCGGCGAGCAACAC
C3              GCGGTACCACGCTGAGCTTGCGGATCGAGGGCCGAGCCGGCGAGCAACAC
C4              GCGGTACCACGCTGAGCTTGCGGATCGAGGGCCGAGCCGGCGAGCAACAC
C5              GCGGTACCACGCTGAGCTTGCGGATCGAGGGCCGAGCCGGCGAGCAACAC
C6              GCGGTACCACGCTGAGCTTGCGGATCGAGGGCCGAGCCGGCGAGCAACAC
                **************************************************

C1              GTTGTCTTCTCAGCTTCCGGGCGCACCCTGACCTTCCCCGGCTTCCTGAA
C2              GTTGTCTTCTCAGCTTCCGGGCGCACCCTGACCTTCCCCGGCTTCCTGAA
C3              GTTGTCTTCTCAGCTTCCGGGCGCACCCTGACCTTCCCCGGCTTCCTGAA
C4              GTTGTCTTCTCAGCTTCCGGGCGCACCCTGACCTTCCCCGGCTTCCTGAA
C5              GTTGTCTTCTCAGCTTCCGGGCGCACCCTGACCTTCCCCGGCTTCCTGAA
C6              GTTGTCTTCTCAGCTTCCGGGCGCACCCTGACCTTCCCCGGCTTCCTGAA
                **************************************************

C1              GGCCTATGTGGAAACCGTGGACGAGCTGGCCGGCGGCGAGGCTGACGACG
C2              GGCCTATGTGGAAACCGTGGACGAGCTGGCCGGCGGCGAGGCTGACGACG
C3              GGCCTATGTGGAAACCGTGGACGAGCTGGCCGGCGGCGAGGCTGACGACG
C4              GGCCTATGTGGAAACCGTGGACGAGCTGGCCGGCGGCGAGGCTGACGACG
C5              GGCCTATGTGGAAACCGTGGACGAGCTGGCCGGCGGCGAGGCTGACGACG
C6              GGCCTATGTGGAAACCGTGGACGAGCTGGCCGGCGGCGAGGCTGACGACG
                **************************************************

C1              CTGAGCGTCGACTACCGCATCTGACCTCTGGTCAGCTGCTGGATGTCATC
C2              CTGAGCGTCGACTACCGCATCTGACCTCTGGTCAGCTGCTGGATGTCATC
C3              CTGAGCGTCGACTACCGCATCTGACCTCTGGTCAGCTGCTGGATGTCATC
C4              CTGAGCGTCGACTACCGCATCTGACCTCTGGTCAGCTGCTGGATGTCATC
C5              CTGAGCGTCGACTACCGCATCTGACCTCTGGTCAGCTGCTGGATGTCATC
C6              CTGAGCGTCGACTACCGCATCTGACCTCTGGTCAGCTGCTGGATGTCATC
                **************************************************

C1              GATCTGACTCCGGACGGGCACGCCACCAACCCTCCGGCCCGCTATACGGA
C2              GATCTGACTCCGGACGGGCACGCCACCAACCCTCCGGCCCGCTATACGGA
C3              GATCTGACTCCGGACGGGCACGCCACCAACCCTCCGGCCCGCTATACGGA
C4              GATCTGACTCCGGACGGGCACGCCACCAACCCTCCGGCCCGCTATACGGA
C5              GATCTGACTCCGGACGGGCACGCCACCAACCCTCCGGCCCGCTATACGGA
C6              GATCTGACTCCGGACGGGCACGCCACCAACCCTCCGGCCCGCTATACGGA
                **************************************************

C1              AGCTTCTTTGGTTAAAGCGTTGGAGGAGTTGGGTATCGGCCGCCCGTCGA
C2              AGCTTCTTTGGTTAAAGCGTTGGAGGAGTTGGGTATCGGCCGCCCGTCGA
C3              AGCTTCTTTGGTTAAAGCGTTGGAGGAGTTGGGTATCGGCCGCCCGTCGA
C4              AGCTTCTTTGGTTAAAGCGTTGGAGGAGTTGGGTATCGGCCGCCCGTCGA
C5              AGCTTCTTTGGTTAAAGCGTTGGAGGAGTTGGGTATCGGCCGCCCGTCGA
C6              AGCTTCTTTGGTTAAAGCGTTGGAGGAGTTGGGTATCGGCCGCCCGTCGA
                **************************************************

C1              CGTACTCATCGATCATAAAGACCGTCCAGGACCGCGGCTATGTGCAGAAG
C2              CGTACTCATCGATCATAAAGACCGTCCAGGACCGCGGCTATGTGCAGAAG
C3              CGTACTCATCGATCATAAAGACCGTCCAGGACCGCGGCTATGTGCAGAAG
C4              CGTACTCATCGATCATAAAGACCGTCCAGGACCGCGGCTATGTGCAGAAG
C5              CGTACTCATCGATCATAAAGACCGTCCAGGACCGCGGCTATGTGCAGAAG
C6              CGTACTCATCGATCATAAAGACCGTCCAGGACCGCGGCTATGTGCAGAAG
                **************************************************

C1              AAGGGCAGCGCCCTGGTGCCGTCGTGGGTCGCGTTCGCAGTTACCGGCCT
C2              AAGGGCAGCGCCCTGGTGCCGTCGTGGGTCGCGTTCGCAGTTACCGGCCT
C3              AAGGGCAGCGCCCTGGTGCCGTCGTGGGTCGCGTTCGCAGTTACCGGCCT
C4              AAGGGCAGCGCCCTGGTGCCGTCGTGGGTCGCGTTCGCAGTTACCGGCCT
C5              AAGGGCAGCGCCCTGGTGCCGTCGTGGGTCGCGTTCGCAGTTACCGGCCT
C6              AAGGGCAGCGCCCTGGTGCCGTCGTGGGTCGCGTTCGCAGTTACCGGCCT
                **************************************************

C1              TTTGGAGCAGCATTTCGGCCGTCTCGTCGACTACGATTTCACCGCCGCGA
C2              TTTGGAGCAGCATTTCGGCCGTCTCGTCGACTACGATTTCACCGCCGCGA
C3              TTTGGAGCAGCATTTCGGCCGTCTCGTCGACTACGATTTCACCGCCGCGA
C4              TTTGGAGCAGCATTTCGGCCGTCTCGTCGACTACGATTTCACCGCCGCGA
C5              TTTGGAGCAGCATTTCGGCCGTCTCGTCGACTACGATTTCACCGCCGCGA
C6              TTTGGAGCAGCATTTCGGCCGTCTCGTCGACTACGATTTCACCGCCGCGA
                **************************************************

C1              TGGAAGACGAGCTCGATGAGATCGCTAACGGGAATGAGCAACGTACCAAC
C2              TGGAAGACGAGCTCGATGAGATCGCTAACGGGAATGAGCAACGTACCAAC
C3              TGGAAGACGAGCTCGATGAGATCGCTAACGGGAATGAGCAACGTACCAAC
C4              TGGAAGACGAGCTCGATGAGATCGCTAACGGGAATGAGCAACGTACCAAC
C5              TGGAAGACGAGCTCGATGAGATCGCTAACGGGAATGAGCAACGTACCAAC
C6              TGGAAGACGAGCTCGATGAGATCGCTAACGGGAATGAGCAACGTACCAAC
                **************************************************

C1              TGGCTCAACAACTTCTACTTTGGTGGCAACCACGGTGTGTCCGATTCAAT
C2              TGGCTCAACAACTTCTACTTTGGTGGCAACCACGGTGTGTCCGATTCAAT
C3              TGGCTCAACAACTTCTACTTTGGTGGCAACCACGGTGTGTCCGATTCAAT
C4              TGGCTCAACAACTTCTACTTTGGTGGCAACCACGGTGTGTCCGATTCAAT
C5              TGGCTCAACAACTTCTACTTTGGTGGCAACCACGGTGTGTCCGATTCAAT
C6              TGGCTCAACAACTTCTACTTTGGTGGCAACCACGGTGTGTCCGATTCAAT
                **************************************************

C1              AGCCCGCTCCGGCGGCTTGAAGAAGTTGGTCGGCGTGAATATTGAAGGGA
C2              AGCCCGCTCCGGCGGCTTGAAGAAGTTGGTCGGCGTGAATATTGAAGGGA
C3              AGCCCGCTCCGGCGGCTTGAAGAAGTTGGTCGGCGTGAATATTGAAGGGA
C4              AGCCCGCTCCGGCGGCTTGAAGAAGTTGGTCGGCGTGAATATTGAAGGGA
C5              AGCCCGCTCCGGCGGCTTGAAGAAGTTGGTCGGCGTGAATATTGAAGGGA
C6              AGCCCGCTCCGGCGGCTTGAAGAAGTTGGTCGGCGTGAATATTGAAGGGA
                **************************************************

C1              TTGATGCACGAGAGGTCAATTCCATCAAACTGTTTGACGATGAGCACGGT
C2              TTGATGCACGAGAGGTCAATTCCATCAAACTGTTTGACGATGAGCACGGT
C3              TTGATGCACGAGAGGTCAATTCCATCAAACTGTTTGACGATGAGCACGGT
C4              TTGATGCACGAGAGGTCAATTCCATCAAACTGTTTGACGATGAGCACGGT
C5              TTGATGCACGAGAGGTCAATTCCATCAAACTGTTTGACGATGAGCACGGT
C6              TTGATGCACGAGAGGTCAATTCCATCAAACTGTTTGACGATGAGCACGGT
                **************************************************

C1              CGTCCTGTCTATGTTCGGGTAGGCAAGACTGGGCCGTATCTGGAACGCTT
C2              CGTCCTGTCTATGTTCGGGTAGGCAAGACTGGGCCGTATCTGGAACGCTT
C3              CGTCCTGTCTATGTTCGGGTAGGCAAGACTGGGCCGTATCTGGAACGCTT
C4              CGTCCTGTCTATGTTCGGGTAGGCAAGACTGGGCCGTATCTGGAACGCTT
C5              CGTCCTGTCTATGTTCGGGTAGGCAAGACTGGGCCGTATCTGGAACGCTT
C6              CGTCCTGTCTATGTTCGGGTAGGCAAGACTGGGCCGTATCTGGAACGCTT
                **************************************************

C1              GTTGGCAGGCGATGATGGTGAACTTACCCCGCAGCGGGCAAACCTCAACG
C2              GTTGGCAGGCGATGATGGTGAACTTACCCCGCAGCGGGCAAACCTCAACG
C3              GTTGGCAGGCGATGATGGTGAACTTACCCCGCAGCGGGCAAACCTCAACG
C4              GTTGGCAGGCGATGATGGTGAACTTACCCCGCAGCGGGCAAACCTCAACG
C5              GTTGGCAGGCGATGATGGTGAACTTACCCCGCAGCGGGCAAACCTCAACG
C6              GTTGGCAGGCGATGATGGTGAACTTACCCCGCAGCGGGCAAACCTCAACG
                **************************************************

C1              GCACACTCACTCCGGATGAGCTCACCTTGGAGGTTGCCGAGGAGCTTTTC
C2              GCACACTCACTCCGGATGAGCTCACCTTGGAGGTTGCCGAGGAGCTTTTC
C3              GCACACTCACTCCGGATGAGCTCACCTTGGAGGTTGCCGAGGAGCTTTTC
C4              GCACACTCACTCCGGATGAGCTCACCTTGGAGGTTGCCGAGGAGCTTTTC
C5              GCACACTCACTCCGGATGAGCTCACCTTGGAGGTTGCCGAGGAGCTTTTC
C6              GCACACTCACTCCGGATGAGCTCACCTTGGAGGTTGCCGAGGAGCTTTTC
                **************************************************

C1              GCCACACCGCACGAGGGGCGCGTTCTGGGGGTGGATCCCGAAACTGGCCA
C2              GCCACACCGCACGAGGGGCGCGTTCTGGGGGTGGATCCCGAAACTGGCCA
C3              GCCACACCGCACGAGGGGCGCGTTCTGGGGGTGGATCCCGAAACTGGCCA
C4              GCCACACCGCACGAGGGGCGCGTTCTGGGGGTGGATCCCGAAACTGGCCA
C5              GCCACACCGCACGAGGGGCGCGTTCTGGGGGTGGATCCCGAAACTGGCCA
C6              GCCACACCGCACGAGGGGCGCGTTCTGGGGGTGGATCCCGAAACTGGCCA
                **************************************************

C1              CGAGATCGTCGCCAAAGACGGTCGGTACGGGCCTTATGTGACTGAGGTCC
C2              CGAGATCGTCGCCAAAGACGGTCGGTACGGGCCTTATGTGACTGAGGTCC
C3              CGAGATCGTCGCCAAAGACGGTCGGTACGGGCCTTATGTGACTGAGGTCC
C4              CGAGATCGTCGCCAAAGACGGTCGGTACGGGCCTTATGTGACTGAGGTCC
C5              CGAGATCGTCGCCAAAGACGGTCGGTACGGGCCTTATGTGACTGAGGTCC
C6              CGAGATCGTCGCCAAAGACGGTCGGTACGGGCCTTATGTGACTGAGGTCC
                **************************************************

C1              TGCCTAAGCACGATGACGACTATGGTGCAGCGGATCAGGGAACTAAGAAA
C2              TGCCTAAGCACGATGACGACTATGGTGCAGCGGATCAGGGAACTAAGAAA
C3              TGCCTAAGCACGATGACGACTATGGTGCAGCGGATCAGGGAACTAAGAAA
C4              TGCCTAAGCACGATGACGACTATGGTGCAGCGGATCAGGGAACTAAGAAA
C5              TGCCTAAGCACGATGACGACTATGGTGCAGCGGATCAGGGAACTAAGAAA
C6              TGCCTAAGCACGATGACGACTATGGTGCAGCGGATCAGGGAACTAAGAAA
                **************************************************

C1              ACTAAGAAGGGTAGGAGGGCTTCCGCTTCTCAAGGCCCCAAACCGAGGAC
C2              ACTAAGAAGGGTAGGAGGGCTTCCGCTTCTCAAGGCCCCAAACCGAGGAC
C3              ACTAAGAAGGGTAGGAGGGCTTCCGCTTCTCAAGGCCCCAAACCGAGGAC
C4              ACTAAGAAGGGTAGGAGGGCTTCCGCTTCTCAAGGCCCCAAACCGAGGAC
C5              ACTAAGAAGGGTAGGAGGGCTTCCGCTTCTCAAGGCCCCAAACCGAGGAC
C6              ACTAAGAAGGGTAGGAGGGCTTCCGCTTCTCAAGGCCCCAAACCGAGGAC
                **************************************************

C1              CGGGTCTTTGCTGCGGAGCATGGATTTGCAAACGATCACTCTCGAGGATG
C2              CGGGTCTTTGCTGCGGAGCATGGATTTGCAAACGATCACTCTCGAGGATG
C3              CGGGTCTTTGCTGCGGAGCATGGATTTGCAAACGATCACTCTCGAGGATG
C4              CGGGTCTTTGCTGCGGAGCATGGATTTGCAAACGATCACTCTCGAGGATG
C5              CGGGTCTTTGCTGCGGAGCATGGATTTGCAAACGATCACTCTCGAGGATG
C6              CGGGTCTTTGCTGCGGAGCATGGATTTGCAAACGATCACTCTCGAGGATG
                **************************************************

C1              CATTGAAACTGTTGTTGCTGCCTCGGGTTGTCGGTGTGGACCCTGCGTCC
C2              CATTGAAACTGTTGTTGCTGCCTCGGGTTGTCGGTGTGGACCCTGCGTCC
C3              CATTGAAACTGTTGTTGCTGCCTCGGGTTGTCGGTGTGGACCCTGCGTCC
C4              CATTGAAACTGTTGTTGCTGCCTCGGGTTGTCGGTGTGGACCCTGCGTCC
C5              CATTGAAACTGTTGTTGCTGCCTCGGGTTGTCGGTGTGGACCCTGCGTCC
C6              CATTGAAACTGTTGTTGCTGCCTCGGGTTGTCGGTGTGGACCCTGCGTCC
                **************************************************

C1              GGTGAAGAGATCACCGCGCAGAACGGGCGTTATGGTCCATATCTGAAGCG
C2              GGTGAAGAGATCACCGCGCAGAACGGGCGTTATGGTCCATATCTGAAGCG
C3              GGTGAAGAGATCACCGCGCAGAACGGGCGTTATGGTCCATATCTGAAGCG
C4              GGTGAAGAGATCACCGCGCAGAACGGGCGTTATGGTCCATATCTGAAGCG
C5              GGTGAAGAGATCACCGCGCAGAACGGGCGTTATGGTCCATATCTGAAGCG
C6              GGTGAAGAGATCACCGCGCAGAACGGGCGTTATGGTCCATATCTGAAGCG
                **************************************************

C1              CGGCAAAGATTCTCGACCACTAACAACTGAAGACCAGATGTTCATCATTA
C2              CGGCAAAGATTCTCGACCACTAACAACTGAAGACCAGATGTTCATCATTA
C3              CGGCAAAGATTCTCGACCACTAACAACTGAAGACCAGATGTTCATCATTA
C4              CGGCAAAGATTCTCGACCACTAACAACTGAAGACCAGATGTTCATCATTA
C5              CGGCAAAGATTCTCGACCACTAACAACTGAAGACCAGATGTTCATCATTA
C6              CGGCAAAGATTCTCGACCACTAACAACTGAAGACCAGATGTTCATCATTA
                **************************************************

C1              CTCTCGACGAGGCGTTAAAGATCTACGCTGAACCGAAACGTGCTGGTCGA
C2              CTCTCGACGAGGCGTTAAAGATCTACGCTGAACCGAAACGTGCTGGTCGA
C3              CTCTCGACGAGGCGTTAAAGATCTACGCTGAACCGAAACGTGCTGGTCGA
C4              CTCTCGACGAGGCGTTAAAGATCTACGCTGAACCGAAACGTGCTGGTCGA
C5              CTCTCGACGAGGCGTTAAAGATCTACGCTGAACCGAAACGTGCTGGTCGA
C6              CTCTCGACGAGGCGTTAAAGATCTACGCTGAACCGAAACGTGCTGGTCGA
                **************************************************

C1              CAAAGTACTTCGCCGCCGCCTTTGCGTGAGCTGGGGACTGATCCGACGTC
C2              CAAAGTACTTCGCCGCCGCCTTTGCGTGAGCTGGGGACTGATCCGACGTC
C3              CAAAGTACTTCGCCGCCGCCTTTGCGTGAGCTGGGGACTGATCCGACGTC
C4              CAAAGTACTTCGCCGCCGCCTTTGCGTGAGCTGGGGACTGATCCGACGTC
C5              CAAAGTACTTCGCCGCCGCCTTTGCGTGAGCTGGGGACTGATCCGACGTC
C6              CAAAGTACTTCGCCGCCGCCTTTGCGTGAGCTGGGGACTGATCCGACGTC
                **************************************************

C1              GGGCAAGCCAATGCTGATCAAGGACGGCCGGTTCGGCCCGTATGTCACCG
C2              GGGCAAGCCAATGCTGATCAAGGACGGCCGGTTCGGCCCGTATGTCACCG
C3              GGGCAAGCCAATGCTGATCAAGGACGGCCGGTTCGGCCCGTATGTCACCG
C4              GGGCAAGCCAATGCTGATCAAGGACGGCCGGTTCGGCCCGTATGTCACCG
C5              GGGCAAGCCAATGCTGATCAAGGACGGCCGGTTCGGCCCGTATGTCACCG
C6              GGGCAAGCCAATGCTGATCAAGGACGGCCGGTTCGGCCCGTATGTCACCG
                **************************************************

C1              ACGGTGAGACCAACGCTAGCCTGCGCAAGGGTGATGACGTGGTGTCGATA
C2              ACGGTGAGACCAACGCTAGCCTGCGCAAGGGTGATGACGTGGTGTCGATA
C3              ACGGTGAGACCAACGCTAGCCTGCGCAAGGGTGATGACGTGGTGTCGATA
C4              ACGGTGAGACCAACGCTAGCCTGCGCAAGGGTGATGACGTGGTGTCGATA
C5              ACGGTGAGACCAACGCTAGCCTGCGCAAGGGTGATGACGTGGTGTCGATA
C6              ACGGTGAGACCAACGCTAGCCTGCGCAAGGGTGATGACGTGGTGTCGATA
                **************************************************

C1              ACCGATGAACGTGCCGCCGAATTGTTGGCTGACCGACGGGCCCGAGGTCC
C2              ACCGATGAACGTGCCGCCGAATTGTTGGCTGACCGACGGGCCCGAGGTCC
C3              ACCGATGAACGTGCCGCCGAATTGTTGGCTGACCGACGGGCCCGAGGTCC
C4              ACCGATGAACGTGCCGCCGAATTGTTGGCTGACCGACGGGCCCGAGGTCC
C5              ACCGATGAACGTGCCGCCGAATTGTTGGCTGACCGACGGGCCCGAGGTCC
C6              ACCGATGAACGTGCCGCCGAATTGTTGGCTGACCGACGGGCCCGAGGTCC
                **************************************************

C1              GGTTAAGCGGCCTGCTAAGAAGGCTCGCAAGGTCCCGGCGAAGAAGGCAG
C2              GGTTAAGCGGCCTGCTAAGAAGGCTCGCAAGGTCCCGGCGAAGAAGGCAG
C3              GGTTAAGCGGCCTGCTAAGAAGGCTCGCAAGGTCCCGGCGAAGAAGGCAG
C4              GGTTAAGCGGCCTGCTAAGAAGGCTCGCAAGGTCCCGGCGAAGAAGGCAG
C5              GGTTAAGCGGCCTGCTAAGAAGGCTCGCAAGGTCCCGGCGAAGAAGGCAG
C6              GGTTAAGCGGCCTGCTAAGAAGGCTCGCAAGGTCCCGGCGAAGAAGGCAG
                **************************************************

C1              CTAGACTGGCTCCGGCCCGCGGGATCAGCCAGTCACCTCGC
C2              CTAGACTGGCTCCGGCCCGCGGGATCAGCCAGTCACCTCGC
C3              CTAGACTGGCTCCGGCCCGCGGGATCAGCCAGTCACCTCGC
C4              CTAGACTGGCTCCGGCCCGCGGGATCAGCCAGTCACCTCGC
C5              CTAGACTGGCTCCGGCCCGCGGGATCAGCCAGTCACCTCGC
C6              CTAGACTGGCTCCGGCCCGCGGGATCAGCCAGTCACCTCGC
                *****************************************



>C1
ATGAAGGGCCCCAGGGGTTCTAGGAGCGGCAGAAATGGGAGCCCGCGGCG
ACTTGTTATAGTCGAGTCGCCGACGAAAGCGCGCAAATTGTCCGGCTATC
TAGGATCTGCGTACATAGTCGAATCATCCCGGGGGCATATCCGTGACCTG
CCGCGGACGGCGGCTGATGTGCCCGCGAAGTTCAAGTCTGAGCCGTGGGC
TCGGCTGGGCGTAAACGTCGACGCAGACTTTGAACCGCTCTACATCATCA
CCCCCGAGAAGAAGAGCACCGTCACTGAACTCAAAGGTCTGCTCCAAGGA
GTCGACGAGCTCTATCTGGCCACAGATGGTGACCGCGAGGGCGAAGCCAT
CGCCTGGCACCTGATGCAGACTCTGAAACCGCGAGTTCCGGTCAAGCGGA
TGGTTTTCCACGAGATCACCGAGCACGCGATCCTCGCCGCCGCTGCGCAT
CCCCGTGAACTGGATATTGACCTGGTTGACGCGCAGGAGACCCGACGCAT
CCTGGACCGGCTGTACGGGTATGAAGTTAGTCCGGTACTGTGGAAGAAGG
TAGCGCCTAAGCTTTCGGCGGGCCGAGTGCAATCGGTGGCCACCCGCATC
ATCGTGCAGCGTGAACGCGACCGGATGGCGTTCTGCAGCGCGGTGTACTG
GGACATTGTTGCCAAGCTGGACGCCAGCGTGTCCGATCCGACCGCCCAGC
CGCTCACCTTTGTCGCCCGTCTGACGGCTGTAGATGGCTTGCGGGTCGCC
ACCGGCCGCGATTTCGGTGCGATGGGCACGCTGCGTGGAGACTGTGAGGT
CTCCAAAATCATTGTCCTCGACGACCTGACCGCAACCACGTTGGCCGCAG
GATTGCGCGGCGCTCAGCTTACCGTGGCCTCAGCGGAAGAGAAGCTCTAC
ACTCGGCGACCGTATCCGCCATTCATGACGTCGACGCTGCAACAGGAAGC
CGGACGCAAGTTGCGATTCTCTGCGGAACGCACGATGAGCATCGCCCAGC
GGCTATATGAGAACGGTTACATTACCTACATGCGTACCGACTCGACCACG
TTGTCTGAGTCGGCTATCAACGCCGCTCGTACGCAGGCGCGTCAGCTCTA
CGGCGAGGAGTACGTCTCTGACTCGCCGCGTCAGTACACCCGCAAGGTAA
AGAACGCACAGGAAGCCCACGAGGCCATCCGGCCTGCAGGAGAGACGTTC
GCTACCCCGGACGCGGTGTGTAATGAACTCGACGGTGACGAATTCCGGAT
CTACGAGCTGGTATGGCGGCGTACTGTAGCTTCTCAGATGGCCGACGCTC
GCGGTACCACGCTGAGCTTGCGGATCGAGGGCCGAGCCGGCGAGCAACAC
GTTGTCTTCTCAGCTTCCGGGCGCACCCTGACCTTCCCCGGCTTCCTGAA
GGCCTATGTGGAAACCGTGGACGAGCTGGCCGGCGGCGAGGCTGACGACG
CTGAGCGTCGACTACCGCATCTGACCTCTGGTCAGCTGCTGGATGTCATC
GATCTGACTCCGGACGGGCACGCCACCAACCCTCCGGCCCGCTATACGGA
AGCTTCTTTGGTTAAAGCGTTGGAGGAGTTGGGTATCGGCCGCCCGTCGA
CGTACTCATCGATCATAAAGACCGTCCAGGACCGCGGCTATGTGCAGAAG
AAGGGCAGCGCCCTGGTGCCGTCGTGGGTCGCGTTCGCAGTTACCGGCCT
TTTGGAGCAGCATTTCGGCCGTCTCGTCGACTACGATTTCACCGCCGCGA
TGGAAGACGAGCTCGATGAGATCGCTAACGGGAATGAGCAACGTACCAAC
TGGCTCAACAACTTCTACTTTGGTGGCAACCACGGTGTGTCCGATTCAAT
AGCCCGCTCCGGCGGCTTGAAGAAGTTGGTCGGCGTGAATATTGAAGGGA
TTGATGCACGAGAGGTCAATTCCATCAAACTGTTTGACGATGAGCACGGT
CGTCCTGTCTATGTTCGGGTAGGCAAGACTGGGCCGTATCTGGAACGCTT
GTTGGCAGGCGATGATGGTGAACTTACCCCGCAGCGGGCAAACCTCAACG
GCACACTCACTCCGGATGAGCTCACCTTGGAGGTTGCCGAGGAGCTTTTC
GCCACACCGCACGAGGGGCGCGTTCTGGGGGTGGATCCCGAAACTGGCCA
CGAGATCGTCGCCAAAGACGGTCGGTACGGGCCTTATGTGACTGAGGTCC
TGCCTAAGCACGATGACGACTATGGTGCAGCGGATCAGGGAACTAAGAAA
ACTAAGAAGGGTAGGAGGGCTTCCGCTTCTCAAGGCCCCAAACCGAGGAC
CGGGTCTTTGCTGCGGAGCATGGATTTGCAAACGATCACTCTCGAGGATG
CATTGAAACTGTTGTTGCTGCCTCGGGTTGTCGGTGTGGACCCTGCGTCC
GGTGAAGAGATCACCGCGCAGAACGGGCGTTATGGTCCATATCTGAAGCG
CGGCAAAGATTCTCGACCACTAACAACTGAAGACCAGATGTTCATCATTA
CTCTCGACGAGGCGTTAAAGATCTACGCTGAACCGAAACGTGCTGGTCGA
CAAAGTACTTCGCCGCCGCCTTTGCGTGAGCTGGGGACTGATCCGACGTC
GGGCAAGCCAATGCTGATCAAGGACGGCCGGTTCGGCCCGTATGTCACCG
ACGGTGAGACCAACGCTAGCCTGCGCAAGGGTGATGACGTGGTGTCGATA
ACCGATGAACGTGCCGCCGAATTGTTGGCTGACCGACGGGCCCGAGGTCC
GGTTAAGCGGCCTGCTAAGAAGGCTCGCAAGGTCCCGGCGAAGAAGGCAG
CTAGACTGGCTCCGGCCCGCGGGATCAGCCAGTCACCTCGC
>C2
ATGAAGGGCCCCAGGGGTTCTAGGAGCGGCAGAAATGGGAGCCCGCGGCG
ACTTGTTATAGTCGAGTCGCCGACGAAAGCGCGCAAATTGTCCGGCTATC
TAGGATCTGCGTACATAGTCGAATCATCCCGGGGGCATATCCGTGACCTG
CCGCGGACGGCGGCTGATGTGCCCGCGAAGTTCAAGTCTGAGCCGTGGGC
TCGGCTGGGCGTAAACGTCGACGCAGACTTTGAACCGCTCTACATCATCA
CCCCCGAGAAGAAGAGCACCGTCACTGAACTCAAAGGTCTGCTCCAAGGA
GTCGACGAGCTCTATCTGGCCACAGATGGTGACCGCGAGGGCGAAGCCAT
CGCCTGGCACCTGATGCAGACTCTGAAACCGCGAGTTCCGGTCAAGCGGA
TGGTTTTCCACGAGATCACCGAGCACGCGATCCTCGCCGCCGCTGCGCAT
CCCCGTGAACTGGATATTGACCTGGTTGACGCGCAGGAGACCCGACGCAT
CCTGGACCGGCTGTACGGGTATGAAGTTAGTCCGGTACTGTGGAAGAAGG
TAGCGCCTAAGCTTTCGGCGGGCCGAGTGCAATCGGTGGCCACCCGCATC
ATCGTGCAGCGTGAACGCGACCGGATGGCGTTCTGCAGCGCGGTGTACTG
GGACATTGTTGCCAAGCTGGACGCCAGCGTGTCCGATCCGACCGCCCAGC
CGCTCACCTTTGTCGCCCGTCTGACGGCTGTAGATGGCTTGCGGGTCGCC
ACCGGCCGCGATTTCGGTGCGATGGGCACGCTGCGTGGAGACTGTGAGGT
CTCCAAAATCATTGTCCTCGACGACCTGACCGCAACCACGTTGGCCGCAG
GATTGCGCGGCGCTCAGCTTACCGTGGCCTCAGCGGAAGAGAAGCTCTAC
ACTCGGCGACCGTATCCGCCATTCATGACGTCGACGCTGCAACAGGAAGC
CGGACGCAAGTTGCGATTCTCTGCGGAACGCACGATGAGCATCGCCCAGC
GGCTATATGAGAACGGTTACATTACCTACATGCGTACCGACTCGACCACG
TTGTCTGAGTCGGCTATCAACGCCGCTCGTACGCAGGCGCGTCAGCTCTA
CGGCGAGGAGTACGTCTCTGACTCGCCGCGTCAGTACACCCGCAAGGTAA
AGAACGCACAGGAAGCCCACGAGGCCATCCGGCCTGCAGGAGAGACGTTC
GCTACCCCGGACGCGGTGTGTAATGAACTCGACGGTGACGAATTCCGGAT
CTACGAGCTGGTATGGCGGCGTACTGTAGCTTCTCAGATGGCCGACGCTC
GCGGTACCACGCTGAGCTTGCGGATCGAGGGCCGAGCCGGCGAGCAACAC
GTTGTCTTCTCAGCTTCCGGGCGCACCCTGACCTTCCCCGGCTTCCTGAA
GGCCTATGTGGAAACCGTGGACGAGCTGGCCGGCGGCGAGGCTGACGACG
CTGAGCGTCGACTACCGCATCTGACCTCTGGTCAGCTGCTGGATGTCATC
GATCTGACTCCGGACGGGCACGCCACCAACCCTCCGGCCCGCTATACGGA
AGCTTCTTTGGTTAAAGCGTTGGAGGAGTTGGGTATCGGCCGCCCGTCGA
CGTACTCATCGATCATAAAGACCGTCCAGGACCGCGGCTATGTGCAGAAG
AAGGGCAGCGCCCTGGTGCCGTCGTGGGTCGCGTTCGCAGTTACCGGCCT
TTTGGAGCAGCATTTCGGCCGTCTCGTCGACTACGATTTCACCGCCGCGA
TGGAAGACGAGCTCGATGAGATCGCTAACGGGAATGAGCAACGTACCAAC
TGGCTCAACAACTTCTACTTTGGTGGCAACCACGGTGTGTCCGATTCAAT
AGCCCGCTCCGGCGGCTTGAAGAAGTTGGTCGGCGTGAATATTGAAGGGA
TTGATGCACGAGAGGTCAATTCCATCAAACTGTTTGACGATGAGCACGGT
CGTCCTGTCTATGTTCGGGTAGGCAAGACTGGGCCGTATCTGGAACGCTT
GTTGGCAGGCGATGATGGTGAACTTACCCCGCAGCGGGCAAACCTCAACG
GCACACTCACTCCGGATGAGCTCACCTTGGAGGTTGCCGAGGAGCTTTTC
GCCACACCGCACGAGGGGCGCGTTCTGGGGGTGGATCCCGAAACTGGCCA
CGAGATCGTCGCCAAAGACGGTCGGTACGGGCCTTATGTGACTGAGGTCC
TGCCTAAGCACGATGACGACTATGGTGCAGCGGATCAGGGAACTAAGAAA
ACTAAGAAGGGTAGGAGGGCTTCCGCTTCTCAAGGCCCCAAACCGAGGAC
CGGGTCTTTGCTGCGGAGCATGGATTTGCAAACGATCACTCTCGAGGATG
CATTGAAACTGTTGTTGCTGCCTCGGGTTGTCGGTGTGGACCCTGCGTCC
GGTGAAGAGATCACCGCGCAGAACGGGCGTTATGGTCCATATCTGAAGCG
CGGCAAAGATTCTCGACCACTAACAACTGAAGACCAGATGTTCATCATTA
CTCTCGACGAGGCGTTAAAGATCTACGCTGAACCGAAACGTGCTGGTCGA
CAAAGTACTTCGCCGCCGCCTTTGCGTGAGCTGGGGACTGATCCGACGTC
GGGCAAGCCAATGCTGATCAAGGACGGCCGGTTCGGCCCGTATGTCACCG
ACGGTGAGACCAACGCTAGCCTGCGCAAGGGTGATGACGTGGTGTCGATA
ACCGATGAACGTGCCGCCGAATTGTTGGCTGACCGACGGGCCCGAGGTCC
GGTTAAGCGGCCTGCTAAGAAGGCTCGCAAGGTCCCGGCGAAGAAGGCAG
CTAGACTGGCTCCGGCCCGCGGGATCAGCCAGTCACCTCGC
>C3
ATGAAGGGCCCCAGGGGTTCTAGGAGCGGCAGAAATGGGAGCCCGCGGCG
ACTTGTTATAGTCGAGTCGCCGACGAAAGCGCGCAAATTGTCCGGCTATC
TAGGATCTGCGTACATAGTCGAATCATCCCGGGGGCATATCCGTGACCTG
CCGCGGACGGCGGCTGATGTGCCCGCGAAGTTCAAGTCTGAGCCGTGGGC
TCGGCTGGGCGTAAACGTCGACGCAGACTTTGAACCGCTCTACATCATCA
CCCCCGAGAAGAAGAGCACCGTCACTGAACTCAAAGGTCTGCTCCAAGGA
GTCGACGAGCTCTATCTGGCCACAGATGGTGACCGCGAGGGCGAAGCCAT
CGCCTGGCACCTGATGCAGACTCTGAAACCGCGAGTTCCGGTCAAGCGGA
TGGTTTTCCACGAGATCACCGAGCACGCGATCCTCGCCGCCGCTGCGCAT
CCCCGTGAACTGGATATTGACCTGGTTGACGCGCAGGAGACCCGACGCAT
CCTGGACCGGCTGTACGGGTATGAAGTTAGTCCGGTACTGTGGAAGAAGG
TAGCGCCTAAGCTTTCGGCGGGCCGAGTGCAATCGGTGGCCACCCGCATC
ATCGTGCAGCGTGAACGCGACCGGATGGCGTTCTGCAGCGCGGTGTACTG
GGACATTGTTGCCAAGCTGGACGCCAGCGTGTCCGATCCGACCGCCCAGC
CGCTCACCTTTGTCGCCCGTCTGACGGCTGTAGATGGCTTGCGGGTCGCC
ACCGGCCGCGATTTCGGTGCGATGGGCACGCTGCGTGGAGACTGTGAGGT
CTCCAAAATCATTGTCCTCGACGACCTGACCGCAACCACGTTGGCCGCAG
GATTGCGCGGCGCTCAGCTTACCGTGGCCTCAGCGGAAGAGAAGCTCTAC
ACTCGGCGACCGTATCCGCCATTCATGACGTCGACGCTGCAACAGGAAGC
CGGACGCAAGTTGCGATTCTCTGCGGAACGCACGATGAGCATCGCCCAGC
GGCTATATGAGAACGGTTACATTACCTACATGCGTACCGACTCGACCACG
TTGTCTGAGTCGGCTATCAACGCCGCTCGTACGCAGGCGCGTCAGCTCTA
CGGCGAGGAGTACGTCTCTGACTCGCCGCGTCAGTACACCCGCAAGGTAA
AGAACGCACAGGAAGCCCACGAGGCCATCCGGCCTGCAGGAGAGACGTTC
GCTACCCCGGACGCGGTGTGTAATGAACTCGACGGTGACGAATTCCGGAT
CTACGAGCTGGTATGGCGGCGTACTGTAGCTTCTCAGATGGCCGACGCTC
GCGGTACCACGCTGAGCTTGCGGATCGAGGGCCGAGCCGGCGAGCAACAC
GTTGTCTTCTCAGCTTCCGGGCGCACCCTGACCTTCCCCGGCTTCCTGAA
GGCCTATGTGGAAACCGTGGACGAGCTGGCCGGCGGCGAGGCTGACGACG
CTGAGCGTCGACTACCGCATCTGACCTCTGGTCAGCTGCTGGATGTCATC
GATCTGACTCCGGACGGGCACGCCACCAACCCTCCGGCCCGCTATACGGA
AGCTTCTTTGGTTAAAGCGTTGGAGGAGTTGGGTATCGGCCGCCCGTCGA
CGTACTCATCGATCATAAAGACCGTCCAGGACCGCGGCTATGTGCAGAAG
AAGGGCAGCGCCCTGGTGCCGTCGTGGGTCGCGTTCGCAGTTACCGGCCT
TTTGGAGCAGCATTTCGGCCGTCTCGTCGACTACGATTTCACCGCCGCGA
TGGAAGACGAGCTCGATGAGATCGCTAACGGGAATGAGCAACGTACCAAC
TGGCTCAACAACTTCTACTTTGGTGGCAACCACGGTGTGTCCGATTCAAT
AGCCCGCTCCGGCGGCTTGAAGAAGTTGGTCGGCGTGAATATTGAAGGGA
TTGATGCACGAGAGGTCAATTCCATCAAACTGTTTGACGATGAGCACGGT
CGTCCTGTCTATGTTCGGGTAGGCAAGACTGGGCCGTATCTGGAACGCTT
GTTGGCAGGCGATGATGGTGAACTTACCCCGCAGCGGGCAAACCTCAACG
GCACACTCACTCCGGATGAGCTCACCTTGGAGGTTGCCGAGGAGCTTTTC
GCCACACCGCACGAGGGGCGCGTTCTGGGGGTGGATCCCGAAACTGGCCA
CGAGATCGTCGCCAAAGACGGTCGGTACGGGCCTTATGTGACTGAGGTCC
TGCCTAAGCACGATGACGACTATGGTGCAGCGGATCAGGGAACTAAGAAA
ACTAAGAAGGGTAGGAGGGCTTCCGCTTCTCAAGGCCCCAAACCGAGGAC
CGGGTCTTTGCTGCGGAGCATGGATTTGCAAACGATCACTCTCGAGGATG
CATTGAAACTGTTGTTGCTGCCTCGGGTTGTCGGTGTGGACCCTGCGTCC
GGTGAAGAGATCACCGCGCAGAACGGGCGTTATGGTCCATATCTGAAGCG
CGGCAAAGATTCTCGACCACTAACAACTGAAGACCAGATGTTCATCATTA
CTCTCGACGAGGCGTTAAAGATCTACGCTGAACCGAAACGTGCTGGTCGA
CAAAGTACTTCGCCGCCGCCTTTGCGTGAGCTGGGGACTGATCCGACGTC
GGGCAAGCCAATGCTGATCAAGGACGGCCGGTTCGGCCCGTATGTCACCG
ACGGTGAGACCAACGCTAGCCTGCGCAAGGGTGATGACGTGGTGTCGATA
ACCGATGAACGTGCCGCCGAATTGTTGGCTGACCGACGGGCCCGAGGTCC
GGTTAAGCGGCCTGCTAAGAAGGCTCGCAAGGTCCCGGCGAAGAAGGCAG
CTAGACTGGCTCCGGCCCGCGGGATCAGCCAGTCACCTCGC
>C4
ATGAAGGGCCCCAGGGGTTCTAGGAGCGGCAGAAATGGGAGCCCGCGGCG
ACTTGTTATAGTCGAGTCGCCGACGAAAGCGCGCAAATTGTCCGGCTATC
TAGGATCTGCGTACATAGTCGAATCATCCCGGGGGCATATCCGTGACCTG
CCGCGGACGGCGGCTGATGTGCCCGCGAAGTTCAAGTCTGAGCCGTGGGC
TCGGCTGGGCGTAAACGTCGACGCAGACTTTGAACCGCTCTACATCATCA
CCCCCGAGAAGAAGAGCACCGTCACTGAACTCAAAGGTCTGCTCCAAGGA
GTCGACGAGCTCTATCTGGCCACAGATGGTGACCGCGAGGGCGAAGCCAT
CGCCTGGCACCTGATGCAGACTCTGAAACCGCGAGTTCCGGTCAAGCGGA
TGGTTTTCCACGAGATCACCGAGCACGCGATCCTCGCCGCCGCTGCGCAT
CCCCGTGAACTGGATATTGACCTGGTTGACGCGCAGGAGACCCGACGCAT
CCTGGACCGGCTGTACGGGTATGAAGTTAGTCCGGTACTGTGGAAGAAGG
TAGCGCCTAAGCTTTCGGCGGGCCGAGTGCAATCGGTGGCCACCCGCATC
ATCGTGCAGCGTGAACGCGACCGGATGGCGTTCTGCAGCGCGGTGTACTG
GGACATTGTTGCCAAGCTGGACGCCAGCGTGTCCGATCCGACCGCCCAGC
CGCTCACCTTTGTCGCCCGTCTGACGGCTGTAGATGGCTTGCGGGTCGCC
ACCGGCCGCGATTTCGGTGCGATGGGCACGCTGCGTGGAGACTGTGAGGT
CTCCAAAATCATTGTCCTCGACGACCTGACCGCAACCACGTTGGCCGCAG
GATTGCGCGGCGCTCAGCTTACCGTGGCCTCAGCGGAAGAGAAGCTCTAC
ACTCGGCGACCGTATCCGCCATTCATGACGTCGACGCTGCAACAGGAAGC
CGGACGCAAGTTGCGATTCTCTGCGGAACGCACGATGAGCATCGCCCAGC
GGCTATATGAGAACGGTTACATTACCTACATGCGTACCGACTCGACCACG
TTGTCTGAGTCGGCTATCAACGCCGCTCGTACGCAGGCGCGTCAGCTCTA
CGGCGAGGAGTACGTCTCTGACTCGCCGCGTCAGTACACCCGCAAGGTAA
AGAACGCACAGGAAGCCCACGAGGCCATCCGGCCTGCAGGAGAGACGTTC
GCTACCCCGGACGCGGTGTGTAATGAACTCGACGGTGACGAATTCCGGAT
CTACGAGCTGGTATGGCGGCGTACTGTAGCTTCTCAGATGGCCGACGCTC
GCGGTACCACGCTGAGCTTGCGGATCGAGGGCCGAGCCGGCGAGCAACAC
GTTGTCTTCTCAGCTTCCGGGCGCACCCTGACCTTCCCCGGCTTCCTGAA
GGCCTATGTGGAAACCGTGGACGAGCTGGCCGGCGGCGAGGCTGACGACG
CTGAGCGTCGACTACCGCATCTGACCTCTGGTCAGCTGCTGGATGTCATC
GATCTGACTCCGGACGGGCACGCCACCAACCCTCCGGCCCGCTATACGGA
AGCTTCTTTGGTTAAAGCGTTGGAGGAGTTGGGTATCGGCCGCCCGTCGA
CGTACTCATCGATCATAAAGACCGTCCAGGACCGCGGCTATGTGCAGAAG
AAGGGCAGCGCCCTGGTGCCGTCGTGGGTCGCGTTCGCAGTTACCGGCCT
TTTGGAGCAGCATTTCGGCCGTCTCGTCGACTACGATTTCACCGCCGCGA
TGGAAGACGAGCTCGATGAGATCGCTAACGGGAATGAGCAACGTACCAAC
TGGCTCAACAACTTCTACTTTGGTGGCAACCACGGTGTGTCCGATTCAAT
AGCCCGCTCCGGCGGCTTGAAGAAGTTGGTCGGCGTGAATATTGAAGGGA
TTGATGCACGAGAGGTCAATTCCATCAAACTGTTTGACGATGAGCACGGT
CGTCCTGTCTATGTTCGGGTAGGCAAGACTGGGCCGTATCTGGAACGCTT
GTTGGCAGGCGATGATGGTGAACTTACCCCGCAGCGGGCAAACCTCAACG
GCACACTCACTCCGGATGAGCTCACCTTGGAGGTTGCCGAGGAGCTTTTC
GCCACACCGCACGAGGGGCGCGTTCTGGGGGTGGATCCCGAAACTGGCCA
CGAGATCGTCGCCAAAGACGGTCGGTACGGGCCTTATGTGACTGAGGTCC
TGCCTAAGCACGATGACGACTATGGTGCAGCGGATCAGGGAACTAAGAAA
ACTAAGAAGGGTAGGAGGGCTTCCGCTTCTCAAGGCCCCAAACCGAGGAC
CGGGTCTTTGCTGCGGAGCATGGATTTGCAAACGATCACTCTCGAGGATG
CATTGAAACTGTTGTTGCTGCCTCGGGTTGTCGGTGTGGACCCTGCGTCC
GGTGAAGAGATCACCGCGCAGAACGGGCGTTATGGTCCATATCTGAAGCG
CGGCAAAGATTCTCGACCACTAACAACTGAAGACCAGATGTTCATCATTA
CTCTCGACGAGGCGTTAAAGATCTACGCTGAACCGAAACGTGCTGGTCGA
CAAAGTACTTCGCCGCCGCCTTTGCGTGAGCTGGGGACTGATCCGACGTC
GGGCAAGCCAATGCTGATCAAGGACGGCCGGTTCGGCCCGTATGTCACCG
ACGGTGAGACCAACGCTAGCCTGCGCAAGGGTGATGACGTGGTGTCGATA
ACCGATGAACGTGCCGCCGAATTGTTGGCTGACCGACGGGCCCGAGGTCC
GGTTAAGCGGCCTGCTAAGAAGGCTCGCAAGGTCCCGGCGAAGAAGGCAG
CTAGACTGGCTCCGGCCCGCGGGATCAGCCAGTCACCTCGC
>C5
ATGAAGGGCCCCAGGGGTTCTAGGAGCGGCAGAAATGGGAGCCCGCGGCG
ACTTGTTATAGTCGAGTCGCCGACGAAAGCGCGCAAATTGTCCGGCTATC
TAGGATCTGCGTACATAGTCGAATCATCCCGGGGGCATATCCGTGACCTG
CCGCGGACGGCGGCTGATGTGCCCGCGAAGTTCAAGTCTGAGCCGTGGGC
TCGGCTGGGCGTAAACGTCGACGCAGACTTTGAACCGCTCTACATCATCA
CCCCCGAGAAGAAGAGCACCGTCACTGAACTCAAAGGTCTGCTCCAAGGA
GTCGACGAGCTCTATCTGGCCACAGATGGTGACCGCGAGGGCGAAGCCAT
CGCCTGGCACCTGATGCAGACTCTGAAACCGCGAGTTCCGGTCAAGCGGA
TGGTTTTCCACGAGATCACCGAGCACGCGATCCTCGCCGCCGCTGCGCAT
CCCCGTGAACTGGATATTGACCTGGTTGACGCGCAGGAGACCCGACGCAT
CCTGGACCGGCTGTACGGGTATGAAGTTAGTCCGGTACTGTGGAAGAAGG
TAGCGCCTAAGCTTTCGGCGGGCCGAGTGCAATCGGTGGCCACCCGCATC
ATCGTGCAGCGTGAACGCGACCGGATGGCGTTCTGCAGCGCGGTGTACTG
GGACATTGTTGCCAAGCTGGACGCCAGCGTGTCCGATCCGACCGCCCAGC
CGCTCACCTTTGTCGCCCGTCTGACGGCTGTAGATGGCTTGCGGGTCGCC
ACCGGCCGCGATTTCGGTGCGATGGGCACGCTGCGTGGAGACTGTGAGGT
CTCCAAAATCATTGTCCTCGACGACCTGACCGCAACCACGTTGGCCGCAG
GATTGCGCGGCGCTCAGCTTACCGTGGCCTCAGCGGAAGAGAAGCTCTAC
ACTCGGCGACCGTATCCGCCATTCATGACGTCGACGCTGCAACAGGAAGC
CGGACGCAAGTTGCGATTCTCTGCGGAACGCACGATGAGCATCGCCCAGC
GGCTATATGAGAACGGTTACATTACCTACATGCGTACCGACTCGACCACG
TTGTCTGAGTCGGCTATCAACGCCGCTCGTACGCAGGCGCGTCAGCTCTA
CGGCGAGGAGTACGTCTCTGACTCGCCGCGTCAGTACACCCGCAAGGTAA
AGAACGCACAGGAAGCCCACGAGGCCATCCGGCCTGCAGGAGAGACGTTC
GCTACCCCGGACGCGGTGTGTAATGAACTCGACGGTGACGAATTCCGGAT
CTACGAGCTGGTATGGCGGCGTACTGTAGCTTCTCAGATGGCCGACGCTC
GCGGTACCACGCTGAGCTTGCGGATCGAGGGCCGAGCCGGCGAGCAACAC
GTTGTCTTCTCAGCTTCCGGGCGCACCCTGACCTTCCCCGGCTTCCTGAA
GGCCTATGTGGAAACCGTGGACGAGCTGGCCGGCGGCGAGGCTGACGACG
CTGAGCGTCGACTACCGCATCTGACCTCTGGTCAGCTGCTGGATGTCATC
GATCTGACTCCGGACGGGCACGCCACCAACCCTCCGGCCCGCTATACGGA
AGCTTCTTTGGTTAAAGCGTTGGAGGAGTTGGGTATCGGCCGCCCGTCGA
CGTACTCATCGATCATAAAGACCGTCCAGGACCGCGGCTATGTGCAGAAG
AAGGGCAGCGCCCTGGTGCCGTCGTGGGTCGCGTTCGCAGTTACCGGCCT
TTTGGAGCAGCATTTCGGCCGTCTCGTCGACTACGATTTCACCGCCGCGA
TGGAAGACGAGCTCGATGAGATCGCTAACGGGAATGAGCAACGTACCAAC
TGGCTCAACAACTTCTACTTTGGTGGCAACCACGGTGTGTCCGATTCAAT
AGCCCGCTCCGGCGGCTTGAAGAAGTTGGTCGGCGTGAATATTGAAGGGA
TTGATGCACGAGAGGTCAATTCCATCAAACTGTTTGACGATGAGCACGGT
CGTCCTGTCTATGTTCGGGTAGGCAAGACTGGGCCGTATCTGGAACGCTT
GTTGGCAGGCGATGATGGTGAACTTACCCCGCAGCGGGCAAACCTCAACG
GCACACTCACTCCGGATGAGCTCACCTTGGAGGTTGCCGAGGAGCTTTTC
GCCACACCGCACGAGGGGCGCGTTCTGGGGGTGGATCCCGAAACTGGCCA
CGAGATCGTCGCCAAAGACGGTCGGTACGGGCCTTATGTGACTGAGGTCC
TGCCTAAGCACGATGACGACTATGGTGCAGCGGATCAGGGAACTAAGAAA
ACTAAGAAGGGTAGGAGGGCTTCCGCTTCTCAAGGCCCCAAACCGAGGAC
CGGGTCTTTGCTGCGGAGCATGGATTTGCAAACGATCACTCTCGAGGATG
CATTGAAACTGTTGTTGCTGCCTCGGGTTGTCGGTGTGGACCCTGCGTCC
GGTGAAGAGATCACCGCGCAGAACGGGCGTTATGGTCCATATCTGAAGCG
CGGCAAAGATTCTCGACCACTAACAACTGAAGACCAGATGTTCATCATTA
CTCTCGACGAGGCGTTAAAGATCTACGCTGAACCGAAACGTGCTGGTCGA
CAAAGTACTTCGCCGCCGCCTTTGCGTGAGCTGGGGACTGATCCGACGTC
GGGCAAGCCAATGCTGATCAAGGACGGCCGGTTCGGCCCGTATGTCACCG
ACGGTGAGACCAACGCTAGCCTGCGCAAGGGTGATGACGTGGTGTCGATA
ACCGATGAACGTGCCGCCGAATTGTTGGCTGACCGACGGGCCCGAGGTCC
GGTTAAGCGGCCTGCTAAGAAGGCTCGCAAGGTCCCGGCGAAGAAGGCAG
CTAGACTGGCTCCGGCCCGCGGGATCAGCCAGTCACCTCGC
>C6
ATGAAGGGCCCCAGGGGTTCTAGGAGCGGCAGAAATGGGAGCCCGCGGCG
ACTTGTTATAGTCGAGTCGCCGACGAAAGCGCGCAAATTGTCCGGCTATC
TAGGATCTGCGTACATAGTCGAATCATCCCGGGGGCATATCCGTGACCTG
CCGCGGACGGCGGCTGATGTGCCCGCGAAGTTCAAGTCTGAGCCGTGGGC
TCGGCTGGGCGTAAACGTCGACGCAGACTTTGAACCGCTCTACATCATCA
CCCCCGAGAAGAAGAGCACCGTCACTGAACTCAAAGGTCTGCTCCAAGGA
GTCGACGAGCTCTATCTGGCCACAGATGGTGACCGCGAGGGCGAAGCCAT
CGCCTGGCACCTGATGCAGACTCTGAAACCGCGAGTTCCGGTCAAGCGGA
TGGTTTTCCACGAGATCACCGAGCACGCGATCCTCGCCGCCGCTGCGCAT
CCCCGTGAACTGGATATTGACCTGGTTGACGCGCAGGAGACCCGACGCAT
CCTGGACCGGCTGTACGGGTATGAAGTTAGTCCGGTACTGTGGAAGAAGG
TAGCGCCTAAGCTTTCGGCGGGCCGAGTGCAATCGGTGGCCACCCGCATC
ATCGTGCAGCGTGAACGCGACCGGATGGCGTTCTGCAGCGCGGTGTACTG
GGACATTGTTGCCAAGCTGGACGCCAGCGTGTCCGATCCGACCGCCCAGC
CGCTCACCTTTGTCGCCCGTCTGACGGCTGTAGATGGCTTGCGGGTCGCC
ACCGGCCGCGATTTCGGTGCGATGGGCACGCTGCGTGGAGACTGTGAGGT
CTCCAAAATCATTGTCCTCGACGACCTGACCGCAACCACGTTGGCCGCAG
GATTGCGCGGCGCTCAGCTTACCGTGGCCTCAGCGGAAGAGAAGCTCTAC
ACTCGGCGACCGTATCCGCCATTCATGACGTCGACGCTGCAACAGGAAGC
CGGACGCAAGTTGCGATTCTCTGCGGAACGCACGATGAGCATCGCCCAGC
GGCTATATGAGAACGGTTACATTACCTACATGCGTACCGACTCGACCACG
TTGTCTGAGTCGGCTATCAACGCCGCTCGTACGCAGGCGCGTCAGCTCTA
CGGCGAGGAGTACGTCTCTGACTCGCCGCGTCAGTACACCCGCAAGGTAA
AGAACGCACAGGAAGCCCACGAGGCCATCCGGCCTGCAGGAGAGACGTTC
GCTACCCCGGACGCGGTGTGTAATGAACTCGACGGTGACGAATTCCGGAT
CTACGAGCTGGTATGGCGGCGTACTGTAGCTTCTCAGATGGCCGACGCTC
GCGGTACCACGCTGAGCTTGCGGATCGAGGGCCGAGCCGGCGAGCAACAC
GTTGTCTTCTCAGCTTCCGGGCGCACCCTGACCTTCCCCGGCTTCCTGAA
GGCCTATGTGGAAACCGTGGACGAGCTGGCCGGCGGCGAGGCTGACGACG
CTGAGCGTCGACTACCGCATCTGACCTCTGGTCAGCTGCTGGATGTCATC
GATCTGACTCCGGACGGGCACGCCACCAACCCTCCGGCCCGCTATACGGA
AGCTTCTTTGGTTAAAGCGTTGGAGGAGTTGGGTATCGGCCGCCCGTCGA
CGTACTCATCGATCATAAAGACCGTCCAGGACCGCGGCTATGTGCAGAAG
AAGGGCAGCGCCCTGGTGCCGTCGTGGGTCGCGTTCGCAGTTACCGGCCT
TTTGGAGCAGCATTTCGGCCGTCTCGTCGACTACGATTTCACCGCCGCGA
TGGAAGACGAGCTCGATGAGATCGCTAACGGGAATGAGCAACGTACCAAC
TGGCTCAACAACTTCTACTTTGGTGGCAACCACGGTGTGTCCGATTCAAT
AGCCCGCTCCGGCGGCTTGAAGAAGTTGGTCGGCGTGAATATTGAAGGGA
TTGATGCACGAGAGGTCAATTCCATCAAACTGTTTGACGATGAGCACGGT
CGTCCTGTCTATGTTCGGGTAGGCAAGACTGGGCCGTATCTGGAACGCTT
GTTGGCAGGCGATGATGGTGAACTTACCCCGCAGCGGGCAAACCTCAACG
GCACACTCACTCCGGATGAGCTCACCTTGGAGGTTGCCGAGGAGCTTTTC
GCCACACCGCACGAGGGGCGCGTTCTGGGGGTGGATCCCGAAACTGGCCA
CGAGATCGTCGCCAAAGACGGTCGGTACGGGCCTTATGTGACTGAGGTCC
TGCCTAAGCACGATGACGACTATGGTGCAGCGGATCAGGGAACTAAGAAA
ACTAAGAAGGGTAGGAGGGCTTCCGCTTCTCAAGGCCCCAAACCGAGGAC
CGGGTCTTTGCTGCGGAGCATGGATTTGCAAACGATCACTCTCGAGGATG
CATTGAAACTGTTGTTGCTGCCTCGGGTTGTCGGTGTGGACCCTGCGTCC
GGTGAAGAGATCACCGCGCAGAACGGGCGTTATGGTCCATATCTGAAGCG
CGGCAAAGATTCTCGACCACTAACAACTGAAGACCAGATGTTCATCATTA
CTCTCGACGAGGCGTTAAAGATCTACGCTGAACCGAAACGTGCTGGTCGA
CAAAGTACTTCGCCGCCGCCTTTGCGTGAGCTGGGGACTGATCCGACGTC
GGGCAAGCCAATGCTGATCAAGGACGGCCGGTTCGGCCCGTATGTCACCG
ACGGTGAGACCAACGCTAGCCTGCGCAAGGGTGATGACGTGGTGTCGATA
ACCGATGAACGTGCCGCCGAATTGTTGGCTGACCGACGGGCCCGAGGTCC
GGTTAAGCGGCCTGCTAAGAAGGCTCGCAAGGTCCCGGCGAAGAAGGCAG
CTAGACTGGCTCCGGCCCGCGGGATCAGCCAGTCACCTCGC
>C1
MKGPRGSRSGRNGSPRRLVIVESPTKARKLSGYLGSAYIVESSRGHIRDL
PRTAADVPAKFKSEPWARLGVNVDADFEPLYIITPEKKSTVTELKGLLQG
VDELYLATDGDREGEAIAWHLMQTLKPRVPVKRMVFHEITEHAILAAAAH
PRELDIDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRI
IVQRERDRMAFCSAVYWDIVAKLDASVSDPTAQPLTFVARLTAVDGLRVA
TGRDFGAMGTLRGDCEVSKIIVLDDLTATTLAAGLRGAQLTVASAEEKLY
TRRPYPPFMTSTLQQEAGRKLRFSAERTMSIAQRLYENGYITYMRTDSTT
LSESAINAARTQARQLYGEEYVSDSPRQYTRKVKNAQEAHEAIRPAGETF
ATPDAVCNELDGDEFRIYELVWRRTVASQMADARGTTLSLRIEGRAGEQH
VVFSASGRTLTFPGFLKAYVETVDELAGGEADDAERRLPHLTSGQLLDVI
DLTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTVQDRGYVQK
KGSALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIANGNEQRTN
WLNNFYFGGNHGVSDSIARSGGLKKLVGVNIEGIDAREVNSIKLFDDEHG
RPVYVRVGKTGPYLERLLAGDDGELTPQRANLNGTLTPDELTLEVAEELF
ATPHEGRVLGVDPETGHEIVAKDGRYGPYVTEVLPKHDDDYGAADQGTKK
TKKGRRASASQGPKPRTGSLLRSMDLQTITLEDALKLLLLPRVVGVDPAS
GEEITAQNGRYGPYLKRGKDSRPLTTEDQMFIITLDEALKIYAEPKRAGR
QSTSPPPLRELGTDPTSGKPMLIKDGRFGPYVTDGETNASLRKGDDVVSI
TDERAAELLADRRARGPVKRPAKKARKVPAKKAARLAPARGISQSPR
>C2
MKGPRGSRSGRNGSPRRLVIVESPTKARKLSGYLGSAYIVESSRGHIRDL
PRTAADVPAKFKSEPWARLGVNVDADFEPLYIITPEKKSTVTELKGLLQG
VDELYLATDGDREGEAIAWHLMQTLKPRVPVKRMVFHEITEHAILAAAAH
PRELDIDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRI
IVQRERDRMAFCSAVYWDIVAKLDASVSDPTAQPLTFVARLTAVDGLRVA
TGRDFGAMGTLRGDCEVSKIIVLDDLTATTLAAGLRGAQLTVASAEEKLY
TRRPYPPFMTSTLQQEAGRKLRFSAERTMSIAQRLYENGYITYMRTDSTT
LSESAINAARTQARQLYGEEYVSDSPRQYTRKVKNAQEAHEAIRPAGETF
ATPDAVCNELDGDEFRIYELVWRRTVASQMADARGTTLSLRIEGRAGEQH
VVFSASGRTLTFPGFLKAYVETVDELAGGEADDAERRLPHLTSGQLLDVI
DLTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTVQDRGYVQK
KGSALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIANGNEQRTN
WLNNFYFGGNHGVSDSIARSGGLKKLVGVNIEGIDAREVNSIKLFDDEHG
RPVYVRVGKTGPYLERLLAGDDGELTPQRANLNGTLTPDELTLEVAEELF
ATPHEGRVLGVDPETGHEIVAKDGRYGPYVTEVLPKHDDDYGAADQGTKK
TKKGRRASASQGPKPRTGSLLRSMDLQTITLEDALKLLLLPRVVGVDPAS
GEEITAQNGRYGPYLKRGKDSRPLTTEDQMFIITLDEALKIYAEPKRAGR
QSTSPPPLRELGTDPTSGKPMLIKDGRFGPYVTDGETNASLRKGDDVVSI
TDERAAELLADRRARGPVKRPAKKARKVPAKKAARLAPARGISQSPR
>C3
MKGPRGSRSGRNGSPRRLVIVESPTKARKLSGYLGSAYIVESSRGHIRDL
PRTAADVPAKFKSEPWARLGVNVDADFEPLYIITPEKKSTVTELKGLLQG
VDELYLATDGDREGEAIAWHLMQTLKPRVPVKRMVFHEITEHAILAAAAH
PRELDIDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRI
IVQRERDRMAFCSAVYWDIVAKLDASVSDPTAQPLTFVARLTAVDGLRVA
TGRDFGAMGTLRGDCEVSKIIVLDDLTATTLAAGLRGAQLTVASAEEKLY
TRRPYPPFMTSTLQQEAGRKLRFSAERTMSIAQRLYENGYITYMRTDSTT
LSESAINAARTQARQLYGEEYVSDSPRQYTRKVKNAQEAHEAIRPAGETF
ATPDAVCNELDGDEFRIYELVWRRTVASQMADARGTTLSLRIEGRAGEQH
VVFSASGRTLTFPGFLKAYVETVDELAGGEADDAERRLPHLTSGQLLDVI
DLTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTVQDRGYVQK
KGSALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIANGNEQRTN
WLNNFYFGGNHGVSDSIARSGGLKKLVGVNIEGIDAREVNSIKLFDDEHG
RPVYVRVGKTGPYLERLLAGDDGELTPQRANLNGTLTPDELTLEVAEELF
ATPHEGRVLGVDPETGHEIVAKDGRYGPYVTEVLPKHDDDYGAADQGTKK
TKKGRRASASQGPKPRTGSLLRSMDLQTITLEDALKLLLLPRVVGVDPAS
GEEITAQNGRYGPYLKRGKDSRPLTTEDQMFIITLDEALKIYAEPKRAGR
QSTSPPPLRELGTDPTSGKPMLIKDGRFGPYVTDGETNASLRKGDDVVSI
TDERAAELLADRRARGPVKRPAKKARKVPAKKAARLAPARGISQSPR
>C4
MKGPRGSRSGRNGSPRRLVIVESPTKARKLSGYLGSAYIVESSRGHIRDL
PRTAADVPAKFKSEPWARLGVNVDADFEPLYIITPEKKSTVTELKGLLQG
VDELYLATDGDREGEAIAWHLMQTLKPRVPVKRMVFHEITEHAILAAAAH
PRELDIDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRI
IVQRERDRMAFCSAVYWDIVAKLDASVSDPTAQPLTFVARLTAVDGLRVA
TGRDFGAMGTLRGDCEVSKIIVLDDLTATTLAAGLRGAQLTVASAEEKLY
TRRPYPPFMTSTLQQEAGRKLRFSAERTMSIAQRLYENGYITYMRTDSTT
LSESAINAARTQARQLYGEEYVSDSPRQYTRKVKNAQEAHEAIRPAGETF
ATPDAVCNELDGDEFRIYELVWRRTVASQMADARGTTLSLRIEGRAGEQH
VVFSASGRTLTFPGFLKAYVETVDELAGGEADDAERRLPHLTSGQLLDVI
DLTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTVQDRGYVQK
KGSALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIANGNEQRTN
WLNNFYFGGNHGVSDSIARSGGLKKLVGVNIEGIDAREVNSIKLFDDEHG
RPVYVRVGKTGPYLERLLAGDDGELTPQRANLNGTLTPDELTLEVAEELF
ATPHEGRVLGVDPETGHEIVAKDGRYGPYVTEVLPKHDDDYGAADQGTKK
TKKGRRASASQGPKPRTGSLLRSMDLQTITLEDALKLLLLPRVVGVDPAS
GEEITAQNGRYGPYLKRGKDSRPLTTEDQMFIITLDEALKIYAEPKRAGR
QSTSPPPLRELGTDPTSGKPMLIKDGRFGPYVTDGETNASLRKGDDVVSI
TDERAAELLADRRARGPVKRPAKKARKVPAKKAARLAPARGISQSPR
>C5
MKGPRGSRSGRNGSPRRLVIVESPTKARKLSGYLGSAYIVESSRGHIRDL
PRTAADVPAKFKSEPWARLGVNVDADFEPLYIITPEKKSTVTELKGLLQG
VDELYLATDGDREGEAIAWHLMQTLKPRVPVKRMVFHEITEHAILAAAAH
PRELDIDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRI
IVQRERDRMAFCSAVYWDIVAKLDASVSDPTAQPLTFVARLTAVDGLRVA
TGRDFGAMGTLRGDCEVSKIIVLDDLTATTLAAGLRGAQLTVASAEEKLY
TRRPYPPFMTSTLQQEAGRKLRFSAERTMSIAQRLYENGYITYMRTDSTT
LSESAINAARTQARQLYGEEYVSDSPRQYTRKVKNAQEAHEAIRPAGETF
ATPDAVCNELDGDEFRIYELVWRRTVASQMADARGTTLSLRIEGRAGEQH
VVFSASGRTLTFPGFLKAYVETVDELAGGEADDAERRLPHLTSGQLLDVI
DLTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTVQDRGYVQK
KGSALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIANGNEQRTN
WLNNFYFGGNHGVSDSIARSGGLKKLVGVNIEGIDAREVNSIKLFDDEHG
RPVYVRVGKTGPYLERLLAGDDGELTPQRANLNGTLTPDELTLEVAEELF
ATPHEGRVLGVDPETGHEIVAKDGRYGPYVTEVLPKHDDDYGAADQGTKK
TKKGRRASASQGPKPRTGSLLRSMDLQTITLEDALKLLLLPRVVGVDPAS
GEEITAQNGRYGPYLKRGKDSRPLTTEDQMFIITLDEALKIYAEPKRAGR
QSTSPPPLRELGTDPTSGKPMLIKDGRFGPYVTDGETNASLRKGDDVVSI
TDERAAELLADRRARGPVKRPAKKARKVPAKKAARLAPARGISQSPR
>C6
MKGPRGSRSGRNGSPRRLVIVESPTKARKLSGYLGSAYIVESSRGHIRDL
PRTAADVPAKFKSEPWARLGVNVDADFEPLYIITPEKKSTVTELKGLLQG
VDELYLATDGDREGEAIAWHLMQTLKPRVPVKRMVFHEITEHAILAAAAH
PRELDIDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRI
IVQRERDRMAFCSAVYWDIVAKLDASVSDPTAQPLTFVARLTAVDGLRVA
TGRDFGAMGTLRGDCEVSKIIVLDDLTATTLAAGLRGAQLTVASAEEKLY
TRRPYPPFMTSTLQQEAGRKLRFSAERTMSIAQRLYENGYITYMRTDSTT
LSESAINAARTQARQLYGEEYVSDSPRQYTRKVKNAQEAHEAIRPAGETF
ATPDAVCNELDGDEFRIYELVWRRTVASQMADARGTTLSLRIEGRAGEQH
VVFSASGRTLTFPGFLKAYVETVDELAGGEADDAERRLPHLTSGQLLDVI
DLTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTVQDRGYVQK
KGSALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIANGNEQRTN
WLNNFYFGGNHGVSDSIARSGGLKKLVGVNIEGIDAREVNSIKLFDDEHG
RPVYVRVGKTGPYLERLLAGDDGELTPQRANLNGTLTPDELTLEVAEELF
ATPHEGRVLGVDPETGHEIVAKDGRYGPYVTEVLPKHDDDYGAADQGTKK
TKKGRRASASQGPKPRTGSLLRSMDLQTITLEDALKLLLLPRVVGVDPAS
GEEITAQNGRYGPYLKRGKDSRPLTTEDQMFIITLDEALKIYAEPKRAGR
QSTSPPPLRELGTDPTSGKPMLIKDGRFGPYVTDGETNASLRKGDDVVSI
TDERAAELLADRRARGPVKRPAKKARKVPAKKAARLAPARGISQSPR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/12res/topA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 2841 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579790176
      Setting output file names to "/data/12res/topA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1638292481
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0496755555
      Seed = 1587202637
      Swapseed = 1579790176
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -6358.294202 -- -24.965149
         Chain 2 -- -6358.293233 -- -24.965149
         Chain 3 -- -6358.294202 -- -24.965149
         Chain 4 -- -6358.293837 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -6358.294202 -- -24.965149
         Chain 2 -- -6358.293233 -- -24.965149
         Chain 3 -- -6358.294202 -- -24.965149
         Chain 4 -- -6358.294202 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-6358.294] (-6358.293) (-6358.294) (-6358.294) * [-6358.294] (-6358.293) (-6358.294) (-6358.294) 
        500 -- (-3919.687) (-3889.198) (-3917.865) [-3891.326] * (-3918.417) (-3908.196) (-3947.587) [-3899.741] -- 0:00:00
       1000 -- (-3917.088) [-3890.959] (-3899.233) (-3895.941) * [-3891.685] (-3892.585) (-3898.698) (-3891.938) -- 0:00:00
       1500 -- [-3897.472] (-3892.513) (-3888.621) (-3900.033) * [-3890.403] (-3893.289) (-3891.554) (-3898.899) -- 0:00:00
       2000 -- [-3891.746] (-3894.501) (-3891.723) (-3895.541) * [-3895.381] (-3889.901) (-3894.727) (-3896.313) -- 0:00:00
       2500 -- (-3895.261) (-3896.308) (-3892.137) [-3888.386] * (-3889.774) [-3892.739] (-3889.951) (-3895.827) -- 0:06:39
       3000 -- (-3896.070) (-3893.117) [-3890.122] (-3902.010) * (-3895.649) [-3891.243] (-3895.071) (-3893.130) -- 0:05:32
       3500 -- (-3889.014) (-3890.238) [-3887.478] (-3902.958) * (-3900.090) (-3892.872) (-3905.913) [-3893.523] -- 0:04:44
       4000 -- (-3890.504) [-3893.743] (-3892.529) (-3895.039) * [-3904.472] (-3892.894) (-3887.952) (-3891.479) -- 0:04:09
       4500 -- (-3887.587) (-3894.310) (-3892.849) [-3899.333] * (-3894.180) (-3891.070) [-3890.963] (-3895.100) -- 0:03:41
       5000 -- (-3904.549) [-3891.134] (-3896.513) (-3891.880) * (-3897.948) (-3890.275) (-3892.978) [-3889.544] -- 0:03:19

      Average standard deviation of split frequencies: 0.067344

       5500 -- [-3893.700] (-3893.757) (-3892.063) (-3893.130) * (-3901.929) (-3891.520) [-3890.552] (-3894.658) -- 0:03:00
       6000 -- [-3890.008] (-3891.015) (-3890.362) (-3887.678) * (-3891.822) [-3892.211] (-3888.760) (-3889.706) -- 0:02:45
       6500 -- (-3893.215) [-3888.213] (-3889.616) (-3895.444) * [-3889.079] (-3889.491) (-3898.662) (-3898.656) -- 0:02:32
       7000 -- (-3900.208) (-3885.079) [-3889.165] (-3895.426) * (-3891.546) [-3891.192] (-3895.843) (-3892.774) -- 0:02:21
       7500 -- (-3892.547) (-3885.938) (-3895.775) [-3890.788] * (-3892.568) [-3889.510] (-3891.294) (-3889.077) -- 0:02:12
       8000 -- [-3890.157] (-3886.690) (-3893.865) (-3890.403) * (-3891.102) [-3892.609] (-3891.933) (-3895.339) -- 0:02:04
       8500 -- (-3890.337) (-3886.415) [-3900.914] (-3897.710) * [-3894.418] (-3886.587) (-3897.232) (-3892.834) -- 0:01:56
       9000 -- [-3886.440] (-3884.725) (-3895.822) (-3893.774) * (-3892.992) (-3893.738) [-3888.320] (-3892.905) -- 0:01:50
       9500 -- [-3892.748] (-3884.826) (-3892.456) (-3893.350) * (-3891.563) (-3891.420) (-3894.974) [-3887.488] -- 0:01:44
      10000 -- (-3893.391) [-3883.155] (-3893.088) (-3896.601) * [-3889.246] (-3895.879) (-3890.129) (-3890.522) -- 0:01:39

      Average standard deviation of split frequencies: 0.065128

      10500 -- (-3898.632) [-3885.674] (-3895.727) (-3889.053) * (-3897.520) [-3891.348] (-3893.995) (-3896.209) -- 0:01:34
      11000 -- (-3893.196) (-3884.499) [-3891.805] (-3897.585) * (-3894.887) (-3891.108) (-3897.817) [-3892.129] -- 0:01:29
      11500 -- [-3888.211] (-3885.148) (-3890.430) (-3891.956) * [-3886.638] (-3890.581) (-3900.711) (-3893.893) -- 0:01:25
      12000 -- (-3896.043) [-3883.780] (-3894.480) (-3891.725) * (-3892.929) [-3890.317] (-3892.081) (-3894.553) -- 0:01:22
      12500 -- (-3895.465) (-3883.229) [-3895.849] (-3891.373) * [-3891.829] (-3900.805) (-3896.498) (-3895.573) -- 0:01:19
      13000 -- [-3888.183] (-3882.411) (-3890.991) (-3894.021) * (-3895.115) (-3889.671) [-3889.036] (-3899.691) -- 0:01:15
      13500 -- (-3894.962) [-3881.686] (-3896.333) (-3887.191) * [-3895.828] (-3887.810) (-3892.236) (-3894.835) -- 0:01:13
      14000 -- (-3889.783) [-3883.565] (-3895.213) (-3893.643) * (-3891.421) [-3893.667] (-3895.372) (-3899.211) -- 0:01:10
      14500 -- (-3897.266) [-3883.670] (-3892.873) (-3893.040) * [-3895.656] (-3894.644) (-3907.744) (-3901.020) -- 0:01:07
      15000 -- (-3890.846) (-3884.959) (-3903.431) [-3897.320] * (-3897.708) [-3895.062] (-3886.955) (-3904.818) -- 0:02:11

      Average standard deviation of split frequencies: 0.041248

      15500 -- [-3892.829] (-3883.137) (-3888.599) (-3908.997) * [-3893.627] (-3899.105) (-3897.675) (-3891.771) -- 0:02:07
      16000 -- (-3891.543) [-3884.598] (-3892.606) (-3888.534) * (-3890.926) [-3890.937] (-3894.078) (-3895.806) -- 0:02:03
      16500 -- [-3897.076] (-3884.069) (-3884.568) (-3894.271) * (-3888.077) (-3891.155) [-3895.858] (-3894.699) -- 0:01:59
      17000 -- (-3894.204) [-3882.900] (-3894.974) (-3891.812) * (-3885.670) [-3893.149] (-3900.979) (-3895.148) -- 0:01:55
      17500 -- [-3887.091] (-3883.691) (-3899.138) (-3901.891) * (-3891.427) [-3893.902] (-3900.418) (-3887.801) -- 0:01:52
      18000 -- [-3893.581] (-3882.942) (-3900.992) (-3900.767) * (-3892.139) (-3901.865) (-3897.508) [-3893.085] -- 0:01:49
      18500 -- (-3893.679) (-3883.204) [-3890.392] (-3894.998) * (-3896.530) (-3888.934) (-3894.613) [-3891.213] -- 0:01:46
      19000 -- (-3895.652) (-3883.170) (-3894.473) [-3892.356] * (-3901.213) (-3894.434) [-3890.143] (-3891.870) -- 0:01:43
      19500 -- [-3896.602] (-3884.410) (-3897.376) (-3892.127) * (-3896.211) [-3890.045] (-3891.759) (-3897.427) -- 0:01:40
      20000 -- (-3891.992) (-3883.623) (-3906.758) [-3891.798] * (-3900.377) (-3891.081) [-3896.202] (-3888.267) -- 0:01:38

      Average standard deviation of split frequencies: 0.037473

      20500 -- (-3891.749) (-3881.930) [-3888.466] (-3894.689) * [-3896.975] (-3889.324) (-3897.393) (-3902.404) -- 0:01:35
      21000 -- (-3896.419) (-3883.873) (-3888.447) [-3890.689] * [-3896.176] (-3895.067) (-3899.389) (-3892.218) -- 0:01:33
      21500 -- (-3900.968) (-3883.564) (-3886.831) [-3891.414] * (-3893.882) (-3890.176) [-3899.118] (-3890.320) -- 0:01:31
      22000 -- (-3895.514) (-3884.066) [-3885.708] (-3892.304) * (-3899.892) (-3889.501) (-3895.284) [-3890.506] -- 0:01:28
      22500 -- (-3901.806) (-3884.799) (-3886.387) [-3891.235] * (-3897.673) (-3906.756) [-3896.268] (-3896.316) -- 0:01:26
      23000 -- [-3893.622] (-3883.053) (-3887.292) (-3890.764) * [-3891.218] (-3892.215) (-3890.765) (-3898.831) -- 0:01:24
      23500 -- (-3893.132) [-3882.919] (-3889.020) (-3893.665) * (-3888.546) (-3902.121) (-3897.382) [-3892.848] -- 0:01:23
      24000 -- [-3905.056] (-3883.907) (-3886.025) (-3894.635) * (-3893.482) (-3882.899) [-3889.586] (-3891.872) -- 0:01:21
      24500 -- [-3894.169] (-3884.289) (-3886.001) (-3902.540) * (-3891.213) [-3883.093] (-3892.165) (-3893.386) -- 0:01:19
      25000 -- [-3894.454] (-3884.571) (-3888.838) (-3900.613) * (-3895.737) [-3883.262] (-3897.759) (-3894.904) -- 0:01:18

      Average standard deviation of split frequencies: 0.034614

      25500 -- [-3889.446] (-3884.563) (-3883.981) (-3899.171) * (-3899.724) (-3883.877) [-3891.548] (-3898.528) -- 0:01:16
      26000 -- (-3898.611) (-3883.983) [-3883.838] (-3894.348) * (-3889.623) (-3884.189) [-3890.511] (-3887.535) -- 0:01:14
      26500 -- (-3896.880) (-3884.539) [-3882.146] (-3892.583) * (-3888.724) [-3886.113] (-3890.104) (-3890.888) -- 0:01:13
      27000 -- [-3887.342] (-3884.539) (-3883.800) (-3890.625) * (-3889.461) [-3888.549] (-3894.492) (-3892.037) -- 0:01:12
      27500 -- (-3889.940) (-3884.757) [-3882.914] (-3897.087) * (-3897.858) (-3890.247) (-3899.353) [-3891.762] -- 0:01:46
      28000 -- [-3891.207] (-3883.536) (-3884.100) (-3895.651) * (-3890.791) (-3886.338) (-3896.458) [-3894.787] -- 0:01:44
      28500 -- [-3892.907] (-3885.819) (-3882.777) (-3891.333) * (-3892.791) (-3883.976) [-3891.756] (-3897.014) -- 0:01:42
      29000 -- (-3888.565) (-3891.706) [-3884.700] (-3891.427) * [-3891.482] (-3884.849) (-3891.280) (-3889.632) -- 0:01:40
      29500 -- [-3888.138] (-3885.306) (-3884.743) (-3897.494) * [-3893.554] (-3886.092) (-3897.047) (-3899.555) -- 0:01:38
      30000 -- (-3890.735) [-3886.627] (-3884.718) (-3894.108) * [-3893.437] (-3887.830) (-3892.742) (-3887.114) -- 0:01:37

      Average standard deviation of split frequencies: 0.041846

      30500 -- (-3894.755) (-3885.002) [-3885.883] (-3891.027) * (-3888.189) (-3883.061) [-3893.024] (-3895.869) -- 0:01:35
      31000 -- [-3897.212] (-3885.189) (-3892.546) (-3900.597) * (-3899.581) (-3884.028) (-3888.751) [-3893.240] -- 0:01:33
      31500 -- (-3890.599) [-3884.682] (-3883.136) (-3901.745) * (-3899.718) (-3884.880) [-3892.007] (-3896.431) -- 0:01:32
      32000 -- (-3894.968) [-3884.106] (-3883.137) (-3895.250) * (-3898.876) [-3883.584] (-3893.507) (-3893.719) -- 0:01:30
      32500 -- (-3892.349) [-3883.648] (-3882.987) (-3899.041) * [-3901.131] (-3884.904) (-3895.969) (-3897.644) -- 0:01:29
      33000 -- (-3897.792) (-3883.905) [-3886.926] (-3899.898) * [-3900.339] (-3882.071) (-3887.749) (-3896.060) -- 0:01:27
      33500 -- (-3903.798) (-3883.994) [-3887.029] (-3896.767) * (-3889.823) [-3887.919] (-3891.707) (-3896.618) -- 0:01:26
      34000 -- (-3897.443) (-3883.995) (-3884.520) [-3890.927] * (-3906.626) (-3888.613) (-3893.758) [-3890.583] -- 0:01:25
      34500 -- (-3897.524) (-3883.814) [-3885.858] (-3898.000) * (-3883.179) (-3887.531) [-3892.899] (-3903.579) -- 0:01:23
      35000 -- [-3890.282] (-3883.814) (-3885.469) (-3892.617) * (-3883.332) (-3886.114) [-3889.892] (-3890.791) -- 0:01:22

      Average standard deviation of split frequencies: 0.037974

      35500 -- (-3889.265) [-3883.825] (-3886.429) (-3900.199) * (-3882.992) (-3887.157) [-3892.933] (-3890.970) -- 0:01:21
      36000 -- (-3890.142) (-3885.443) (-3884.352) [-3886.285] * (-3883.056) (-3884.417) (-3893.544) [-3893.242] -- 0:01:20
      36500 -- (-3889.194) (-3883.798) (-3886.026) [-3883.767] * (-3883.575) [-3883.801] (-3897.478) (-3894.010) -- 0:01:19
      37000 -- [-3897.311] (-3883.812) (-3884.445) (-3883.565) * [-3883.692] (-3885.853) (-3900.073) (-3890.028) -- 0:01:18
      37500 -- [-3887.763] (-3884.064) (-3884.246) (-3884.036) * (-3882.488) (-3883.869) (-3889.825) [-3892.328] -- 0:01:17
      38000 -- (-3891.039) (-3884.064) (-3886.404) [-3884.358] * (-3882.586) (-3884.913) [-3887.570] (-3893.302) -- 0:01:15
      38500 -- (-3894.121) [-3884.064] (-3888.817) (-3883.210) * (-3882.364) (-3885.098) (-3891.659) [-3892.725] -- 0:01:14
      39000 -- (-3894.061) [-3884.064] (-3887.601) (-3883.344) * (-3882.286) (-3883.319) [-3890.088] (-3890.335) -- 0:01:13
      39500 -- (-3896.906) (-3884.064) [-3884.301] (-3883.043) * (-3882.447) (-3883.988) (-3890.501) [-3893.423] -- 0:01:12
      40000 -- [-3901.572] (-3883.469) (-3885.495) (-3884.831) * (-3883.177) (-3883.844) (-3895.135) [-3890.368] -- 0:01:12

      Average standard deviation of split frequencies: 0.029624

      40500 -- (-3890.996) (-3884.689) [-3885.132] (-3884.742) * (-3883.031) (-3885.110) (-3892.037) [-3893.483] -- 0:01:34
      41000 -- (-3889.430) (-3884.409) (-3886.816) [-3883.693] * (-3882.695) [-3885.810] (-3891.384) (-3897.416) -- 0:01:33
      41500 -- [-3887.496] (-3884.134) (-3886.250) (-3886.272) * (-3882.273) (-3885.040) [-3887.728] (-3893.225) -- 0:01:32
      42000 -- (-3899.169) (-3883.984) [-3884.830] (-3885.074) * (-3882.011) (-3885.085) [-3892.467] (-3896.754) -- 0:01:31
      42500 -- (-3887.097) [-3884.839] (-3883.697) (-3884.981) * (-3881.869) [-3890.910] (-3886.111) (-3898.650) -- 0:01:30
      43000 -- (-3900.975) (-3886.056) (-3884.161) [-3885.036] * (-3881.905) (-3888.728) (-3898.794) [-3896.508] -- 0:01:29
      43500 -- (-3896.399) (-3886.055) (-3884.830) [-3886.689] * [-3882.551] (-3885.110) (-3902.873) (-3895.081) -- 0:01:27
      44000 -- [-3891.904] (-3885.923) (-3889.883) (-3885.097) * (-3883.972) (-3884.458) [-3900.349] (-3891.205) -- 0:01:26
      44500 -- [-3889.426] (-3885.170) (-3885.018) (-3885.068) * [-3884.008] (-3882.836) (-3899.466) (-3892.347) -- 0:01:25
      45000 -- [-3893.950] (-3886.219) (-3885.599) (-3886.313) * (-3884.095) (-3901.755) [-3893.957] (-3892.901) -- 0:01:24

      Average standard deviation of split frequencies: 0.025107

      45500 -- [-3894.274] (-3885.778) (-3884.626) (-3885.814) * [-3884.045] (-3888.521) (-3892.963) (-3891.727) -- 0:01:23
      46000 -- [-3886.658] (-3884.962) (-3885.271) (-3886.479) * (-3883.919) (-3888.629) [-3894.850] (-3888.427) -- 0:01:22
      46500 -- [-3890.137] (-3885.843) (-3885.083) (-3886.096) * (-3884.089) (-3885.988) (-3890.854) [-3885.230] -- 0:01:22
      47000 -- (-3888.913) [-3883.861] (-3885.605) (-3887.237) * (-3884.144) (-3888.944) [-3897.173] (-3897.769) -- 0:01:21
      47500 -- (-3892.606) (-3882.490) (-3885.004) [-3885.431] * (-3884.265) (-3889.213) [-3893.643] (-3895.234) -- 0:01:20
      48000 -- (-3890.278) (-3882.485) [-3884.704] (-3885.738) * [-3884.265] (-3884.830) (-3901.450) (-3891.352) -- 0:01:19
      48500 -- [-3890.664] (-3882.061) (-3884.667) (-3884.571) * [-3884.555] (-3889.136) (-3897.481) (-3887.889) -- 0:01:18
      49000 -- (-3893.995) (-3881.830) [-3886.341] (-3884.297) * (-3886.959) (-3887.970) (-3893.177) [-3892.550] -- 0:01:17
      49500 -- (-3894.950) (-3881.783) (-3886.994) [-3883.519] * (-3885.482) (-3882.331) [-3891.633] (-3890.708) -- 0:01:16
      50000 -- (-3896.400) [-3881.828] (-3885.304) (-3884.742) * (-3886.669) [-3882.690] (-3894.157) (-3889.022) -- 0:01:16

      Average standard deviation of split frequencies: 0.030570

      50500 -- (-3893.129) (-3883.889) [-3888.308] (-3885.499) * (-3887.423) (-3882.771) (-3894.543) [-3894.888] -- 0:01:15
      51000 -- (-3901.508) (-3883.170) (-3884.089) [-3884.670] * (-3883.719) (-3883.040) (-3892.975) [-3898.893] -- 0:01:14
      51500 -- (-3895.649) [-3883.474] (-3885.001) (-3888.747) * (-3885.333) (-3888.557) (-3893.463) [-3889.047] -- 0:01:13
      52000 -- [-3888.516] (-3884.205) (-3885.117) (-3885.182) * (-3884.360) [-3887.945] (-3891.766) (-3892.671) -- 0:01:12
      52500 -- (-3887.102) [-3883.947] (-3883.862)