>C1
MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
PRLRALAEELAAGVRQRTFM
>C2
MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
PRLRALAEELAAGVRQRTFM
>C3
MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
PRLRALAEELAAGVRQRTFM
>C4
MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
PRLRALAEELAAGVRQRTFM
>C5
MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
PRLRALAEELAAGVRQRTFM
>C6
MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
PRLRALAEELAAGVRQRTFM
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=270
C1 MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
C2 MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
C3 MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
C4 MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
C5 MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
C6 MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
**************************************************
C1 SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
C2 SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
C3 SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
C4 SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
C5 SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
C6 SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
**************************************************
C1 GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
C2 GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
C3 GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
C4 GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
C5 GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
C6 GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
**************************************************
C1 KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
C2 KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
C3 KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
C4 KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
C5 KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
C6 KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
**************************************************
C1 ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
C2 ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
C3 ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
C4 ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
C5 ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
C6 ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
**************************************************
C1 PRLRALAEELAAGVRQRTFM
C2 PRLRALAEELAAGVRQRTFM
C3 PRLRALAEELAAGVRQRTFM
C4 PRLRALAEELAAGVRQRTFM
C5 PRLRALAEELAAGVRQRTFM
C6 PRLRALAEELAAGVRQRTFM
********************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [8100]--->[8100]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.489 Mb, Max= 30.816 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
C2 MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
C3 MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
C4 MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
C5 MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
C6 MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
**************************************************
C1 SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
C2 SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
C3 SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
C4 SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
C5 SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
C6 SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
**************************************************
C1 GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
C2 GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
C3 GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
C4 GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
C5 GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
C6 GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
**************************************************
C1 KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
C2 KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
C3 KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
C4 KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
C5 KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
C6 KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
**************************************************
C1 ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
C2 ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
C3 ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
C4 ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
C5 ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
C6 ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
**************************************************
C1 PRLRALAEELAAGVRQRTFM
C2 PRLRALAEELAAGVRQRTFM
C3 PRLRALAEELAAGVRQRTFM
C4 PRLRALAEELAAGVRQRTFM
C5 PRLRALAEELAAGVRQRTFM
C6 PRLRALAEELAAGVRQRTFM
********************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGATGGTTCTGGAACAGAGCGAAACAAGTAGGCTTGGGCCGGTTTTCGA
C2 ATGATGGTTCTGGAACAGAGCGAAACAAGTAGGCTTGGGCCGGTTTTCGA
C3 ATGATGGTTCTGGAACAGAGCGAAACAAGTAGGCTTGGGCCGGTTTTCGA
C4 ATGATGGTTCTGGAACAGAGCGAAACAAGTAGGCTTGGGCCGGTTTTCGA
C5 ATGATGGTTCTGGAACAGAGCGAAACAAGTAGGCTTGGGCCGGTTTTCGA
C6 ATGATGGTTCTGGAACAGAGCGAAACAAGTAGGCTTGGGCCGGTTTTCGA
**************************************************
C1 TTCGTGTCGTGCGGACAATCGCGCGGCATTGATTGGTTACTTGCCCACCG
C2 TTCGTGTCGTGCGGACAATCGCGCGGCATTGATTGGTTACTTGCCCACCG
C3 TTCGTGTCGTGCGGACAATCGCGCGGCATTGATTGGTTACTTGCCCACCG
C4 TTCGTGTCGTGCGGACAATCGCGCGGCATTGATTGGTTACTTGCCCACCG
C5 TTCGTGTCGTGCGGACAATCGCGCGGCATTGATTGGTTACTTGCCCACCG
C6 TTCGTGTCGTGCGGACAATCGCGCGGCATTGATTGGTTACTTGCCCACCG
**************************************************
C1 GTTACCCTGATGTGCCTACTTCGGTGGACGCGATGATAGAACTCGTCGAA
C2 GTTACCCTGATGTGCCTACTTCGGTGGACGCGATGATAGAACTCGTCGAA
C3 GTTACCCTGATGTGCCTACTTCGGTGGACGCGATGATAGAACTCGTCGAA
C4 GTTACCCTGATGTGCCTACTTCGGTGGACGCGATGATAGAACTCGTCGAA
C5 GTTACCCTGATGTGCCTACTTCGGTGGACGCGATGATAGAACTCGTCGAA
C6 GTTACCCTGATGTGCCTACTTCGGTGGACGCGATGATAGAACTCGTCGAA
**************************************************
C1 TCCGGCTGTGACATCATTGAAGTTGGCGTTCCTTATTCGGATCCCGGTAT
C2 TCCGGCTGTGACATCATTGAAGTTGGCGTTCCTTATTCGGATCCCGGTAT
C3 TCCGGCTGTGACATCATTGAAGTTGGCGTTCCTTATTCGGATCCCGGTAT
C4 TCCGGCTGTGACATCATTGAAGTTGGCGTTCCTTATTCGGATCCCGGTAT
C5 TCCGGCTGTGACATCATTGAAGTTGGCGTTCCTTATTCGGATCCCGGTAT
C6 TCCGGCTGTGACATCATTGAAGTTGGCGTTCCTTATTCGGATCCCGGTAT
**************************************************
C1 GGACGGTCCAACCATCGCGAGGGCCACCGAGGTTGCGCTTCGTGGAGGAG
C2 GGACGGTCCAACCATCGCGAGGGCCACCGAGGTTGCGCTTCGTGGAGGAG
C3 GGACGGTCCAACCATCGCGAGGGCCACCGAGGTTGCGCTTCGTGGAGGAG
C4 GGACGGTCCAACCATCGCGAGGGCCACCGAGGTTGCGCTTCGTGGAGGAG
C5 GGACGGTCCAACCATCGCGAGGGCCACCGAGGTTGCGCTTCGTGGAGGAG
C6 GGACGGTCCAACCATCGCGAGGGCCACCGAGGTTGCGCTTCGTGGAGGAG
**************************************************
C1 TACGAGTCCGCGATACTCTAGCCGCGGTCGAGGCGATCAGCCAAGCTGGC
C2 TACGAGTCCGCGATACTCTAGCCGCGGTCGAGGCGATCAGCCAAGCTGGC
C3 TACGAGTCCGCGATACTCTAGCCGCGGTCGAGGCGATCAGCCAAGCTGGC
C4 TACGAGTCCGCGATACTCTAGCCGCGGTCGAGGCGATCAGCCAAGCTGGC
C5 TACGAGTCCGCGATACTCTAGCCGCGGTCGAGGCGATCAGCCAAGCTGGC
C6 TACGAGTCCGCGATACTCTAGCCGCGGTCGAGGCGATCAGCCAAGCTGGC
**************************************************
C1 GGACGCGCCGTGGTGATGACGTACTGGAATCCTGTGTTGCGCTATGGGGT
C2 GGACGCGCCGTGGTGATGACGTACTGGAATCCTGTGTTGCGCTATGGGGT
C3 GGACGCGCCGTGGTGATGACGTACTGGAATCCTGTGTTGCGCTATGGGGT
C4 GGACGCGCCGTGGTGATGACGTACTGGAATCCTGTGTTGCGCTATGGGGT
C5 GGACGCGCCGTGGTGATGACGTACTGGAATCCTGTGTTGCGCTATGGGGT
C6 GGACGCGCCGTGGTGATGACGTACTGGAATCCTGTGTTGCGCTATGGGGT
**************************************************
C1 TTGTGCGTTTGCGCGGGATCTGGAGTCAGCTGGAGGACACGGTCTGGTCA
C2 TTGTGCGTTTGCGCGGGATCTGGAGTCAGCTGGAGGACACGGTCTGGTCA
C3 TTGTGCGTTTGCGCGGGATCTGGAGTCAGCTGGAGGACACGGTCTGGTCA
C4 TTGTGCGTTTGCGCGGGATCTGGAGTCAGCTGGAGGACACGGTCTGGTCA
C5 TTGTGCGTTTGCGCGGGATCTGGAGTCAGCTGGAGGACACGGTCTGGTCA
C6 TTGTGCGTTTGCGCGGGATCTGGAGTCAGCTGGAGGACACGGTCTGGTCA
**************************************************
C1 CTCCCGACCTTATTCCCGACGAAGCACGCCAATGGATCGCGGCATCCGAG
C2 CTCCCGACCTTATTCCCGACGAAGCACGCCAATGGATCGCGGCATCCGAG
C3 CTCCCGACCTTATTCCCGACGAAGCACGCCAATGGATCGCGGCATCCGAG
C4 CTCCCGACCTTATTCCCGACGAAGCACGCCAATGGATCGCGGCATCCGAG
C5 CTCCCGACCTTATTCCCGACGAAGCACGCCAATGGATCGCGGCATCCGAG
C6 CTCCCGACCTTATTCCCGACGAAGCACGCCAATGGATCGCGGCATCCGAG
**************************************************
C1 AAGCATCGGTTGGATCGCATTTTTCTAGTGGCTCCATCATCGACGCCGCA
C2 AAGCATCGGTTGGATCGCATTTTTCTAGTGGCTCCATCATCGACGCCGCA
C3 AAGCATCGGTTGGATCGCATTTTTCTAGTGGCTCCATCATCGACGCCGCA
C4 AAGCATCGGTTGGATCGCATTTTTCTAGTGGCTCCATCATCGACGCCGCA
C5 AAGCATCGGTTGGATCGCATTTTTCTAGTGGCTCCATCATCGACGCCGCA
C6 AAGCATCGGTTGGATCGCATTTTTCTAGTGGCTCCATCATCGACGCCGCA
**************************************************
C1 CCGGTTGGTGACCACGGTCGGGGCATCACGTGGATTTGTTTATGCGGTGT
C2 CCGGTTGGTGACCACGGTCGGGGCATCACGTGGATTTGTTTATGCGGTGT
C3 CCGGTTGGTGACCACGGTCGGGGCATCACGTGGATTTGTTTATGCGGTGT
C4 CCGGTTGGTGACCACGGTCGGGGCATCACGTGGATTTGTTTATGCGGTGT
C5 CCGGTTGGTGACCACGGTCGGGGCATCACGTGGATTTGTTTATGCGGTGT
C6 CCGGTTGGTGACCACGGTCGGGGCATCACGTGGATTTGTTTATGCGGTGT
**************************************************
C1 CTGTGATGGGTGTGACCGGGGCGCGTGACGCGGTGTCGCAGGTTGTGCCA
C2 CTGTGATGGGTGTGACCGGGGCGCGTGACGCGGTGTCGCAGGTTGTGCCA
C3 CTGTGATGGGTGTGACCGGGGCGCGTGACGCGGTGTCGCAGGTTGTGCCA
C4 CTGTGATGGGTGTGACCGGGGCGCGTGACGCGGTGTCGCAGGTTGTGCCA
C5 CTGTGATGGGTGTGACCGGGGCGCGTGACGCGGTGTCGCAGGTTGTGCCA
C6 CTGTGATGGGTGTGACCGGGGCGCGTGACGCGGTGTCGCAGGTTGTGCCA
**************************************************
C1 GAACTGGTGGCCAGGGTGAAGGCAGTATCTGACATTGCGGTCGGGGTCGG
C2 GAACTGGTGGCCAGGGTGAAGGCAGTATCTGACATTGCGGTCGGGGTCGG
C3 GAACTGGTGGCCAGGGTGAAGGCAGTATCTGACATTGCGGTCGGGGTCGG
C4 GAACTGGTGGCCAGGGTGAAGGCAGTATCTGACATTGCGGTCGGGGTCGG
C5 GAACTGGTGGCCAGGGTGAAGGCAGTATCTGACATTGCGGTCGGGGTCGG
C6 GAACTGGTGGCCAGGGTGAAGGCAGTATCTGACATTGCGGTCGGGGTCGG
**************************************************
C1 CCTGGGGGTGCGATCACGAGAGCAGGCCGCGCAGATCGGCGGCTACGCCG
C2 CCTGGGGGTGCGATCACGAGAGCAGGCCGCGCAGATCGGCGGCTACGCCG
C3 CCTGGGGGTGCGATCACGAGAGCAGGCCGCGCAGATCGGCGGCTACGCCG
C4 CCTGGGGGTGCGATCACGAGAGCAGGCCGCGCAGATCGGCGGCTACGCCG
C5 CCTGGGGGTGCGATCACGAGAGCAGGCCGCGCAGATCGGCGGCTACGCCG
C6 CCTGGGGGTGCGATCACGAGAGCAGGCCGCGCAGATCGGCGGCTACGCCG
**************************************************
C1 ACGGTGTCATTGTTGGTTCCGCGTTGGTGTCGGCGCTGGGTGACGGTTTG
C2 ACGGTGTCATTGTTGGTTCCGCGTTGGTGTCGGCGCTGGGTGACGGTTTG
C3 ACGGTGTCATTGTTGGTTCCGCGTTGGTGTCGGCGCTGGGTGACGGTTTG
C4 ACGGTGTCATTGTTGGTTCCGCGTTGGTGTCGGCGCTGGGTGACGGTTTG
C5 ACGGTGTCATTGTTGGTTCCGCGTTGGTGTCGGCGCTGGGTGACGGTTTG
C6 ACGGTGTCATTGTTGGTTCCGCGTTGGTGTCGGCGCTGGGTGACGGTTTG
**************************************************
C1 CCTCGATTGCGTGCTCTTGCCGAGGAACTCGCCGCCGGCGTGCGCCAAAG
C2 CCTCGATTGCGTGCTCTTGCCGAGGAACTCGCCGCCGGCGTGCGCCAAAG
C3 CCTCGATTGCGTGCTCTTGCCGAGGAACTCGCCGCCGGCGTGCGCCAAAG
C4 CCTCGATTGCGTGCTCTTGCCGAGGAACTCGCCGCCGGCGTGCGCCAAAG
C5 CCTCGATTGCGTGCTCTTGCCGAGGAACTCGCCGCCGGCGTGCGCCAAAG
C6 CCTCGATTGCGTGCTCTTGCCGAGGAACTCGCCGCCGGCGTGCGCCAAAG
**************************************************
C1 GACGTTCATG
C2 GACGTTCATG
C3 GACGTTCATG
C4 GACGTTCATG
C5 GACGTTCATG
C6 GACGTTCATG
**********
>C1
ATGATGGTTCTGGAACAGAGCGAAACAAGTAGGCTTGGGCCGGTTTTCGA
TTCGTGTCGTGCGGACAATCGCGCGGCATTGATTGGTTACTTGCCCACCG
GTTACCCTGATGTGCCTACTTCGGTGGACGCGATGATAGAACTCGTCGAA
TCCGGCTGTGACATCATTGAAGTTGGCGTTCCTTATTCGGATCCCGGTAT
GGACGGTCCAACCATCGCGAGGGCCACCGAGGTTGCGCTTCGTGGAGGAG
TACGAGTCCGCGATACTCTAGCCGCGGTCGAGGCGATCAGCCAAGCTGGC
GGACGCGCCGTGGTGATGACGTACTGGAATCCTGTGTTGCGCTATGGGGT
TTGTGCGTTTGCGCGGGATCTGGAGTCAGCTGGAGGACACGGTCTGGTCA
CTCCCGACCTTATTCCCGACGAAGCACGCCAATGGATCGCGGCATCCGAG
AAGCATCGGTTGGATCGCATTTTTCTAGTGGCTCCATCATCGACGCCGCA
CCGGTTGGTGACCACGGTCGGGGCATCACGTGGATTTGTTTATGCGGTGT
CTGTGATGGGTGTGACCGGGGCGCGTGACGCGGTGTCGCAGGTTGTGCCA
GAACTGGTGGCCAGGGTGAAGGCAGTATCTGACATTGCGGTCGGGGTCGG
CCTGGGGGTGCGATCACGAGAGCAGGCCGCGCAGATCGGCGGCTACGCCG
ACGGTGTCATTGTTGGTTCCGCGTTGGTGTCGGCGCTGGGTGACGGTTTG
CCTCGATTGCGTGCTCTTGCCGAGGAACTCGCCGCCGGCGTGCGCCAAAG
GACGTTCATG
>C2
ATGATGGTTCTGGAACAGAGCGAAACAAGTAGGCTTGGGCCGGTTTTCGA
TTCGTGTCGTGCGGACAATCGCGCGGCATTGATTGGTTACTTGCCCACCG
GTTACCCTGATGTGCCTACTTCGGTGGACGCGATGATAGAACTCGTCGAA
TCCGGCTGTGACATCATTGAAGTTGGCGTTCCTTATTCGGATCCCGGTAT
GGACGGTCCAACCATCGCGAGGGCCACCGAGGTTGCGCTTCGTGGAGGAG
TACGAGTCCGCGATACTCTAGCCGCGGTCGAGGCGATCAGCCAAGCTGGC
GGACGCGCCGTGGTGATGACGTACTGGAATCCTGTGTTGCGCTATGGGGT
TTGTGCGTTTGCGCGGGATCTGGAGTCAGCTGGAGGACACGGTCTGGTCA
CTCCCGACCTTATTCCCGACGAAGCACGCCAATGGATCGCGGCATCCGAG
AAGCATCGGTTGGATCGCATTTTTCTAGTGGCTCCATCATCGACGCCGCA
CCGGTTGGTGACCACGGTCGGGGCATCACGTGGATTTGTTTATGCGGTGT
CTGTGATGGGTGTGACCGGGGCGCGTGACGCGGTGTCGCAGGTTGTGCCA
GAACTGGTGGCCAGGGTGAAGGCAGTATCTGACATTGCGGTCGGGGTCGG
CCTGGGGGTGCGATCACGAGAGCAGGCCGCGCAGATCGGCGGCTACGCCG
ACGGTGTCATTGTTGGTTCCGCGTTGGTGTCGGCGCTGGGTGACGGTTTG
CCTCGATTGCGTGCTCTTGCCGAGGAACTCGCCGCCGGCGTGCGCCAAAG
GACGTTCATG
>C3
ATGATGGTTCTGGAACAGAGCGAAACAAGTAGGCTTGGGCCGGTTTTCGA
TTCGTGTCGTGCGGACAATCGCGCGGCATTGATTGGTTACTTGCCCACCG
GTTACCCTGATGTGCCTACTTCGGTGGACGCGATGATAGAACTCGTCGAA
TCCGGCTGTGACATCATTGAAGTTGGCGTTCCTTATTCGGATCCCGGTAT
GGACGGTCCAACCATCGCGAGGGCCACCGAGGTTGCGCTTCGTGGAGGAG
TACGAGTCCGCGATACTCTAGCCGCGGTCGAGGCGATCAGCCAAGCTGGC
GGACGCGCCGTGGTGATGACGTACTGGAATCCTGTGTTGCGCTATGGGGT
TTGTGCGTTTGCGCGGGATCTGGAGTCAGCTGGAGGACACGGTCTGGTCA
CTCCCGACCTTATTCCCGACGAAGCACGCCAATGGATCGCGGCATCCGAG
AAGCATCGGTTGGATCGCATTTTTCTAGTGGCTCCATCATCGACGCCGCA
CCGGTTGGTGACCACGGTCGGGGCATCACGTGGATTTGTTTATGCGGTGT
CTGTGATGGGTGTGACCGGGGCGCGTGACGCGGTGTCGCAGGTTGTGCCA
GAACTGGTGGCCAGGGTGAAGGCAGTATCTGACATTGCGGTCGGGGTCGG
CCTGGGGGTGCGATCACGAGAGCAGGCCGCGCAGATCGGCGGCTACGCCG
ACGGTGTCATTGTTGGTTCCGCGTTGGTGTCGGCGCTGGGTGACGGTTTG
CCTCGATTGCGTGCTCTTGCCGAGGAACTCGCCGCCGGCGTGCGCCAAAG
GACGTTCATG
>C4
ATGATGGTTCTGGAACAGAGCGAAACAAGTAGGCTTGGGCCGGTTTTCGA
TTCGTGTCGTGCGGACAATCGCGCGGCATTGATTGGTTACTTGCCCACCG
GTTACCCTGATGTGCCTACTTCGGTGGACGCGATGATAGAACTCGTCGAA
TCCGGCTGTGACATCATTGAAGTTGGCGTTCCTTATTCGGATCCCGGTAT
GGACGGTCCAACCATCGCGAGGGCCACCGAGGTTGCGCTTCGTGGAGGAG
TACGAGTCCGCGATACTCTAGCCGCGGTCGAGGCGATCAGCCAAGCTGGC
GGACGCGCCGTGGTGATGACGTACTGGAATCCTGTGTTGCGCTATGGGGT
TTGTGCGTTTGCGCGGGATCTGGAGTCAGCTGGAGGACACGGTCTGGTCA
CTCCCGACCTTATTCCCGACGAAGCACGCCAATGGATCGCGGCATCCGAG
AAGCATCGGTTGGATCGCATTTTTCTAGTGGCTCCATCATCGACGCCGCA
CCGGTTGGTGACCACGGTCGGGGCATCACGTGGATTTGTTTATGCGGTGT
CTGTGATGGGTGTGACCGGGGCGCGTGACGCGGTGTCGCAGGTTGTGCCA
GAACTGGTGGCCAGGGTGAAGGCAGTATCTGACATTGCGGTCGGGGTCGG
CCTGGGGGTGCGATCACGAGAGCAGGCCGCGCAGATCGGCGGCTACGCCG
ACGGTGTCATTGTTGGTTCCGCGTTGGTGTCGGCGCTGGGTGACGGTTTG
CCTCGATTGCGTGCTCTTGCCGAGGAACTCGCCGCCGGCGTGCGCCAAAG
GACGTTCATG
>C5
ATGATGGTTCTGGAACAGAGCGAAACAAGTAGGCTTGGGCCGGTTTTCGA
TTCGTGTCGTGCGGACAATCGCGCGGCATTGATTGGTTACTTGCCCACCG
GTTACCCTGATGTGCCTACTTCGGTGGACGCGATGATAGAACTCGTCGAA
TCCGGCTGTGACATCATTGAAGTTGGCGTTCCTTATTCGGATCCCGGTAT
GGACGGTCCAACCATCGCGAGGGCCACCGAGGTTGCGCTTCGTGGAGGAG
TACGAGTCCGCGATACTCTAGCCGCGGTCGAGGCGATCAGCCAAGCTGGC
GGACGCGCCGTGGTGATGACGTACTGGAATCCTGTGTTGCGCTATGGGGT
TTGTGCGTTTGCGCGGGATCTGGAGTCAGCTGGAGGACACGGTCTGGTCA
CTCCCGACCTTATTCCCGACGAAGCACGCCAATGGATCGCGGCATCCGAG
AAGCATCGGTTGGATCGCATTTTTCTAGTGGCTCCATCATCGACGCCGCA
CCGGTTGGTGACCACGGTCGGGGCATCACGTGGATTTGTTTATGCGGTGT
CTGTGATGGGTGTGACCGGGGCGCGTGACGCGGTGTCGCAGGTTGTGCCA
GAACTGGTGGCCAGGGTGAAGGCAGTATCTGACATTGCGGTCGGGGTCGG
CCTGGGGGTGCGATCACGAGAGCAGGCCGCGCAGATCGGCGGCTACGCCG
ACGGTGTCATTGTTGGTTCCGCGTTGGTGTCGGCGCTGGGTGACGGTTTG
CCTCGATTGCGTGCTCTTGCCGAGGAACTCGCCGCCGGCGTGCGCCAAAG
GACGTTCATG
>C6
ATGATGGTTCTGGAACAGAGCGAAACAAGTAGGCTTGGGCCGGTTTTCGA
TTCGTGTCGTGCGGACAATCGCGCGGCATTGATTGGTTACTTGCCCACCG
GTTACCCTGATGTGCCTACTTCGGTGGACGCGATGATAGAACTCGTCGAA
TCCGGCTGTGACATCATTGAAGTTGGCGTTCCTTATTCGGATCCCGGTAT
GGACGGTCCAACCATCGCGAGGGCCACCGAGGTTGCGCTTCGTGGAGGAG
TACGAGTCCGCGATACTCTAGCCGCGGTCGAGGCGATCAGCCAAGCTGGC
GGACGCGCCGTGGTGATGACGTACTGGAATCCTGTGTTGCGCTATGGGGT
TTGTGCGTTTGCGCGGGATCTGGAGTCAGCTGGAGGACACGGTCTGGTCA
CTCCCGACCTTATTCCCGACGAAGCACGCCAATGGATCGCGGCATCCGAG
AAGCATCGGTTGGATCGCATTTTTCTAGTGGCTCCATCATCGACGCCGCA
CCGGTTGGTGACCACGGTCGGGGCATCACGTGGATTTGTTTATGCGGTGT
CTGTGATGGGTGTGACCGGGGCGCGTGACGCGGTGTCGCAGGTTGTGCCA
GAACTGGTGGCCAGGGTGAAGGCAGTATCTGACATTGCGGTCGGGGTCGG
CCTGGGGGTGCGATCACGAGAGCAGGCCGCGCAGATCGGCGGCTACGCCG
ACGGTGTCATTGTTGGTTCCGCGTTGGTGTCGGCGCTGGGTGACGGTTTG
CCTCGATTGCGTGCTCTTGCCGAGGAACTCGCCGCCGGCGTGCGCCAAAG
GACGTTCATG
>C1
MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
PRLRALAEELAAGVRQRTFM
>C2
MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
PRLRALAEELAAGVRQRTFM
>C3
MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
PRLRALAEELAAGVRQRTFM
>C4
MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
PRLRALAEELAAGVRQRTFM
>C5
MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
PRLRALAEELAAGVRQRTFM
>C6
MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
PRLRALAEELAAGVRQRTFM
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 810 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579790295
Setting output file names to "/data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1041169347
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0182151338
Seed = 882410644
Swapseed = 1579790295
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1812.818718 -- -24.965149
Chain 2 -- -1812.818549 -- -24.965149
Chain 3 -- -1812.818824 -- -24.965149
Chain 4 -- -1812.818718 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1812.818824 -- -24.965149
Chain 2 -- -1812.818824 -- -24.965149
Chain 3 -- -1812.818824 -- -24.965149
Chain 4 -- -1812.818824 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1812.819] (-1812.819) (-1812.819) (-1812.819) * [-1812.819] (-1812.819) (-1812.819) (-1812.819)
500 -- (-1132.393) (-1110.538) (-1126.267) [-1111.238] * (-1109.056) [-1109.275] (-1119.097) (-1121.153) -- 0:00:00
1000 -- (-1108.507) (-1101.116) (-1117.647) [-1105.236] * [-1105.593] (-1110.157) (-1115.476) (-1106.985) -- 0:00:00
1500 -- [-1107.451] (-1105.573) (-1109.815) (-1110.775) * [-1108.303] (-1101.074) (-1118.159) (-1109.126) -- 0:00:00
2000 -- (-1107.112) (-1114.261) (-1111.349) [-1101.316] * [-1109.190] (-1105.517) (-1104.376) (-1107.431) -- 0:00:00
2500 -- (-1107.759) (-1114.588) (-1103.391) [-1106.036] * (-1115.227) (-1111.693) (-1109.718) [-1106.317] -- 0:00:00
3000 -- (-1109.912) (-1113.400) (-1107.445) [-1102.737] * (-1113.281) (-1102.592) [-1106.397] (-1107.667) -- 0:00:00
3500 -- [-1102.820] (-1110.560) (-1101.657) (-1104.480) * (-1115.885) [-1106.278] (-1101.593) (-1102.116) -- 0:00:00
4000 -- (-1102.049) [-1104.698] (-1107.803) (-1100.289) * [-1103.615] (-1106.151) (-1112.777) (-1110.798) -- 0:00:00
4500 -- (-1109.637) (-1110.362) (-1105.038) [-1103.125] * [-1109.917] (-1113.049) (-1118.729) (-1104.607) -- 0:00:00
5000 -- [-1109.576] (-1102.638) (-1100.382) (-1104.023) * [-1107.573] (-1109.732) (-1099.308) (-1107.552) -- 0:00:00
Average standard deviation of split frequencies: 0.047824
5500 -- (-1104.786) [-1113.253] (-1103.725) (-1108.648) * [-1104.333] (-1109.265) (-1109.554) (-1107.974) -- 0:03:00
6000 -- (-1104.642) (-1110.434) (-1107.336) [-1111.870] * (-1107.251) (-1100.788) [-1110.149] (-1103.563) -- 0:02:45
6500 -- [-1103.319] (-1104.703) (-1110.189) (-1104.477) * (-1100.822) (-1107.773) [-1100.337] (-1107.149) -- 0:02:32
7000 -- (-1110.960) (-1102.334) [-1107.592] (-1101.681) * (-1103.149) [-1105.036] (-1102.573) (-1109.080) -- 0:02:21
7500 -- (-1108.546) [-1103.905] (-1107.632) (-1107.015) * (-1109.311) (-1108.104) (-1104.242) [-1100.832] -- 0:02:12
8000 -- [-1097.482] (-1110.245) (-1107.368) (-1114.625) * (-1105.592) (-1102.008) (-1105.503) [-1104.288] -- 0:02:04
8500 -- (-1095.487) (-1111.402) [-1104.264] (-1110.058) * [-1100.774] (-1101.513) (-1103.077) (-1108.515) -- 0:01:56
9000 -- (-1096.316) (-1102.587) [-1106.092] (-1106.646) * [-1104.564] (-1108.680) (-1112.375) (-1107.410) -- 0:01:50
9500 -- [-1096.418] (-1109.486) (-1103.924) (-1114.192) * (-1102.411) (-1119.325) [-1105.077] (-1102.675) -- 0:01:44
10000 -- (-1095.256) (-1106.861) (-1111.681) [-1103.030] * (-1102.672) (-1108.418) [-1107.900] (-1101.280) -- 0:01:39
Average standard deviation of split frequencies: 0.064082
10500 -- [-1094.896] (-1099.152) (-1120.109) (-1110.555) * (-1103.022) (-1107.148) (-1109.919) [-1105.250] -- 0:01:34
11000 -- (-1096.033) (-1115.601) [-1103.100] (-1113.132) * [-1108.827] (-1109.866) (-1107.941) (-1104.063) -- 0:01:29
11500 -- (-1096.169) (-1103.788) (-1101.366) [-1106.327] * (-1109.562) (-1108.220) (-1104.422) [-1100.486] -- 0:01:25
12000 -- (-1099.892) [-1108.581] (-1107.135) (-1107.397) * (-1103.747) [-1102.874] (-1107.036) (-1102.389) -- 0:01:22
12500 -- [-1097.764] (-1108.213) (-1102.583) (-1115.938) * (-1107.019) (-1107.376) (-1102.280) [-1106.463] -- 0:01:19
13000 -- (-1096.850) (-1104.570) (-1107.418) [-1106.763] * (-1108.965) [-1106.870] (-1113.456) (-1108.757) -- 0:01:15
13500 -- (-1096.277) [-1111.658] (-1110.198) (-1110.043) * (-1120.919) (-1109.461) (-1104.362) [-1104.507] -- 0:01:13
14000 -- (-1095.032) [-1105.638] (-1105.451) (-1102.452) * (-1104.927) [-1106.612] (-1101.430) (-1095.434) -- 0:01:10
14500 -- (-1096.817) (-1103.015) (-1111.239) [-1107.170] * (-1114.815) (-1105.568) (-1097.026) [-1095.423] -- 0:01:07
15000 -- (-1097.394) (-1103.916) [-1095.549] (-1107.109) * [-1103.196] (-1105.548) (-1097.787) (-1095.659) -- 0:01:05
Average standard deviation of split frequencies: 0.070711
15500 -- (-1101.316) (-1106.612) [-1097.524] (-1101.149) * (-1109.574) [-1108.734] (-1098.016) (-1097.373) -- 0:01:03
16000 -- [-1096.879] (-1114.451) (-1100.202) (-1107.220) * (-1106.038) (-1104.642) [-1095.468] (-1097.478) -- 0:01:01
16500 -- (-1102.479) [-1103.339] (-1102.083) (-1110.552) * [-1102.072] (-1111.342) (-1096.225) (-1097.576) -- 0:00:59
17000 -- (-1099.362) (-1103.263) [-1098.756] (-1103.033) * [-1106.203] (-1103.725) (-1094.846) (-1099.762) -- 0:00:57
17500 -- (-1104.026) (-1109.342) (-1098.156) [-1105.524] * (-1104.745) [-1105.498] (-1095.322) (-1098.332) -- 0:00:56
18000 -- (-1100.794) [-1101.091] (-1098.300) (-1106.188) * (-1108.255) [-1104.091] (-1096.268) (-1098.562) -- 0:00:54
18500 -- (-1103.502) (-1116.612) (-1098.220) [-1104.343] * [-1107.156] (-1107.376) (-1099.523) (-1096.902) -- 0:00:53
19000 -- (-1101.579) (-1103.164) [-1101.455] (-1104.180) * [-1107.453] (-1109.212) (-1095.531) (-1097.481) -- 0:01:43
19500 -- (-1101.736) [-1104.903] (-1101.914) (-1113.953) * [-1105.110] (-1109.790) (-1094.505) (-1097.104) -- 0:01:40
20000 -- (-1102.798) (-1102.772) (-1096.927) [-1107.874] * (-1108.219) [-1100.787] (-1094.835) (-1097.710) -- 0:01:38
Average standard deviation of split frequencies: 0.072774
20500 -- (-1100.548) [-1102.532] (-1097.178) (-1104.307) * (-1101.553) [-1104.532] (-1094.539) (-1096.648) -- 0:01:35
21000 -- (-1097.120) (-1106.577) [-1095.446] (-1111.384) * (-1109.603) [-1109.702] (-1094.930) (-1095.128) -- 0:01:33
21500 -- (-1096.253) [-1107.619] (-1096.007) (-1114.379) * [-1106.948] (-1102.411) (-1096.352) (-1095.307) -- 0:01:31
22000 -- (-1099.194) (-1107.496) [-1096.450] (-1111.044) * (-1105.858) (-1105.565) (-1096.890) [-1098.861] -- 0:01:28
22500 -- (-1099.788) [-1111.542] (-1096.042) (-1109.014) * (-1108.867) (-1101.034) [-1097.608] (-1095.872) -- 0:01:26
23000 -- (-1099.413) [-1105.584] (-1095.695) (-1109.691) * [-1104.469] (-1096.860) (-1096.181) (-1098.234) -- 0:01:24
23500 -- [-1097.617] (-1107.836) (-1098.685) (-1109.830) * [-1101.613] (-1099.801) (-1097.047) (-1096.691) -- 0:01:23
24000 -- [-1096.627] (-1095.094) (-1099.848) (-1104.049) * (-1102.500) (-1100.043) (-1095.339) [-1100.915] -- 0:01:21
24500 -- (-1096.322) [-1095.833] (-1096.563) (-1106.041) * [-1109.464] (-1097.080) (-1095.339) (-1097.868) -- 0:01:19
25000 -- (-1096.714) (-1095.933) [-1096.105] (-1103.216) * (-1102.202) (-1097.726) (-1097.936) [-1096.206] -- 0:01:18
Average standard deviation of split frequencies: 0.054393
25500 -- (-1095.285) (-1096.680) [-1096.197] (-1105.085) * (-1108.555) (-1098.533) (-1095.806) [-1094.676] -- 0:01:16
26000 -- (-1096.171) [-1095.074] (-1094.990) (-1111.652) * (-1105.089) (-1097.335) [-1097.339] (-1095.198) -- 0:01:14
26500 -- (-1097.081) [-1095.222] (-1095.677) (-1106.004) * (-1106.888) (-1101.232) (-1095.897) [-1095.615] -- 0:01:13
27000 -- [-1095.808] (-1095.886) (-1095.002) (-1105.715) * (-1102.938) (-1098.740) [-1097.438] (-1094.790) -- 0:01:12
27500 -- (-1094.791) (-1095.340) [-1097.014] (-1105.349) * (-1097.063) [-1100.458] (-1096.288) (-1097.622) -- 0:01:10
28000 -- (-1096.788) (-1094.547) (-1098.453) [-1104.458] * (-1097.384) (-1095.886) [-1098.085] (-1095.759) -- 0:01:09
28500 -- (-1099.176) [-1094.594] (-1099.278) (-1110.168) * (-1098.100) (-1099.089) [-1096.706] (-1096.968) -- 0:01:08
29000 -- (-1097.977) [-1094.582] (-1098.053) (-1109.564) * (-1096.454) (-1096.809) (-1100.320) [-1096.322] -- 0:01:06
29500 -- [-1099.772] (-1095.289) (-1095.966) (-1102.095) * (-1097.636) (-1095.217) (-1098.620) [-1096.434] -- 0:01:05
30000 -- (-1103.201) (-1095.551) [-1098.958] (-1110.156) * (-1096.101) (-1097.031) (-1097.372) [-1096.861] -- 0:01:04
Average standard deviation of split frequencies: 0.039967
30500 -- (-1095.898) (-1096.321) [-1095.243] (-1106.283) * (-1098.120) (-1097.140) (-1095.056) [-1097.906] -- 0:01:03
31000 -- (-1099.628) (-1095.838) (-1096.017) [-1112.093] * [-1096.824] (-1096.600) (-1096.594) (-1096.717) -- 0:01:02
31500 -- (-1104.030) (-1095.320) [-1098.399] (-1108.525) * (-1096.354) [-1095.325] (-1097.554) (-1101.338) -- 0:01:01
32000 -- (-1102.245) [-1098.051] (-1095.398) (-1105.251) * (-1097.137) (-1096.995) [-1095.575] (-1102.547) -- 0:01:00
32500 -- (-1101.661) [-1094.518] (-1097.400) (-1111.367) * [-1097.378] (-1095.999) (-1095.779) (-1095.240) -- 0:00:59
33000 -- (-1097.020) [-1095.655] (-1097.376) (-1112.209) * (-1097.951) [-1095.082] (-1096.958) (-1096.189) -- 0:00:58
33500 -- (-1097.001) (-1095.501) [-1096.009] (-1102.766) * (-1097.675) (-1095.474) [-1098.163] (-1098.155) -- 0:00:57
34000 -- (-1097.023) (-1095.835) (-1098.063) [-1101.306] * (-1097.560) [-1095.899] (-1095.428) (-1096.176) -- 0:00:56
34500 -- [-1096.718] (-1098.891) (-1100.712) (-1103.330) * (-1100.992) [-1095.589] (-1094.783) (-1096.591) -- 0:01:23
35000 -- (-1102.179) (-1097.333) (-1098.672) [-1104.352] * (-1098.393) [-1096.384] (-1097.961) (-1096.024) -- 0:01:22
Average standard deviation of split frequencies: 0.046865
35500 -- [-1098.583] (-1095.811) (-1098.928) (-1109.094) * (-1097.248) (-1096.094) (-1098.397) [-1095.464] -- 0:01:21
36000 -- (-1099.843) (-1096.086) [-1095.860] (-1105.980) * [-1095.151] (-1098.459) (-1096.861) (-1096.174) -- 0:01:20
36500 -- (-1096.132) (-1096.151) [-1095.095] (-1107.293) * (-1096.831) (-1095.704) (-1098.247) [-1095.733] -- 0:01:19
37000 -- (-1094.916) (-1096.120) [-1096.191] (-1104.346) * (-1099.397) (-1096.716) (-1098.642) [-1096.112] -- 0:01:18
37500 -- (-1096.508) (-1098.475) [-1095.889] (-1101.914) * (-1097.907) (-1095.513) (-1095.179) [-1096.953] -- 0:01:17
38000 -- (-1097.388) [-1098.061] (-1096.602) (-1102.083) * [-1096.019] (-1095.571) (-1097.255) (-1095.658) -- 0:01:15
38500 -- (-1098.312) [-1094.880] (-1096.557) (-1109.796) * (-1098.479) (-1095.673) [-1095.643] (-1096.008) -- 0:01:14
39000 -- [-1096.345] (-1096.789) (-1096.899) (-1106.778) * (-1096.844) (-1096.204) (-1098.893) [-1094.902] -- 0:01:13
39500 -- (-1100.209) [-1096.552] (-1095.018) (-1103.415) * (-1095.999) (-1095.447) (-1097.111) [-1095.007] -- 0:01:12
40000 -- (-1096.234) [-1095.481] (-1099.253) (-1102.674) * (-1101.265) (-1097.780) (-1096.709) [-1096.509] -- 0:01:12
Average standard deviation of split frequencies: 0.041487
40500 -- (-1099.618) (-1094.768) (-1096.175) [-1104.411] * (-1100.317) (-1096.450) [-1098.448] (-1096.186) -- 0:01:11
41000 -- (-1097.511) (-1096.483) [-1096.331] (-1108.255) * [-1096.786] (-1098.112) (-1098.433) (-1096.821) -- 0:01:10
41500 -- (-1095.681) (-1100.074) (-1096.602) [-1106.497] * [-1099.850] (-1095.494) (-1097.655) (-1096.078) -- 0:01:09
42000 -- (-1096.673) [-1099.239] (-1095.544) (-1113.338) * (-1097.390) (-1098.134) [-1097.148] (-1096.413) -- 0:01:08
42500 -- (-1096.449) (-1099.397) (-1095.634) [-1106.142] * [-1096.317] (-1096.631) (-1098.888) (-1096.037) -- 0:01:07
43000 -- (-1096.469) (-1095.448) (-1096.153) [-1101.268] * (-1097.155) [-1096.806] (-1101.023) (-1097.182) -- 0:01:06
43500 -- (-1096.234) (-1100.789) [-1097.243] (-1105.281) * (-1096.971) (-1098.107) [-1096.440] (-1096.813) -- 0:01:05
44000 -- (-1098.792) (-1094.528) [-1096.141] (-1107.538) * (-1097.231) (-1098.382) [-1095.691] (-1096.668) -- 0:01:05
44500 -- (-1096.751) (-1095.935) [-1098.439] (-1106.050) * (-1098.289) (-1098.918) [-1098.903] (-1101.072) -- 0:01:04
45000 -- (-1096.642) [-1096.470] (-1095.160) (-1106.227) * (-1095.445) (-1099.864) [-1096.587] (-1098.178) -- 0:01:03
Average standard deviation of split frequencies: 0.029719
45500 -- (-1097.015) (-1097.695) [-1094.520] (-1104.608) * [-1098.515] (-1097.198) (-1094.773) (-1097.562) -- 0:01:02
46000 -- [-1098.827] (-1098.980) (-1099.950) (-1105.105) * [-1098.245] (-1098.106) (-1097.391) (-1096.104) -- 0:01:02
46500 -- (-1100.518) [-1097.478] (-1096.373) (-1113.073) * (-1100.229) (-1096.447) [-1096.637] (-1096.389) -- 0:01:01
47000 -- [-1095.730] (-1098.173) (-1097.122) (-1115.007) * [-1097.231] (-1102.237) (-1095.906) (-1099.865) -- 0:01:00
47500 -- (-1097.009) (-1098.733) [-1099.933] (-1107.576) * (-1098.721) [-1095.319] (-1098.295) (-1097.473) -- 0:01:00
48000 -- (-1095.854) [-1097.099] (-1095.628) (-1111.018) * (-1096.341) [-1095.740] (-1095.661) (-1097.885) -- 0:00:59
48500 -- (-1096.027) (-1096.822) [-1095.813] (-1107.081) * (-1096.158) (-1094.926) [-1098.377] (-1098.558) -- 0:00:58
49000 -- [-1096.824] (-1096.197) (-1096.130) (-1105.069) * (-1098.151) (-1098.168) [-1095.234] (-1103.555) -- 0:00:58
49500 -- [-1095.712] (-1096.727) (-1096.366) (-1113.000) * (-1100.008) (-1097.517) [-1095.695] (-1102.004) -- 0:00:57
50000 -- (-1100.273) (-1095.876) (-1095.015) [-1107.842] * (-1099.510) (-1096.239) [-1095.511] (-1100.031) -- 0:00:57
Average standard deviation of split frequencies: 0.023505
50500 -- (-1095.900) (-1098.292) (-1096.790) [-1101.778] * (-1098.597) (-1098.703) [-1095.230] (-1099.802) -- 0:01:15
51000 -- (-1097.477) (-1097.752) [-1096.279] (-1108.902) * (-1098.495) (-1102.152) [-1096.450] (-1098.600) -- 0:01:14
51500 -- (-1097.812) [-1096.190] (-1096.147) (-1103.069) * (-1099.027) [-1097.734] (-1097.852) (-1097.473) -- 0:01:13
52000 -- (-1102.194) (-1096.193) [-1096.920] (-1116.242) * (-1098.043) (-1097.445) [-1100.104] (-1098.030) -- 0:01:12
52500 -- (-1096.831) (-1096.190) [-1096.923] (-1107.053) * (-1097.294) (-1096.137) (-1098.410) [-1098.192] -- 0:01:12
53000 -- [-1097.837] (-1098.293) (-1097.175) (-1121.053) * (-1096.367) [-1096.481] (-1095.590) (-1099.474) -- 0:01:11
53500 -- [-1097.080] (-1099.841) (-1096.798) (-1105.409) * (-1098.177) [-1098.014] (-1095.902) (-1098.677) -- 0:01:10
54000 -- (-1096.692) (-1094.823) (-1095.727) [-1102.565] * (-1098.128) [-1099.460] (-1096.096) (-1096.152) -- 0:01:10
54500 -- (-1098.653) (-1095.605) (-1098.857) [-1112.442] * (-1097.262) [-1096.944] (-1095.141) (-1095.272) -- 0:01:09
55000 -- (-1098.543) (-1096.294) [-1098.937] (-1108.211) * (-1097.581) (-1097.748) [-1095.737] (-1095.512) -- 0:01:08
Average standard deviation of split frequencies: 0.022915
55500 -- (-1097.650) (-1097.268) (-1096.965) [-1102.995] * (-1094.679) [-1095.942] (-1095.906) (-1096.671) -- 0:01:08
56000 -- [-1097.401] (-1096.733) (-1099.111) (-1100.467) * [-1095.074] (-1095.149) (-1095.016) (-1095.449) -- 0:01:07
56500 -- (-1096.883) (-1095.622) (-1098.170) [-1110.176] * (-1095.089) [-1096.593] (-1094.879) (-1096.112) -- 0:01:06
57000 -- (-1097.154) (-1096.304) (-1096.279) [-1105.937] * (-1096.636) [-1095.601] (-1097.863) (-1094.847) -- 0:01:06
57500 -- (-1095.372) [-1095.358] (-1096.292) (-1104.577) * (-1095.965) (-1097.126) [-1099.641] (-1094.872) -- 0:01:05
58000 -- (-1095.281) [-1098.020] (-1096.611) (-1107.837) * (-1100.842) [-1095.575] (-1096.991) (-1095.124) -- 0:01:04
58500 -- [-1094.806] (-1098.661) (-1098.593) (-1111.103) * (-1097.480) (-1097.138) (-1097.055) [-1095.437] -- 0:01:04
59000 -- (-1095.642) [-1096.219] (-1095.455) (-1096.205) * (-1096.037) (-1096.364) (-1098.423) [-1095.557] -- 0:01:03
59500 -- (-1095.282) (-1095.791) (-1095.852) [-1096.645] * [-1097.226] (-1096.644) (-1101.709) (-1098.332) -- 0:01:03
60000 -- (-1095.341) (-1098.051) [-1096.182] (-1097.797) * (-1100.010) [-1098.240] (-1107.354) (-1094.929) -- 0:01:02
Average standard deviation of split frequencies: 0.018994
60500 -- [-1095.081] (-1098.007) (-1095.766) (-1095.370) * (-1102.533) (-1102.089) (-1096.369) [-1095.476] -- 0:01:02
61000 -- [-1094.818] (-1099.134) (-1098.857) (-1094.815) * [-1098.402] (-1101.024) (-1101.073) (-1099.412) -- 0:01:01
61500 -- (-1095.023) (-1098.175) (-1099.412) [-1098.123] * (-1100.697) (-1096.750) [-1095.691] (-1099.877) -- 0:01:01
62000 -- (-1097.286) (-1097.349) (-1096.694) [-1097.884] * (-1101.749) (-1101.301) (-1095.700) [-1101.798] -- 0:01:00
62500 -- (-1097.011) (-1098.472) (-1095.115) [-1096.296] * (-1103.014) [-1096.897] (-1098.590) (-1096.726) -- 0:01:00
63000 -- (-1098.238) (-1101.225) [-1095.675] (-1096.138) * (-1097.813) (-1100.470) [-1096.122] (-1099.981) -- 0:00:59
63500 -- (-1096.830) (-1099.455) [-1099.800] (-1097.066) * (-1097.657) (-1098.268) (-1095.565) [-1096.899] -- 0:00:58
64000 -- (-1097.876) (-1098.898) (-1096.275) [-1095.921] * (-1095.456) (-1096.260) [-1097.571] (-1096.815) -- 0:00:58
64500 -- (-1095.809) [-1100.128] (-1094.826) (-1098.267) * (-1095.097) (-1096.433) [-1095.265] (-1094.827) -- 0:00:58
65000 -- (-1097.777) (-1097.705) [-1095.609] (-1096.834) * [-1095.612] (-1096.294) (-1096.234) (-1096.342) -- 0:00:57
Average standard deviation of split frequencies: 0.021103
65500 -- (-1097.281) (-1098.932) [-1096.262] (-1095.540) * (-1098.284) [-1098.256] (-1095.111) (-1096.652) -- 0:00:57
66000 -- [-1096.659] (-1097.923) (-1099.740) (-1096.887) * (-1098.019) (-1095.719) [-1094.570] (-1097.895) -- 0:00:56
66500 -- (-1095.143) (-1095.391) (-1102.821) [-1097.383] * (-1098.461) (-1095.778) [-1096.737] (-1099.737) -- 0:00:56
67000 -- [-1094.966] (-1099.624) (-1098.422) (-1095.974) * (-1095.112) (-1095.605) (-1097.721) [-1098.583] -- 0:01:09
67500 -- [-1100.982] (-1095.609) (-1095.461) (-1097.204) * (-1095.059) [-1099.950] (-1097.575) (-1096.203) -- 0:01:09
68000 -- [-1102.310] (-1095.451) (-1098.149) (-1098.133) * (-1098.172) [-1097.967] (-1098.307) (-1096.572) -- 0:01:08
68500 -- (-1097.607) (-1097.104) [-1096.664] (-1095.937) * (-1096.575) [-1094.876] (-1096.345) (-1103.939) -- 0:01:07
69000 -- [-1095.842] (-1097.640) (-1098.922) (-1095.855) * (-1096.123) (-1095.537) (-1097.139) [-1097.032] -- 0:01:07
69500 -- (-1094.772) (-1098.619) [-1097.392] (-1097.693) * (-1097.930) (-1096.666) [-1097.089] (-1100.525) -- 0:01:06
70000 -- (-1095.843) (-1098.646) [-1095.499] (-1099.296) * (-1095.929) (-1096.731) (-1097.964) [-1097.259] -- 0:01:06
Average standard deviation of split frequencies: 0.025016
70500 -- (-1096.544) (-1099.823) (-1095.937) [-1097.715] * (-1100.133) [-1094.683] (-1095.471) (-1096.158) -- 0:01:05
71000 -- (-1095.125) (-1098.348) (-1095.665) [-1099.091] * (-1095.657) [-1095.028] (-1095.515) (-1097.125) -- 0:01:05
71500 -- (-1095.520) (-1096.502) [-1096.686] (-1096.782) * (-1095.861) [-1096.898] (-1094.735) (-1095.875) -- 0:01:04
72000 -- (-1095.241) (-1095.780) [-1096.469] (-1097.299) * (-1096.977) (-1099.946) (-1095.950) [-1096.502] -- 0:01:04
72500 -- (-1095.296) (-1098.738) [-1096.099] (-1096.620) * [-1095.559] (-1100.271) (-1096.655) (-1100.406) -- 0:01:03
73000 -- (-1095.098) [-1094.547] (-1095.967) (-1095.285) * (-1098.426) [-1098.526] (-1094.937) (-1100.760) -- 0:01:03
73500 -- [-1094.922] (-1096.571) (-1095.434) (-1098.079) * [-1095.651] (-1095.680) (-1096.078) (-1096.076) -- 0:01:03
74000 -- (-1096.333) (-1097.482) [-1096.176] (-1097.019) * (-1101.827) (-1096.964) (-1098.062) [-1096.008] -- 0:01:02
74500 -- (-1098.451) (-1098.327) [-1097.762] (-1095.152) * (-1095.776) (-1099.466) (-1098.795) [-1095.443] -- 0:01:02
75000 -- (-1096.473) (-1098.722) (-1096.254) [-1099.706] * (-1095.177) (-1099.150) [-1096.565] (-1099.198) -- 0:01:01
Average standard deviation of split frequencies: 0.021709
75500 -- (-1095.858) (-1097.449) [-1098.555] (-1096.875) * [-1096.536] (-1098.635) (-1095.677) (-1096.489) -- 0:01:01
76000 -- (-1094.898) (-1098.724) (-1094.821) [-1096.754] * (-1095.550) (-1097.363) [-1098.429] (-1095.571) -- 0:01:00
76500 -- (-1095.377) (-1099.546) [-1095.010] (-1096.049) * (-1096.253) (-1097.347) (-1096.221) [-1095.229] -- 0:01:00
77000 -- (-1097.868) (-1098.114) [-1096.348] (-1102.501) * (-1096.558) (-1098.887) (-1098.922) [-1098.936] -- 0:00:59
77500 -- (-1097.622) [-1100.015] (-1095.060) (-1099.103) * (-1098.304) (-1104.110) (-1096.427) [-1101.065] -- 0:00:59
78000 -- (-1095.248) (-1099.271) (-1096.135) [-1099.137] * (-1099.881) [-1100.733] (-1096.152) (-1099.882) -- 0:00:59
78500 -- (-1095.779) [-1098.269] (-1098.705) (-1099.747) * (-1098.959) (-1095.231) [-1097.992] (-1099.668) -- 0:00:58
79000 -- (-1095.244) (-1100.406) (-1095.255) [-1098.843] * (-1100.748) [-1096.733] (-1100.831) (-1097.751) -- 0:00:58
79500 -- (-1095.170) (-1102.339) [-1095.966] (-1098.157) * (-1098.827) [-1097.895] (-1098.259) (-1096.707) -- 0:00:57
80000 -- (-1097.502) (-1098.882) [-1095.493] (-1095.679) * (-1095.779) (-1098.914) [-1096.738] (-1102.204) -- 0:00:57
Average standard deviation of split frequencies: 0.027596
80500 -- [-1097.636] (-1099.481) (-1099.519) (-1096.566) * (-1096.201) (-1099.919) [-1096.052] (-1102.084) -- 0:00:57
81000 -- (-1097.546) (-1097.965) (-1096.395) [-1095.305] * (-1098.100) (-1099.598) [-1097.076] (-1101.425) -- 0:00:56
81500 -- (-1094.976) [-1097.652] (-1101.136) (-1096.434) * (-1101.960) [-1096.747] (-1096.234) (-1094.679) -- 0:00:56
82000 -- (-1094.994) (-1096.946) [-1095.278] (-1096.987) * [-1101.517] (-1095.588) (-1095.892) (-1096.998) -- 0:00:55
82500 -- (-1094.984) [-1097.180] (-1095.644) (-1096.380) * (-1100.269) (-1097.813) [-1096.611] (-1094.861) -- 0:00:55
83000 -- (-1095.232) [-1097.143] (-1095.418) (-1097.442) * (-1101.336) [-1097.844] (-1098.648) (-1095.985) -- 0:00:55
83500 -- (-1095.561) (-1095.021) (-1095.402) [-1097.643] * (-1097.449) (-1099.085) (-1096.843) [-1095.407] -- 0:01:05
84000 -- (-1095.107) (-1098.498) [-1098.761] (-1097.170) * (-1098.272) (-1099.573) [-1094.877] (-1096.530) -- 0:01:05
84500 -- [-1095.243] (-1098.551) (-1095.159) (-1095.918) * (-1095.868) (-1099.259) (-1095.903) [-1096.746] -- 0:01:05
85000 -- (-1094.959) (-1097.061) (-1095.514) [-1098.675] * (-1095.300) (-1099.751) (-1095.731) [-1095.666] -- 0:01:04
Average standard deviation of split frequencies: 0.026830
85500 -- (-1096.204) (-1097.058) [-1095.183] (-1096.840) * (-1096.599) (-1097.109) [-1096.840] (-1095.108) -- 0:01:04
86000 -- (-1096.132) (-1102.924) [-1097.627] (-1095.187) * (-1098.792) [-1096.091] (-1096.079) (-1095.154) -- 0:01:03
86500 -- (-1094.679) (-1102.565) [-1098.406] (-1097.434) * (-1095.500) (-1095.777) (-1096.233) [-1096.092] -- 0:01:03
87000 -- (-1096.239) [-1095.928] (-1097.898) (-1094.981) * [-1095.529] (-1094.680) (-1095.191) (-1095.801) -- 0:01:02
87500 -- (-1096.760) (-1096.858) (-1096.479) [-1096.756] * [-1095.435] (-1096.971) (-1095.750) (-1097.002) -- 0:01:02
88000 -- [-1094.958] (-1098.115) (-1098.471) (-1095.915) * (-1098.172) (-1096.207) (-1097.766) [-1095.463] -- 0:01:02
88500 -- (-1095.601) (-1096.290) (-1095.808) [-1096.615] * [-1098.681] (-1100.731) (-1096.752) (-1094.786) -- 0:01:01
89000 -- (-1098.892) [-1097.414] (-1095.652) (-1095.243) * (-1100.666) (-1100.920) (-1099.258) [-1094.830] -- 0:01:01
89500 -- [-1094.994] (-1098.188) (-1097.548) (-1099.623) * (-1096.120) (-1100.290) (-1095.316) [-1095.891] -- 0:01:01
90000 -- [-1095.972] (-1097.489) (-1098.910) (-1095.128) * [-1095.162] (-1096.113) (-1096.403) (-1095.443) -- 0:01:00
Average standard deviation of split frequencies: 0.025217
90500 -- (-1095.301) [-1098.533] (-1099.863) (-1094.623) * (-1097.767) (-1099.542) [-1098.593] (-1098.307) -- 0:01:00
91000 -- [-1096.408] (-1100.016) (-1097.764) (-1094.703) * (-1098.444) [-1095.596] (-1096.334) (-1097.615) -- 0:00:59
91500 -- (-1098.592) (-1096.623) [-1097.187] (-1095.948) * (-1096.978) [-1095.910] (-1100.237) (-1095.398) -- 0:00:59
92000 -- (-1098.058) (-1097.075) (-1096.855) [-1098.220] * [-1096.688] (-1095.914) (-1104.066) (-1095.447) -- 0:00:59
92500 -- [-1097.881] (-1097.337) (-1097.128) (-1097.365) * [-1095.417] (-1096.854) (-1099.866) (-1098.875) -- 0:00:58
93000 -- (-1096.476) [-1095.119] (-1101.332) (-1097.493) * (-1095.777) (-1094.763) [-1098.167] (-1097.893) -- 0:00:58
93500 -- [-1096.441] (-1095.260) (-1102.302) (-1097.172) * (-1097.379) (-1095.762) [-1096.532] (-1097.879) -- 0:00:58
94000 -- (-1097.364) (-1100.012) [-1096.120] (-1095.815) * (-1100.753) [-1095.306] (-1095.849) (-1102.600) -- 0:00:57
94500 -- (-1101.596) (-1101.776) (-1099.136) [-1096.771] * (-1096.364) [-1095.457] (-1096.290) (-1099.225) -- 0:00:57
95000 -- (-1100.877) (-1098.477) (-1097.003) [-1099.036] * (-1097.095) [-1098.319] (-1098.064) (-1096.694) -- 0:00:57
Average standard deviation of split frequencies: 0.027654
95500 -- (-1101.213) [-1099.450] (-1095.403) (-1096.965) * (-1096.841) (-1096.827) (-1096.530) [-1095.834] -- 0:00:56
96000 -- (-1097.783) [-1096.933] (-1101.179) (-1097.989) * (-1096.049) (-1096.160) (-1099.003) [-1095.191] -- 0:00:56
96500 -- (-1097.894) (-1097.361) (-1097.334) [-1098.148] * (-1096.284) (-1097.253) (-1096.416) [-1094.925] -- 0:00:56
97000 -- (-1096.995) (-1100.477) (-1097.224) [-1098.466] * (-1096.063) [-1098.891] (-1095.478) (-1095.147) -- 0:00:55
97500 -- [-1098.244] (-1096.636) (-1100.486) (-1096.462) * (-1096.769) [-1100.597] (-1096.582) (-1095.685) -- 0:00:55
98000 -- (-1095.293) (-1094.957) (-1107.849) [-1095.287] * (-1097.486) (-1100.842) [-1094.864] (-1095.790) -- 0:00:55
98500 -- (-1096.632) (-1097.949) (-1100.056) [-1095.110] * (-1098.634) (-1099.811) [-1096.050] (-1095.840) -- 0:00:54
99000 -- (-1094.819) [-1095.529] (-1097.522) (-1095.791) * (-1103.382) (-1098.627) [-1095.737] (-1099.567) -- 0:00:54
99500 -- (-1097.005) [-1096.557] (-1095.010) (-1097.105) * (-1095.734) (-1097.706) [-1098.382] (-1096.746) -- 0:00:54
100000 -- [-1096.844] (-1096.093) (-1096.499) (-1095.526) * (-1095.799) (-1097.311) (-1097.579) [-1100.142] -- 0:01:02
Average standard deviation of split frequencies: 0.028343
100500 -- (-1096.122) (-1095.610) [-1099.167] (-1097.696) * (-1097.518) (-1101.163) (-1096.430) [-1095.115] -- 0:01:02
101000 -- (-1099.242) [-1099.993] (-1095.172) (-1096.701) * [-1096.230] (-1098.478) (-1099.175) (-1094.799) -- 0:01:02
101500 -- (-1096.217) [-1095.436] (-1100.963) (-1096.447) * (-1096.030) (-1097.145) (-1098.010) [-1095.147] -- 0:01:01
102000 -- [-1096.474] (-1095.052) (-1100.196) (-1097.361) * (-1096.608) (-1097.805) [-1096.832] (-1097.179) -- 0:01:01
102500 -- [-1096.040] (-1095.188) (-1102.727) (-1096.635) * (-1096.947) (-1096.890) [-1094.884] (-1097.164) -- 0:01:01
103000 -- (-1096.132) (-1095.245) (-1098.264) [-1096.620] * [-1095.575] (-1095.404) (-1095.232) (-1096.863) -- 0:01:00
103500 -- (-1097.802) [-1095.730] (-1098.742) (-1095.468) * (-1095.543) (-1096.344) [-1099.618] (-1099.102) -- 0:01:00
104000 -- (-1097.012) (-1101.336) [-1097.189] (-1097.360) * (-1097.136) (-1097.457) (-1097.704) [-1097.582] -- 0:01:00
104500 -- (-1097.770) [-1101.336] (-1095.394) (-1096.248) * (-1096.224) (-1096.721) (-1095.640) [-1097.108] -- 0:00:59
105000 -- (-1097.653) (-1099.010) [-1095.634] (-1097.805) * [-1098.429] (-1098.945) (-1095.403) (-1094.764) -- 0:00:59
Average standard deviation of split frequencies: 0.027742
105500 -- (-1095.238) (-1100.117) (-1098.187) [-1097.202] * (-1097.657) (-1097.845) [-1094.633] (-1095.380) -- 0:00:59
106000 -- (-1096.013) (-1097.739) (-1097.917) [-1096.127] * (-1101.409) (-1097.482) [-1094.932] (-1095.612) -- 0:00:59
106500 -- (-1098.923) (-1098.424) (-1098.007) [-1096.280] * (-1101.385) (-1094.709) [-1095.452] (-1097.616) -- 0:00:58
107000 -- [-1095.258] (-1098.242) (-1097.165) (-1098.044) * (-1099.254) (-1095.508) (-1096.030) [-1101.457] -- 0:00:58
107500 -- [-1102.782] (-1100.302) (-1096.418) (-1101.784) * (-1097.048) (-1096.391) [-1095.016] (-1102.331) -- 0:00:58
108000 -- (-1096.586) (-1099.727) [-1096.828] (-1100.653) * (-1097.411) (-1099.147) [-1095.301] (-1097.368) -- 0:00:57
108500 -- [-1100.831] (-1100.008) (-1095.037) (-1096.299) * [-1096.669] (-1096.053) (-1095.343) (-1095.160) -- 0:00:57
109000 -- (-1098.050) (-1098.323) (-1095.781) [-1095.111] * (-1095.396) (-1096.389) (-1095.032) [-1094.907] -- 0:00:57
109500 -- (-1095.524) (-1096.669) [-1095.749] (-1096.700) * (-1097.948) [-1095.365] (-1095.303) (-1095.275) -- 0:00:56
110000 -- [-1099.497] (-1096.996) (-1097.326) (-1097.580) * (-1095.027) (-1095.160) [-1096.872] (-1095.164) -- 0:00:56
Average standard deviation of split frequencies: 0.027901
110500 -- [-1101.018] (-1097.773) (-1095.957) (-1097.420) * [-1098.639] (-1096.799) (-1096.444) (-1095.265) -- 0:00:56
111000 -- (-1100.453) (-1100.823) (-1095.424) [-1103.327] * (-1096.396) (-1095.766) [-1096.487] (-1095.114) -- 0:00:56
111500 -- [-1098.629] (-1100.362) (-1096.353) (-1098.432) * [-1095.256] (-1097.173) (-1094.923) (-1095.114) -- 0:00:55
112000 -- [-1096.394] (-1104.368) (-1095.074) (-1096.172) * [-1095.256] (-1095.420) (-1094.609) (-1099.131) -- 0:00:55
112500 -- [-1096.659] (-1103.861) (-1096.783) (-1095.976) * (-1096.388) (-1096.798) [-1095.539] (-1095.635) -- 0:00:55
113000 -- [-1100.064] (-1102.838) (-1097.587) (-1099.930) * (-1098.239) [-1097.448] (-1094.961) (-1097.450) -- 0:00:54
113500 -- [-1099.521] (-1097.595) (-1095.704) (-1097.031) * (-1101.567) (-1101.083) [-1097.506] (-1097.158) -- 0:00:54
114000 -- (-1098.350) [-1100.857] (-1099.093) (-1094.898) * (-1100.245) (-1099.279) [-1095.432] (-1096.792) -- 0:00:54
114500 -- (-1097.081) (-1095.374) [-1096.606] (-1095.974) * (-1101.798) (-1097.589) [-1096.218] (-1097.960) -- 0:00:54
115000 -- [-1098.667] (-1094.928) (-1098.076) (-1095.433) * (-1098.257) [-1097.225] (-1095.187) (-1096.852) -- 0:00:53
Average standard deviation of split frequencies: 0.025805
115500 -- [-1096.119] (-1098.026) (-1099.534) (-1095.352) * (-1095.036) [-1097.198] (-1098.142) (-1098.007) -- 0:00:53
116000 -- [-1095.772] (-1096.431) (-1097.359) (-1094.702) * [-1097.850] (-1100.240) (-1098.139) (-1095.723) -- 0:01:00
116500 -- (-1096.534) (-1095.864) (-1098.944) [-1099.967] * (-1095.960) (-1100.422) [-1097.843] (-1094.814) -- 0:01:00
117000 -- (-1096.177) (-1096.585) [-1095.980] (-1098.483) * (-1096.607) (-1105.052) (-1097.607) [-1094.844] -- 0:01:00
117500 -- (-1095.926) [-1095.749] (-1095.743) (-1096.265) * (-1096.342) (-1096.717) [-1098.896] (-1096.719) -- 0:01:00
118000 -- (-1096.534) (-1096.200) [-1096.424] (-1097.533) * [-1095.928] (-1094.639) (-1098.851) (-1099.313) -- 0:00:59
118500 -- [-1096.932] (-1098.387) (-1100.666) (-1096.034) * [-1094.592] (-1097.075) (-1096.576) (-1101.987) -- 0:00:59
119000 -- (-1098.348) [-1097.185] (-1096.873) (-1095.002) * (-1094.999) (-1095.888) (-1097.857) [-1096.066] -- 0:00:59
119500 -- (-1095.758) (-1097.707) [-1096.600] (-1096.488) * (-1094.981) [-1097.351] (-1099.453) (-1095.843) -- 0:00:58
120000 -- (-1097.710) [-1099.732] (-1098.982) (-1097.707) * (-1095.902) (-1098.293) (-1101.280) [-1094.779] -- 0:00:58
Average standard deviation of split frequencies: 0.026370
120500 -- [-1097.834] (-1095.454) (-1096.676) (-1096.775) * (-1096.752) [-1095.797] (-1097.328) (-1103.600) -- 0:00:58
121000 -- (-1095.318) (-1096.202) (-1098.490) [-1095.422] * (-1096.965) (-1099.198) [-1094.840] (-1095.806) -- 0:00:58
121500 -- (-1096.119) [-1095.433] (-1097.372) (-1098.818) * (-1095.336) [-1097.146] (-1097.007) (-1096.901) -- 0:00:57
122000 -- (-1096.997) (-1096.611) (-1096.629) [-1095.711] * (-1098.090) [-1095.506] (-1102.718) (-1095.987) -- 0:00:57
122500 -- [-1099.059] (-1098.424) (-1095.576) (-1096.635) * [-1094.734] (-1094.836) (-1096.923) (-1097.167) -- 0:00:57
123000 -- (-1101.879) (-1099.725) [-1096.578] (-1095.966) * (-1094.636) (-1096.226) [-1098.575] (-1097.671) -- 0:00:57
123500 -- (-1097.532) [-1098.170] (-1095.421) (-1095.712) * (-1094.905) (-1097.821) [-1098.260] (-1094.877) -- 0:00:56
124000 -- (-1097.070) (-1096.844) [-1096.577] (-1098.200) * [-1096.454] (-1102.979) (-1099.976) (-1094.784) -- 0:00:56
124500 -- (-1098.555) [-1097.930] (-1098.125) (-1095.070) * (-1098.670) (-1097.379) (-1097.145) [-1096.070] -- 0:00:56
125000 -- (-1096.318) (-1095.293) (-1098.248) [-1096.017] * [-1098.335] (-1097.641) (-1095.597) (-1097.016) -- 0:00:56
Average standard deviation of split frequencies: 0.028995
125500 -- (-1097.066) (-1094.963) [-1096.084] (-1097.447) * (-1098.386) (-1095.294) [-1095.780] (-1095.280) -- 0:00:55
126000 -- (-1097.766) (-1095.306) [-1097.618] (-1095.726) * (-1096.534) [-1096.166] (-1096.632) (-1099.888) -- 0:00:55
126500 -- [-1098.748] (-1096.306) (-1098.726) (-1095.654) * (-1095.441) (-1095.854) [-1096.271] (-1098.401) -- 0:00:55
127000 -- (-1098.408) (-1096.826) (-1098.208) [-1096.574] * (-1095.318) [-1095.167] (-1096.787) (-1097.578) -- 0:00:54
127500 -- (-1098.419) (-1100.921) [-1101.915] (-1099.352) * (-1094.635) (-1096.257) [-1099.654] (-1096.633) -- 0:00:54
128000 -- (-1095.967) (-1095.622) (-1099.309) [-1097.218] * (-1096.336) [-1094.916] (-1096.551) (-1095.954) -- 0:00:54
128500 -- (-1094.726) (-1095.810) (-1095.296) [-1097.122] * (-1096.495) (-1099.527) (-1096.888) [-1095.128] -- 0:00:54
129000 -- [-1094.716] (-1097.817) (-1095.619) (-1097.009) * (-1094.741) (-1097.551) (-1097.140) [-1094.931] -- 0:00:54
129500 -- (-1097.631) (-1097.528) [-1095.134] (-1096.108) * (-1097.627) (-1096.540) (-1096.158) [-1094.928] -- 0:00:53
130000 -- (-1100.279) (-1095.705) [-1096.685] (-1097.226) * (-1096.448) [-1096.645] (-1098.605) (-1095.528) -- 0:00:53
Average standard deviation of split frequencies: 0.027779
130500 -- (-1098.037) (-1096.348) (-1096.856) [-1096.385] * (-1099.892) [-1095.979] (-1097.069) (-1096.139) -- 0:00:53
131000 -- (-1096.748) [-1095.739] (-1095.725) (-1095.496) * (-1096.369) [-1095.975] (-1102.157) (-1097.440) -- 0:00:53
131500 -- (-1096.263) [-1097.181] (-1101.054) (-1096.600) * (-1097.784) [-1096.428] (-1096.987) (-1098.628) -- 0:00:52
132000 -- (-1096.263) (-1100.025) [-1096.400] (-1094.786) * [-1095.830] (-1096.154) (-1100.002) (-1097.199) -- 0:00:59
132500 -- (-1097.696) (-1096.995) [-1098.684] (-1094.494) * (-1096.564) (-1095.802) (-1095.585) [-1098.294] -- 0:00:58
133000 -- [-1095.984] (-1096.270) (-1095.630) (-1096.791) * (-1095.555) (-1095.959) [-1094.881] (-1096.538) -- 0:00:58
133500 -- (-1094.814) (-1099.265) (-1095.707) [-1095.787] * (-1095.669) (-1098.428) (-1097.576) [-1096.095] -- 0:00:58
134000 -- (-1098.238) [-1096.293] (-1095.035) (-1097.098) * (-1096.472) [-1094.909] (-1094.795) (-1095.526) -- 0:00:58
134500 -- (-1098.386) (-1096.025) (-1096.695) [-1097.519] * (-1095.746) [-1097.057] (-1098.557) (-1097.655) -- 0:00:57
135000 -- (-1102.873) (-1096.910) [-1095.807] (-1096.740) * [-1096.457] (-1097.334) (-1095.617) (-1100.519) -- 0:00:57
Average standard deviation of split frequencies: 0.024456
135500 -- (-1095.549) (-1096.200) [-1101.203] (-1095.922) * (-1094.710) (-1098.667) (-1095.056) [-1095.483] -- 0:00:57
136000 -- (-1096.131) (-1096.104) [-1097.988] (-1095.827) * (-1095.186) [-1095.560] (-1095.605) (-1097.170) -- 0:00:57
136500 -- (-1095.402) [-1095.903] (-1095.830) (-1096.563) * (-1095.275) (-1094.889) (-1095.475) [-1095.658] -- 0:00:56
137000 -- (-1095.366) (-1095.147) [-1097.771] (-1096.583) * (-1098.970) (-1096.808) [-1096.789] (-1097.444) -- 0:00:56
137500 -- (-1095.331) (-1095.238) [-1098.856] (-1095.214) * (-1099.086) [-1095.148] (-1100.145) (-1097.385) -- 0:00:56
138000 -- (-1100.194) [-1095.614] (-1099.263) (-1094.830) * [-1100.413] (-1101.063) (-1097.518) (-1097.801) -- 0:00:56
138500 -- (-1097.425) [-1094.708] (-1098.822) (-1097.983) * [-1102.721] (-1100.212) (-1097.399) (-1096.613) -- 0:00:55
139000 -- (-1096.236) (-1097.456) [-1096.585] (-1098.916) * (-1096.615) (-1101.745) (-1097.249) [-1096.044] -- 0:00:55
139500 -- (-1096.203) [-1096.267] (-1097.956) (-1097.679) * [-1098.174] (-1097.600) (-1100.325) (-1095.613) -- 0:00:55
140000 -- [-1096.082] (-1097.667) (-1098.008) (-1097.086) * [-1100.610] (-1095.851) (-1099.913) (-1097.914) -- 0:00:55
Average standard deviation of split frequencies: 0.021597
140500 -- (-1096.780) (-1098.444) (-1096.507) [-1096.250] * (-1095.957) [-1095.699] (-1098.772) (-1097.720) -- 0:00:55
141000 -- (-1095.924) (-1099.394) (-1096.866) [-1096.741] * (-1096.406) [-1096.468] (-1098.787) (-1094.897) -- 0:00:54
141500 -- (-1095.771) (-1095.996) (-1094.857) [-1097.697] * (-1101.472) [-1096.834] (-1099.374) (-1095.396) -- 0:00:54
142000 -- [-1096.176] (-1095.355) (-1095.095) (-1096.718) * (-1098.453) [-1096.634] (-1099.782) (-1096.274) -- 0:00:54
142500 -- [-1096.415] (-1097.617) (-1095.102) (-1096.997) * (-1096.843) (-1098.527) [-1099.095] (-1100.291) -- 0:00:54
143000 -- (-1097.572) (-1099.465) [-1096.414] (-1095.933) * [-1098.334] (-1096.239) (-1095.303) (-1096.479) -- 0:00:53
143500 -- (-1100.408) (-1098.876) [-1096.924] (-1095.837) * (-1099.453) [-1094.992] (-1096.638) (-1094.574) -- 0:00:53
144000 -- (-1097.833) [-1096.503] (-1097.860) (-1106.937) * [-1101.764] (-1095.253) (-1096.580) (-1094.804) -- 0:00:53
144500 -- (-1102.283) (-1095.198) [-1099.195] (-1098.255) * (-1096.610) (-1094.752) (-1099.796) [-1095.668] -- 0:00:53
145000 -- [-1097.918] (-1095.616) (-1099.587) (-1100.086) * (-1098.964) [-1095.972] (-1095.586) (-1097.795) -- 0:00:53
Average standard deviation of split frequencies: 0.021149
145500 -- (-1100.291) (-1097.729) (-1099.154) [-1101.094] * [-1095.334] (-1095.645) (-1095.758) (-1097.822) -- 0:00:52
146000 -- (-1097.167) [-1095.891] (-1096.671) (-1099.080) * (-1097.426) (-1097.221) [-1096.303] (-1098.284) -- 0:00:52
146500 -- [-1100.349] (-1098.174) (-1096.923) (-1099.256) * (-1096.020) [-1095.801] (-1096.187) (-1097.500) -- 0:00:52
147000 -- (-1100.835) (-1097.487) [-1097.302] (-1095.468) * [-1098.786] (-1095.634) (-1095.604) (-1097.729) -- 0:00:52
147500 -- (-1096.441) [-1095.517] (-1098.499) (-1094.745) * (-1100.899) (-1095.502) [-1095.235] (-1095.117) -- 0:00:52
148000 -- (-1097.902) [-1094.861] (-1099.828) (-1095.339) * (-1101.725) (-1097.012) [-1097.396] (-1096.266) -- 0:00:51
148500 -- [-1095.690] (-1104.328) (-1099.127) (-1099.593) * [-1097.194] (-1098.572) (-1100.733) (-1095.736) -- 0:00:57
149000 -- [-1095.745] (-1097.808) (-1099.614) (-1095.801) * [-1096.724] (-1099.070) (-1098.826) (-1095.124) -- 0:00:57
149500 -- (-1097.164) (-1094.748) [-1096.300] (-1095.469) * [-1094.674] (-1097.365) (-1098.364) (-1094.867) -- 0:00:56
150000 -- [-1097.770] (-1099.080) (-1096.163) (-1098.618) * (-1095.972) [-1095.855] (-1096.616) (-1098.418) -- 0:00:56
Average standard deviation of split frequencies: 0.021589
150500 -- (-1096.647) (-1099.080) (-1094.830) [-1096.606] * [-1097.609] (-1096.630) (-1095.918) (-1098.534) -- 0:00:56
151000 -- (-1097.082) (-1101.268) [-1095.105] (-1096.215) * [-1096.281] (-1098.001) (-1095.649) (-1097.163) -- 0:00:56
151500 -- (-1100.688) (-1099.753) [-1095.247] (-1096.108) * (-1098.324) [-1095.024] (-1097.300) (-1099.990) -- 0:00:56
152000 -- [-1100.162] (-1096.849) (-1096.104) (-1099.994) * (-1095.802) [-1099.141] (-1098.900) (-1095.297) -- 0:00:55
152500 -- (-1097.175) [-1097.751] (-1095.276) (-1100.566) * (-1098.326) (-1096.188) (-1097.635) [-1095.376] -- 0:00:55
153000 -- (-1096.608) (-1099.858) [-1095.810] (-1100.187) * (-1094.845) (-1097.795) [-1096.055] (-1096.291) -- 0:00:55
153500 -- (-1097.744) [-1098.604] (-1095.695) (-1100.325) * [-1096.425] (-1096.924) (-1097.881) (-1095.954) -- 0:00:55
154000 -- (-1098.137) [-1098.544] (-1094.953) (-1097.219) * [-1098.136] (-1095.751) (-1101.891) (-1095.877) -- 0:00:54
154500 -- (-1095.640) (-1096.414) (-1096.039) [-1097.901] * (-1096.379) (-1099.491) (-1098.709) [-1095.762] -- 0:00:54
155000 -- (-1095.741) [-1096.098] (-1096.923) (-1097.306) * (-1098.522) [-1095.613] (-1098.178) (-1098.981) -- 0:00:54
Average standard deviation of split frequencies: 0.023379
155500 -- [-1094.633] (-1096.009) (-1097.470) (-1095.294) * [-1099.867] (-1095.887) (-1097.886) (-1096.973) -- 0:00:54
156000 -- (-1096.640) (-1097.836) (-1097.514) [-1096.315] * (-1096.825) (-1098.466) (-1100.945) [-1097.252] -- 0:00:54
156500 -- [-1095.252] (-1097.719) (-1098.282) (-1097.024) * (-1096.559) (-1098.557) (-1096.643) [-1098.145] -- 0:00:53
157000 -- (-1098.516) [-1098.729] (-1097.503) (-1101.141) * (-1097.871) (-1096.930) (-1096.650) [-1098.862] -- 0:00:53
157500 -- [-1096.885] (-1097.604) (-1098.935) (-1097.180) * (-1097.946) (-1096.355) (-1097.367) [-1097.750] -- 0:00:53
158000 -- [-1096.881] (-1096.358) (-1095.298) (-1097.286) * (-1098.017) (-1095.634) (-1098.067) [-1098.277] -- 0:00:53
158500 -- (-1097.170) [-1096.174] (-1098.177) (-1097.379) * (-1099.164) [-1095.696] (-1097.021) (-1097.723) -- 0:00:53
159000 -- [-1098.581] (-1096.592) (-1096.251) (-1097.687) * (-1102.664) (-1095.115) (-1097.862) [-1097.384] -- 0:00:52
159500 -- (-1099.948) [-1098.278] (-1099.329) (-1099.713) * (-1098.860) [-1098.837] (-1095.412) (-1100.418) -- 0:00:52
160000 -- (-1097.947) (-1097.076) (-1097.792) [-1098.079] * (-1098.350) [-1096.842] (-1100.761) (-1098.582) -- 0:00:52
Average standard deviation of split frequencies: 0.024708
160500 -- (-1095.431) [-1095.528] (-1097.836) (-1099.926) * (-1096.119) [-1096.362] (-1098.675) (-1095.525) -- 0:00:52
161000 -- (-1096.049) (-1097.438) (-1096.598) [-1098.611] * (-1096.246) (-1096.489) [-1099.382] (-1095.223) -- 0:00:52
161500 -- (-1095.297) [-1097.714] (-1097.596) (-1097.873) * (-1096.599) (-1096.911) (-1097.966) [-1095.381] -- 0:00:51
162000 -- [-1095.111] (-1098.735) (-1095.469) (-1097.702) * [-1100.306] (-1098.329) (-1096.142) (-1095.368) -- 0:00:51
162500 -- (-1094.847) (-1095.254) (-1099.260) [-1096.374] * [-1097.854] (-1094.910) (-1097.151) (-1096.432) -- 0:00:51
163000 -- (-1095.194) [-1094.956] (-1099.631) (-1106.252) * (-1098.265) (-1095.194) [-1095.605] (-1096.501) -- 0:00:56
163500 -- (-1097.301) (-1096.038) [-1095.487] (-1098.450) * (-1100.318) [-1094.915] (-1095.497) (-1095.229) -- 0:00:56
164000 -- (-1100.240) [-1098.241] (-1095.973) (-1098.514) * (-1099.134) (-1095.431) (-1095.237) [-1099.418] -- 0:00:56
164500 -- (-1097.307) [-1097.217] (-1096.161) (-1097.737) * (-1097.097) (-1096.520) [-1096.505] (-1098.786) -- 0:00:55
165000 -- (-1097.189) (-1095.426) (-1096.191) [-1098.687] * (-1096.405) (-1095.547) (-1096.755) [-1095.633] -- 0:00:55
Average standard deviation of split frequencies: 0.022860
165500 -- (-1096.412) [-1095.056] (-1096.652) (-1098.860) * (-1097.025) (-1094.778) (-1101.817) [-1097.397] -- 0:00:55
166000 -- [-1095.222] (-1096.605) (-1098.857) (-1097.086) * (-1096.320) (-1095.338) (-1097.331) [-1096.518] -- 0:00:55
166500 -- [-1094.842] (-1094.890) (-1099.737) (-1095.478) * (-1097.546) (-1095.401) (-1096.690) [-1095.971] -- 0:00:55
167000 -- (-1095.068) (-1096.050) [-1098.263] (-1095.818) * (-1095.465) (-1099.963) [-1095.484] (-1095.317) -- 0:00:54
167500 -- (-1095.555) [-1094.858] (-1099.111) (-1097.812) * (-1098.706) (-1098.117) [-1096.057] (-1097.142) -- 0:00:54
168000 -- (-1096.148) (-1095.515) [-1095.763] (-1099.801) * [-1099.155] (-1100.471) (-1097.144) (-1099.015) -- 0:00:54
168500 -- [-1096.551] (-1095.070) (-1097.348) (-1099.288) * (-1096.164) (-1097.395) (-1097.211) [-1096.636] -- 0:00:54
169000 -- [-1101.991] (-1098.927) (-1099.083) (-1095.988) * (-1096.245) (-1100.013) [-1096.042] (-1096.372) -- 0:00:54
169500 -- (-1099.887) (-1097.615) (-1098.147) [-1096.825] * [-1095.610] (-1096.537) (-1099.676) (-1096.659) -- 0:00:53
170000 -- (-1096.955) [-1096.025] (-1094.924) (-1096.088) * (-1096.029) (-1097.195) [-1095.286] (-1096.664) -- 0:00:53
Average standard deviation of split frequencies: 0.025550
170500 -- (-1096.767) (-1096.194) (-1097.445) [-1094.942] * (-1098.909) (-1104.614) (-1098.778) [-1101.295] -- 0:00:53
171000 -- (-1094.809) [-1096.406] (-1097.951) (-1094.878) * [-1098.005] (-1098.541) (-1101.160) (-1096.735) -- 0:00:53
171500 -- (-1096.363) (-1096.695) (-1096.327) [-1096.142] * (-1098.828) (-1095.776) [-1098.566] (-1095.069) -- 0:00:53
172000 -- (-1097.376) (-1097.263) (-1097.888) [-1097.917] * (-1097.048) (-1099.545) [-1098.419] (-1094.997) -- 0:00:52
172500 -- [-1098.008] (-1098.740) (-1099.394) (-1096.598) * (-1095.556) (-1099.392) [-1098.172] (-1097.467) -- 0:00:52
173000 -- (-1098.584) (-1099.370) (-1095.946) [-1096.848] * (-1098.886) [-1096.656] (-1095.933) (-1094.857) -- 0:00:52
173500 -- (-1099.274) [-1096.376] (-1097.753) (-1096.868) * [-1095.570] (-1096.588) (-1095.738) (-1095.894) -- 0:00:52
174000 -- (-1099.467) (-1094.518) [-1095.228] (-1096.319) * (-1096.888) (-1095.134) [-1096.118] (-1096.045) -- 0:00:52
174500 -- (-1098.749) (-1095.811) (-1096.085) [-1095.080] * (-1095.595) (-1095.573) [-1095.990] (-1098.312) -- 0:00:52
175000 -- (-1097.722) [-1095.610] (-1097.936) (-1096.284) * (-1098.656) [-1096.340] (-1097.449) (-1096.767) -- 0:00:51
Average standard deviation of split frequencies: 0.024529
175500 -- [-1096.707] (-1097.337) (-1103.455) (-1094.991) * (-1095.265) [-1095.100] (-1095.683) (-1096.459) -- 0:00:51
176000 -- (-1098.010) (-1096.849) [-1095.655] (-1099.171) * (-1097.002) [-1094.460] (-1095.569) (-1095.885) -- 0:00:51
176500 -- (-1098.323) (-1097.927) (-1095.191) [-1097.452] * [-1098.045] (-1098.462) (-1095.090) (-1096.510) -- 0:00:51
177000 -- (-1096.780) (-1102.349) [-1095.300] (-1102.173) * (-1098.074) [-1097.715] (-1097.030) (-1095.184) -- 0:00:51
177500 -- (-1097.586) (-1097.250) [-1096.296] (-1099.596) * [-1096.020] (-1095.372) (-1095.525) (-1099.365) -- 0:00:50
178000 -- (-1097.173) (-1094.829) [-1096.832] (-1104.590) * (-1097.077) (-1095.217) (-1095.217) [-1096.814] -- 0:00:55
178500 -- [-1096.528] (-1095.797) (-1096.913) (-1100.676) * (-1098.427) (-1095.686) (-1095.731) [-1096.059] -- 0:00:55
179000 -- [-1096.143] (-1099.624) (-1095.838) (-1096.040) * (-1094.886) (-1100.092) [-1096.135] (-1095.478) -- 0:00:55
179500 -- (-1096.283) [-1097.697] (-1095.522) (-1095.607) * (-1094.793) (-1096.367) [-1098.019] (-1096.782) -- 0:00:54
180000 -- (-1097.362) [-1099.448] (-1097.602) (-1096.247) * (-1094.658) (-1096.340) [-1095.584] (-1098.305) -- 0:00:54
Average standard deviation of split frequencies: 0.023483
180500 -- (-1099.177) (-1099.010) [-1097.165] (-1094.965) * (-1095.289) [-1095.698] (-1096.189) (-1097.076) -- 0:00:54
181000 -- [-1097.289] (-1099.525) (-1095.522) (-1095.720) * (-1096.908) (-1096.869) [-1094.867] (-1097.172) -- 0:00:54
181500 -- (-1097.379) [-1095.266] (-1098.711) (-1097.127) * (-1095.282) (-1097.125) [-1096.724] (-1097.269) -- 0:00:54
182000 -- [-1098.475] (-1095.681) (-1096.450) (-1100.420) * (-1100.858) (-1098.663) [-1094.499] (-1097.034) -- 0:00:53
182500 -- (-1099.032) [-1095.057] (-1097.458) (-1095.279) * (-1096.960) [-1096.011] (-1096.511) (-1095.814) -- 0:00:53
183000 -- (-1096.754) [-1096.910] (-1097.280) (-1096.469) * [-1096.020] (-1101.180) (-1096.987) (-1095.736) -- 0:00:53
183500 -- (-1095.451) (-1101.172) [-1096.968] (-1097.195) * (-1100.921) [-1097.565] (-1096.191) (-1095.173) -- 0:00:53
184000 -- [-1095.275] (-1097.161) (-1099.991) (-1097.438) * (-1101.055) [-1095.034] (-1098.295) (-1094.928) -- 0:00:53
184500 -- [-1098.200] (-1097.489) (-1095.670) (-1098.529) * (-1099.258) [-1095.688] (-1094.622) (-1095.454) -- 0:00:53
185000 -- [-1096.339] (-1096.479) (-1097.259) (-1101.426) * (-1096.858) (-1099.793) (-1097.845) [-1097.313] -- 0:00:52
Average standard deviation of split frequencies: 0.021289
185500 -- [-1096.025] (-1100.401) (-1096.340) (-1095.978) * (-1100.273) [-1098.002] (-1096.821) (-1099.428) -- 0:00:52
186000 -- [-1096.056] (-1097.797) (-1098.734) (-1094.803) * (-1095.800) (-1096.625) [-1097.605] (-1097.223) -- 0:00:52
186500 -- [-1095.008] (-1095.963) (-1097.905) (-1096.260) * (-1094.439) (-1101.222) (-1097.310) [-1096.563] -- 0:00:52
187000 -- (-1096.386) [-1096.485] (-1095.875) (-1095.524) * (-1094.573) [-1097.517] (-1098.429) (-1095.600) -- 0:00:52
187500 -- (-1096.094) [-1098.260] (-1096.668) (-1095.490) * (-1095.210) (-1097.170) [-1096.888] (-1103.357) -- 0:00:52
188000 -- [-1096.890] (-1096.104) (-1095.910) (-1095.492) * (-1096.849) (-1098.005) [-1096.889] (-1098.369) -- 0:00:51
188500 -- (-1095.854) [-1097.722] (-1095.763) (-1097.391) * (-1097.087) (-1101.245) (-1098.237) [-1097.834] -- 0:00:51
189000 -- [-1095.942] (-1098.062) (-1096.955) (-1097.640) * (-1096.852) (-1098.346) (-1098.430) [-1097.217] -- 0:00:51
189500 -- [-1095.858] (-1099.242) (-1095.449) (-1096.713) * (-1096.096) [-1097.573] (-1098.362) (-1097.418) -- 0:00:51
190000 -- (-1096.344) (-1097.241) (-1095.404) [-1096.265] * [-1097.639] (-1097.123) (-1099.631) (-1100.084) -- 0:00:51
Average standard deviation of split frequencies: 0.021139
190500 -- (-1097.839) [-1095.629] (-1095.835) (-1096.918) * (-1097.637) (-1095.581) (-1097.127) [-1100.001] -- 0:00:50
191000 -- [-1096.532] (-1097.958) (-1094.933) (-1097.539) * (-1097.455) (-1094.846) [-1094.818] (-1096.947) -- 0:00:50
191500 -- (-1095.514) (-1097.066) (-1095.131) [-1097.282] * (-1095.089) [-1096.590] (-1094.636) (-1099.650) -- 0:00:50
192000 -- (-1097.182) (-1095.496) (-1096.837) [-1096.773] * [-1095.916] (-1095.252) (-1096.364) (-1099.853) -- 0:00:50
192500 -- [-1095.929] (-1098.614) (-1095.425) (-1098.402) * (-1094.801) (-1097.713) [-1096.401] (-1103.660) -- 0:00:50
193000 -- (-1095.803) (-1097.264) [-1097.248] (-1100.483) * [-1094.809] (-1095.520) (-1096.543) (-1098.666) -- 0:00:54
193500 -- (-1096.487) (-1097.913) (-1095.296) [-1097.797] * (-1095.560) [-1097.256] (-1097.323) (-1098.399) -- 0:00:54
194000 -- (-1097.209) [-1094.885] (-1096.407) (-1097.331) * (-1098.852) [-1099.161] (-1094.980) (-1101.346) -- 0:00:54
194500 -- (-1098.370) (-1097.792) [-1097.715] (-1097.332) * (-1101.417) [-1097.028] (-1096.207) (-1099.895) -- 0:00:53
195000 -- (-1103.373) (-1094.904) [-1097.617] (-1096.098) * (-1096.317) (-1095.483) (-1096.888) [-1099.893] -- 0:00:53
Average standard deviation of split frequencies: 0.021646
195500 -- (-1103.172) (-1095.505) (-1100.800) [-1098.282] * (-1104.865) [-1096.744] (-1096.309) (-1098.892) -- 0:00:53
196000 -- [-1100.604] (-1097.350) (-1097.838) (-1103.161) * (-1099.117) [-1095.446] (-1096.125) (-1097.962) -- 0:00:53
196500 -- (-1102.821) [-1101.882] (-1098.160) (-1096.671) * [-1095.677] (-1095.591) (-1099.419) (-1098.596) -- 0:00:53
197000 -- [-1096.802] (-1098.750) (-1099.176) (-1096.312) * (-1096.089) [-1096.710] (-1096.611) (-1097.921) -- 0:00:52
197500 -- [-1097.047] (-1097.076) (-1099.178) (-1096.127) * [-1098.586] (-1097.236) (-1102.112) (-1095.396) -- 0:00:52
198000 -- (-1099.607) (-1097.403) [-1098.234] (-1099.075) * (-1100.424) [-1099.042] (-1100.526) (-1095.770) -- 0:00:52
198500 -- (-1095.104) [-1098.773] (-1100.808) (-1095.211) * (-1096.531) [-1095.582] (-1098.462) (-1095.930) -- 0:00:52
199000 -- [-1095.237] (-1096.601) (-1097.955) (-1095.525) * (-1096.779) (-1094.871) (-1096.887) [-1095.828] -- 0:00:52
199500 -- (-1095.423) [-1096.099] (-1102.579) (-1096.904) * (-1095.993) [-1096.025] (-1098.110) (-1096.201) -- 0:00:52
200000 -- (-1099.452) [-1096.793] (-1096.507) (-1096.511) * (-1098.114) (-1096.488) (-1097.195) [-1095.989] -- 0:00:51
Average standard deviation of split frequencies: 0.020621
200500 -- (-1099.146) (-1099.195) [-1098.047] (-1098.439) * (-1097.208) (-1096.221) (-1097.125) [-1094.926] -- 0:00:51
201000 -- (-1098.644) [-1098.282] (-1098.094) (-1096.546) * (-1096.543) (-1095.709) (-1096.027) [-1098.706] -- 0:00:51
201500 -- (-1095.116) (-1096.428) (-1097.971) [-1097.409] * (-1094.896) (-1094.758) [-1096.996] (-1097.617) -- 0:00:51
202000 -- (-1095.666) (-1096.633) (-1098.208) [-1095.409] * [-1094.939] (-1096.041) (-1099.913) (-1101.423) -- 0:00:51
202500 -- [-1098.356] (-1095.244) (-1094.853) (-1097.037) * [-1094.428] (-1096.604) (-1096.718) (-1097.114) -- 0:00:51
203000 -- (-1096.875) (-1095.409) (-1097.957) [-1096.158] * (-1098.000) (-1097.713) [-1095.389] (-1096.207) -- 0:00:51
203500 -- (-1101.271) (-1095.684) (-1097.948) [-1094.954] * (-1099.880) [-1096.529] (-1094.720) (-1095.970) -- 0:00:50
204000 -- (-1099.712) (-1098.161) (-1095.186) [-1094.506] * [-1101.031] (-1097.629) (-1098.644) (-1097.059) -- 0:00:50
204500 -- (-1098.490) (-1100.257) (-1100.885) [-1096.930] * (-1098.121) (-1096.662) [-1100.352] (-1097.267) -- 0:00:50
205000 -- [-1098.155] (-1094.801) (-1094.624) (-1097.900) * [-1099.067] (-1096.850) (-1097.392) (-1096.232) -- 0:00:50
Average standard deviation of split frequencies: 0.017926
205500 -- (-1098.975) [-1095.841] (-1094.644) (-1096.184) * (-1095.572) [-1095.161] (-1097.968) (-1099.799) -- 0:00:50
206000 -- (-1099.561) (-1096.747) (-1096.123) [-1096.524] * (-1094.477) [-1096.743] (-1097.663) (-1096.860) -- 0:00:50
206500 -- (-1097.610) (-1098.511) (-1095.733) [-1096.616] * (-1096.362) [-1096.230] (-1099.878) (-1097.331) -- 0:00:49
207000 -- (-1098.077) (-1098.472) [-1098.097] (-1095.989) * (-1096.608) (-1099.452) [-1100.487] (-1097.179) -- 0:00:49
207500 -- (-1096.118) [-1096.964] (-1097.335) (-1097.534) * (-1098.551) (-1096.634) [-1096.418] (-1097.838) -- 0:00:49
208000 -- (-1100.126) (-1095.513) [-1095.248] (-1097.697) * (-1097.684) [-1095.638] (-1100.658) (-1098.470) -- 0:00:53
208500 -- (-1097.085) [-1095.671] (-1096.160) (-1096.347) * (-1098.229) (-1097.538) [-1098.328] (-1100.182) -- 0:00:53
209000 -- [-1095.123] (-1096.742) (-1095.559) (-1097.010) * (-1098.235) [-1098.779] (-1099.811) (-1095.849) -- 0:00:52
209500 -- (-1095.110) (-1095.909) (-1096.481) [-1096.605] * [-1097.287] (-1100.533) (-1098.522) (-1095.848) -- 0:00:52
210000 -- (-1098.877) (-1095.537) (-1097.011) [-1098.029] * [-1095.516] (-1098.140) (-1096.404) (-1096.145) -- 0:00:52
Average standard deviation of split frequencies: 0.016223
210500 -- (-1095.421) (-1096.911) (-1100.377) [-1095.874] * [-1094.913] (-1095.452) (-1097.382) (-1095.839) -- 0:00:52
211000 -- (-1097.897) [-1096.467] (-1097.255) (-1095.657) * (-1095.320) [-1095.690] (-1097.144) (-1096.193) -- 0:00:52
211500 -- (-1095.299) [-1097.819] (-1096.433) (-1094.848) * [-1098.506] (-1095.411) (-1096.987) (-1095.017) -- 0:00:52
212000 -- (-1095.452) (-1096.158) (-1096.407) [-1099.901] * (-1096.999) (-1098.516) [-1095.275] (-1095.743) -- 0:00:52
212500 -- [-1096.269] (-1099.867) (-1095.565) (-1095.080) * (-1095.558) (-1098.079) [-1095.550] (-1095.835) -- 0:00:51
213000 -- (-1097.295) [-1094.943] (-1099.771) (-1095.286) * (-1103.909) (-1098.229) [-1096.819] (-1095.600) -- 0:00:51
213500 -- [-1096.813] (-1095.877) (-1097.378) (-1099.031) * (-1097.469) (-1095.072) (-1098.591) [-1095.809] -- 0:00:51
214000 -- (-1097.355) [-1095.816] (-1097.938) (-1101.387) * (-1098.079) (-1095.326) [-1098.184] (-1098.493) -- 0:00:51
214500 -- (-1096.660) (-1098.216) (-1098.377) [-1100.182] * (-1103.051) (-1096.576) [-1096.916] (-1097.259) -- 0:00:51
215000 -- (-1096.405) (-1095.091) [-1095.352] (-1097.411) * (-1100.165) (-1096.522) [-1098.808] (-1095.789) -- 0:00:51
Average standard deviation of split frequencies: 0.018263
215500 -- (-1098.852) [-1095.949] (-1098.128) (-1096.610) * (-1100.994) (-1101.201) (-1101.105) [-1096.626] -- 0:00:50
216000 -- (-1098.464) (-1100.208) (-1097.856) [-1096.145] * (-1095.804) (-1095.378) (-1101.041) [-1095.814] -- 0:00:50
216500 -- (-1100.658) (-1096.165) [-1096.624] (-1099.979) * (-1095.315) [-1095.117] (-1098.309) (-1097.372) -- 0:00:50
217000 -- (-1096.717) (-1096.301) [-1096.308] (-1097.842) * (-1097.719) [-1094.482] (-1099.128) (-1096.066) -- 0:00:50
217500 -- (-1094.804) (-1095.957) [-1096.674] (-1097.933) * [-1095.899] (-1098.213) (-1099.344) (-1101.816) -- 0:00:50
218000 -- (-1095.457) (-1097.865) (-1098.077) [-1096.266] * (-1096.498) [-1095.350] (-1095.815) (-1095.790) -- 0:00:50
218500 -- (-1097.026) [-1097.971] (-1096.968) (-1095.806) * (-1095.799) [-1098.782] (-1101.322) (-1095.499) -- 0:00:50
219000 -- [-1095.189] (-1095.050) (-1095.735) (-1094.948) * (-1095.351) (-1105.659) (-1097.992) [-1095.952] -- 0:00:49
219500 -- (-1095.600) (-1095.475) [-1094.607] (-1096.936) * (-1095.842) [-1098.187] (-1097.748) (-1095.972) -- 0:00:49
220000 -- [-1096.070] (-1098.131) (-1097.628) (-1100.031) * (-1095.591) (-1095.569) [-1096.622] (-1095.213) -- 0:00:49
Average standard deviation of split frequencies: 0.018664
220500 -- (-1098.852) [-1097.534] (-1098.322) (-1096.176) * (-1103.193) [-1095.165] (-1095.370) (-1094.823) -- 0:00:49
221000 -- (-1098.709) [-1098.045] (-1097.716) (-1099.014) * [-1096.198] (-1097.076) (-1095.446) (-1094.898) -- 0:00:49
221500 -- [-1097.361] (-1097.156) (-1099.314) (-1096.091) * (-1097.395) (-1096.971) (-1097.011) [-1095.488] -- 0:00:49
222000 -- (-1095.318) (-1096.484) [-1100.277] (-1095.631) * [-1096.987] (-1096.583) (-1096.047) (-1097.558) -- 0:00:49
222500 -- (-1095.001) [-1096.394] (-1098.643) (-1095.133) * [-1096.417] (-1095.934) (-1096.085) (-1097.760) -- 0:00:48
223000 -- (-1097.270) [-1097.028] (-1096.931) (-1095.695) * (-1097.716) [-1096.178] (-1096.096) (-1098.260) -- 0:00:52
223500 -- (-1098.203) (-1098.052) (-1096.890) [-1097.740] * (-1100.560) [-1095.968] (-1098.767) (-1098.168) -- 0:00:52
224000 -- (-1097.585) [-1096.725] (-1096.840) (-1097.573) * (-1102.496) (-1099.144) [-1098.521] (-1099.791) -- 0:00:51
224500 -- (-1096.489) (-1098.638) (-1095.842) [-1098.352] * (-1096.314) [-1096.615] (-1097.854) (-1098.230) -- 0:00:51
225000 -- [-1097.746] (-1099.396) (-1097.902) (-1097.042) * (-1094.733) (-1099.599) [-1098.435] (-1098.645) -- 0:00:51
Average standard deviation of split frequencies: 0.018004
225500 -- [-1098.347] (-1098.855) (-1098.507) (-1096.547) * (-1097.145) (-1098.391) (-1097.244) [-1096.937] -- 0:00:51
226000 -- (-1100.068) (-1094.864) (-1096.570) [-1098.789] * [-1095.591] (-1097.064) (-1097.442) (-1096.732) -- 0:00:51
226500 -- [-1096.127] (-1097.449) (-1098.106) (-1097.640) * (-1096.270) (-1097.004) (-1097.293) [-1097.244] -- 0:00:51
227000 -- (-1096.091) [-1095.558] (-1094.735) (-1095.335) * [-1094.909] (-1096.388) (-1096.318) (-1096.327) -- 0:00:51
227500 -- (-1097.590) (-1095.558) [-1095.615] (-1098.162) * (-1096.194) [-1097.448] (-1095.507) (-1095.992) -- 0:00:50
228000 -- (-1095.297) (-1095.061) [-1094.991] (-1095.186) * [-1098.541] (-1100.769) (-1097.777) (-1095.449) -- 0:00:50
228500 -- [-1097.726] (-1096.122) (-1097.124) (-1096.382) * (-1097.044) (-1096.386) (-1095.943) [-1096.863] -- 0:00:50
229000 -- (-1095.099) (-1100.086) (-1097.620) [-1095.429] * (-1096.397) (-1095.864) (-1094.982) [-1097.323] -- 0:00:50
229500 -- (-1096.437) (-1095.196) (-1094.607) [-1095.639] * (-1097.909) (-1095.258) [-1095.038] (-1095.532) -- 0:00:50
230000 -- (-1097.979) (-1096.468) [-1095.236] (-1094.667) * (-1100.164) (-1095.235) [-1096.063] (-1096.461) -- 0:00:50
Average standard deviation of split frequencies: 0.018506
230500 -- (-1097.798) (-1096.012) (-1097.084) [-1095.389] * (-1096.033) (-1098.132) [-1099.004] (-1096.588) -- 0:00:50
231000 -- (-1096.911) [-1095.919] (-1099.976) (-1096.381) * [-1097.074] (-1096.725) (-1098.402) (-1101.638) -- 0:00:49
231500 -- (-1096.943) [-1095.489] (-1095.810) (-1095.248) * (-1095.897) (-1097.567) (-1096.656) [-1097.814] -- 0:00:49
232000 -- (-1097.491) [-1095.506] (-1094.931) (-1095.750) * (-1095.948) (-1096.769) (-1097.452) [-1099.071] -- 0:00:49
232500 -- (-1098.619) (-1103.215) (-1098.618) [-1095.543] * (-1096.369) (-1097.153) (-1097.252) [-1098.296] -- 0:00:49
233000 -- (-1102.626) (-1106.585) [-1100.914] (-1096.784) * [-1099.652] (-1099.165) (-1095.579) (-1096.025) -- 0:00:49
233500 -- [-1096.270] (-1102.773) (-1097.006) (-1096.960) * (-1100.248) (-1096.514) (-1096.009) [-1095.308] -- 0:00:49
234000 -- (-1095.625) (-1096.691) (-1095.448) [-1095.797] * (-1097.019) (-1095.791) [-1095.888] (-1095.600) -- 0:00:49
234500 -- [-1098.433] (-1097.283) (-1098.093) (-1095.683) * (-1095.862) (-1096.715) [-1096.434] (-1095.528) -- 0:00:48
235000 -- (-1094.979) (-1096.524) [-1095.997] (-1098.161) * (-1096.232) [-1099.685] (-1094.723) (-1096.204) -- 0:00:48
Average standard deviation of split frequencies: 0.017200
235500 -- (-1094.942) (-1094.733) (-1095.890) [-1095.669] * (-1096.812) (-1099.657) [-1095.169] (-1095.249) -- 0:00:48
236000 -- (-1098.521) (-1094.599) [-1097.685] (-1096.119) * (-1095.416) (-1100.183) [-1096.083] (-1094.709) -- 0:00:48
236500 -- (-1101.199) [-1095.534] (-1095.241) (-1095.885) * (-1100.485) [-1097.656] (-1095.893) (-1094.831) -- 0:00:48
237000 -- [-1097.234] (-1096.139) (-1095.139) (-1098.638) * (-1098.501) (-1099.121) (-1094.980) [-1098.982] -- 0:00:48
237500 -- (-1098.277) (-1096.930) [-1095.790] (-1099.483) * (-1097.183) (-1096.023) [-1095.079] (-1096.296) -- 0:00:48
238000 -- (-1096.688) (-1096.968) (-1095.055) [-1095.189] * (-1097.319) [-1097.222] (-1099.874) (-1098.665) -- 0:00:48
238500 -- (-1097.423) [-1098.322] (-1095.404) (-1095.228) * (-1100.202) (-1095.872) [-1098.377] (-1095.977) -- 0:00:47
239000 -- (-1096.128) (-1100.270) [-1096.305] (-1096.631) * (-1098.771) [-1095.905] (-1096.556) (-1096.963) -- 0:00:50
239500 -- (-1099.108) [-1095.158] (-1095.762) (-1096.466) * (-1098.533) [-1095.650] (-1096.590) (-1097.937) -- 0:00:50
240000 -- [-1095.171] (-1097.991) (-1095.702) (-1096.560) * (-1096.890) [-1096.553] (-1095.906) (-1103.308) -- 0:00:50
Average standard deviation of split frequencies: 0.017398
240500 -- (-1096.530) (-1098.354) (-1096.669) [-1096.994] * (-1098.795) (-1096.173) (-1097.737) [-1096.624] -- 0:00:50
241000 -- [-1096.698] (-1098.381) (-1098.826) (-1097.009) * (-1096.050) [-1096.925] (-1099.578) (-1098.971) -- 0:00:50
241500 -- (-1095.582) [-1096.029] (-1096.748) (-1098.271) * [-1095.970] (-1096.772) (-1101.927) (-1098.951) -- 0:00:50
242000 -- [-1096.718] (-1095.410) (-1099.438) (-1095.031) * [-1095.122] (-1095.910) (-1101.925) (-1096.618) -- 0:00:50
242500 -- (-1098.892) (-1095.069) [-1095.049] (-1095.244) * [-1095.385] (-1097.933) (-1095.834) (-1095.791) -- 0:00:49
243000 -- (-1098.583) [-1095.479] (-1094.696) (-1097.770) * (-1096.942) (-1099.413) (-1099.901) [-1096.656] -- 0:00:49
243500 -- (-1096.847) (-1095.491) [-1098.121] (-1094.623) * [-1097.511] (-1097.326) (-1096.838) (-1098.559) -- 0:00:49
244000 -- (-1095.742) [-1098.650] (-1097.748) (-1099.419) * (-1101.157) [-1096.894] (-1100.792) (-1098.445) -- 0:00:49
244500 -- [-1098.574] (-1097.777) (-1099.304) (-1096.745) * (-1101.771) [-1097.939] (-1100.228) (-1096.665) -- 0:00:49
245000 -- [-1101.126] (-1095.894) (-1096.010) (-1096.854) * (-1101.616) (-1097.039) (-1098.136) [-1096.494] -- 0:00:49
Average standard deviation of split frequencies: 0.017353
245500 -- (-1098.298) (-1099.373) (-1096.615) [-1096.523] * (-1097.169) (-1099.236) [-1094.728] (-1096.952) -- 0:00:49
246000 -- (-1102.192) (-1098.327) [-1096.411] (-1096.027) * (-1101.295) [-1094.826] (-1096.137) (-1097.933) -- 0:00:49
246500 -- [-1097.034] (-1096.198) (-1095.723) (-1098.349) * (-1097.497) (-1097.377) (-1098.636) [-1096.400] -- 0:00:48
247000 -- (-1095.892) (-1096.378) (-1095.853) [-1094.983] * (-1098.610) (-1097.458) (-1101.080) [-1095.664] -- 0:00:48
247500 -- (-1096.122) (-1098.260) [-1095.665] (-1095.358) * (-1103.754) (-1100.168) (-1099.024) [-1096.782] -- 0:00:48
248000 -- (-1097.158) [-1096.343] (-1095.517) (-1095.301) * [-1096.661] (-1098.527) (-1097.307) (-1099.444) -- 0:00:48
248500 -- (-1097.179) (-1095.597) (-1094.965) [-1096.952] * [-1096.284] (-1098.219) (-1096.067) (-1099.838) -- 0:00:48
249000 -- (-1098.253) [-1096.831] (-1095.096) (-1098.126) * [-1095.819] (-1095.318) (-1095.903) (-1096.134) -- 0:00:48
249500 -- (-1100.061) [-1096.734] (-1095.523) (-1098.660) * (-1096.968) [-1096.964] (-1097.359) (-1095.975) -- 0:00:48
250000 -- (-1097.814) [-1096.224] (-1099.109) (-1095.569) * (-1099.753) [-1094.576] (-1097.525) (-1096.393) -- 0:00:48
Average standard deviation of split frequencies: 0.018924
250500 -- (-1097.285) (-1096.365) [-1095.782] (-1099.502) * (-1095.674) (-1095.631) (-1099.655) [-1096.412] -- 0:00:47
251000 -- [-1097.997] (-1095.863) (-1095.829) (-1097.669) * (-1101.678) (-1095.094) [-1098.017] (-1096.121) -- 0:00:47
251500 -- (-1095.011) [-1095.665] (-1095.829) (-1098.554) * (-1094.988) (-1099.598) [-1099.750] (-1096.018) -- 0:00:47
252000 -- (-1097.891) [-1095.146] (-1096.551) (-1098.561) * (-1097.759) [-1097.066] (-1100.803) (-1096.194) -- 0:00:47
252500 -- (-1096.700) [-1096.850] (-1095.229) (-1095.820) * (-1099.494) (-1098.373) (-1098.830) [-1095.624] -- 0:00:47
253000 -- (-1100.343) [-1094.866] (-1096.045) (-1096.021) * (-1096.546) (-1095.667) [-1095.538] (-1098.952) -- 0:00:47
253500 -- (-1095.180) [-1098.129] (-1104.181) (-1094.743) * (-1099.536) (-1097.152) (-1098.262) [-1094.904] -- 0:00:47
254000 -- (-1097.482) (-1099.271) (-1099.870) [-1094.967] * (-1097.365) [-1095.464] (-1096.234) (-1097.925) -- 0:00:46
254500 -- (-1096.752) [-1096.999] (-1097.236) (-1096.887) * (-1095.409) (-1097.250) (-1099.507) [-1097.361] -- 0:00:46
255000 -- [-1097.333] (-1095.095) (-1095.842) (-1098.403) * [-1095.293] (-1097.787) (-1097.186) (-1095.139) -- 0:00:49
Average standard deviation of split frequencies: 0.018414
255500 -- (-1096.799) (-1095.763) (-1095.781) [-1095.540] * (-1097.850) (-1096.199) (-1096.688) [-1096.160] -- 0:00:49
256000 -- (-1095.003) [-1101.676] (-1095.685) (-1097.208) * (-1096.625) [-1095.700] (-1097.172) (-1095.577) -- 0:00:49
256500 -- [-1097.611] (-1099.043) (-1095.457) (-1100.801) * (-1099.450) (-1095.422) [-1097.358] (-1096.834) -- 0:00:49
257000 -- (-1099.911) (-1096.850) [-1096.380] (-1098.032) * (-1096.959) (-1099.101) (-1097.354) [-1095.213] -- 0:00:49
257500 -- [-1097.513] (-1096.682) (-1096.270) (-1097.271) * (-1098.823) [-1099.960] (-1097.776) (-1098.349) -- 0:00:49
258000 -- (-1098.742) (-1095.765) [-1099.919] (-1096.493) * (-1101.109) (-1097.126) (-1097.589) [-1098.486] -- 0:00:48
258500 -- (-1096.885) [-1097.041] (-1095.972) (-1095.838) * (-1096.975) [-1094.683] (-1095.241) (-1097.964) -- 0:00:48
259000 -- (-1097.700) (-1094.918) (-1101.140) [-1099.863] * (-1095.861) [-1094.525] (-1095.820) (-1095.509) -- 0:00:48
259500 -- (-1098.995) (-1095.278) (-1096.506) [-1096.816] * (-1097.481) (-1094.769) [-1094.840] (-1098.615) -- 0:00:48
260000 -- (-1097.892) [-1095.338] (-1096.822) (-1097.379) * (-1095.873) (-1097.061) [-1096.445] (-1097.673) -- 0:00:48
Average standard deviation of split frequencies: 0.017446
260500 -- (-1098.721) (-1098.566) (-1096.749) [-1097.512] * (-1099.286) (-1096.514) (-1097.273) [-1095.454] -- 0:00:48
261000 -- [-1100.780] (-1100.845) (-1094.733) (-1095.367) * (-1098.942) (-1099.891) [-1095.685] (-1097.023) -- 0:00:48
261500 -- [-1097.430] (-1097.137) (-1100.898) (-1094.780) * (-1098.395) (-1100.259) (-1096.831) [-1098.349] -- 0:00:48
262000 -- (-1095.517) (-1096.336) (-1099.609) [-1094.817] * (-1098.964) (-1098.345) (-1096.595) [-1095.307] -- 0:00:47
262500 -- [-1095.168] (-1096.727) (-1099.139) (-1096.123) * (-1098.023) [-1095.492] (-1097.299) (-1095.619) -- 0:00:47
263000 -- (-1095.390) (-1098.935) (-1099.025) [-1097.261] * (-1094.894) (-1095.628) [-1096.457] (-1098.772) -- 0:00:47
263500 -- (-1097.225) (-1098.200) [-1096.923] (-1096.062) * (-1095.870) (-1096.112) (-1099.653) [-1096.497] -- 0:00:47
264000 -- (-1097.773) (-1097.598) [-1096.526] (-1094.815) * (-1095.055) [-1095.147] (-1103.149) (-1094.467) -- 0:00:47
264500 -- [-1095.811] (-1096.513) (-1097.112) (-1096.842) * (-1095.984) (-1095.749) (-1100.621) [-1097.572] -- 0:00:47
265000 -- [-1095.800] (-1096.869) (-1097.068) (-1098.916) * [-1095.872] (-1098.978) (-1098.045) (-1096.995) -- 0:00:47
Average standard deviation of split frequencies: 0.017305
265500 -- (-1096.996) (-1101.212) [-1097.328] (-1098.227) * (-1097.747) (-1097.399) [-1097.805] (-1095.978) -- 0:00:47
266000 -- [-1094.865] (-1095.453) (-1095.744) (-1099.603) * (-1096.934) [-1095.808] (-1096.382) (-1098.416) -- 0:00:46
266500 -- (-1095.163) (-1096.144) [-1094.858] (-1098.790) * [-1094.977] (-1099.432) (-1095.722) (-1098.278) -- 0:00:46
267000 -- [-1096.219] (-1096.512) (-1096.977) (-1095.898) * [-1097.621] (-1098.652) (-1095.720) (-1096.979) -- 0:00:46
267500 -- (-1099.666) [-1095.132] (-1097.593) (-1095.883) * (-1095.680) [-1101.507] (-1097.044) (-1097.097) -- 0:00:46
268000 -- (-1099.530) (-1095.178) (-1098.384) [-1095.889] * (-1099.686) [-1098.977] (-1098.054) (-1101.004) -- 0:00:46
268500 -- (-1096.356) (-1096.644) (-1099.197) [-1096.911] * (-1094.791) [-1097.517] (-1103.267) (-1094.585) -- 0:00:46
269000 -- (-1100.373) [-1096.734] (-1096.448) (-1096.237) * (-1098.763) (-1099.032) (-1097.943) [-1098.336] -- 0:00:46
269500 -- [-1096.914] (-1097.514) (-1094.998) (-1100.029) * (-1099.643) (-1101.196) (-1098.405) [-1094.959] -- 0:00:46
270000 -- [-1095.980] (-1096.986) (-1098.098) (-1100.097) * [-1099.376] (-1099.384) (-1096.382) (-1096.626) -- 0:00:45
Average standard deviation of split frequencies: 0.018868
270500 -- (-1098.798) [-1095.937] (-1095.467) (-1098.794) * (-1097.331) [-1096.700] (-1096.783) (-1097.098) -- 0:00:45
271000 -- [-1096.792] (-1100.841) (-1095.968) (-1095.343) * (-1097.125) [-1096.686] (-1096.413) (-1098.084) -- 0:00:45
271500 -- (-1095.907) (-1096.951) [-1094.665] (-1097.493) * [-1097.066] (-1096.109) (-1094.715) (-1095.723) -- 0:00:48
272000 -- (-1096.740) [-1099.327] (-1094.984) (-1096.792) * (-1097.207) (-1096.606) (-1095.588) [-1095.736] -- 0:00:48
272500 -- (-1096.487) (-1099.141) (-1098.316) [-1097.728] * [-1095.734] (-1095.758) (-1095.652) (-1096.608) -- 0:00:48
273000 -- (-1097.232) (-1098.797) (-1096.127) [-1099.606] * (-1096.770) (-1096.173) [-1102.709] (-1098.631) -- 0:00:47
273500 -- [-1095.065] (-1098.747) (-1097.559) (-1095.433) * (-1095.451) (-1094.798) [-1096.326] (-1096.020) -- 0:00:47
274000 -- [-1095.197] (-1098.701) (-1096.545) (-1096.646) * (-1096.153) (-1095.405) [-1096.178] (-1095.490) -- 0:00:47
274500 -- (-1096.118) (-1099.919) (-1098.979) [-1095.492] * (-1096.073) (-1095.238) [-1097.670] (-1094.965) -- 0:00:47
275000 -- [-1095.926] (-1098.364) (-1096.071) (-1096.962) * (-1095.938) (-1095.798) [-1097.318] (-1094.914) -- 0:00:47
Average standard deviation of split frequencies: 0.017080
275500 -- (-1096.449) (-1099.368) [-1096.265] (-1096.649) * (-1095.059) (-1098.517) [-1099.985] (-1094.463) -- 0:00:47
276000 -- (-1097.158) (-1099.416) (-1094.706) [-1097.069] * (-1097.915) (-1096.441) (-1097.791) [-1097.593] -- 0:00:47
276500 -- [-1096.495] (-1100.093) (-1101.162) (-1096.259) * (-1095.078) (-1096.153) (-1094.765) [-1095.529] -- 0:00:47
277000 -- [-1096.603] (-1096.568) (-1099.636) (-1096.439) * (-1096.285) (-1094.725) (-1094.942) [-1096.180] -- 0:00:46
277500 -- (-1095.997) [-1096.761] (-1097.549) (-1096.486) * [-1096.447] (-1095.350) (-1094.755) (-1097.588) -- 0:00:46
278000 -- (-1100.661) [-1095.982] (-1097.297) (-1095.408) * (-1095.845) [-1097.095] (-1096.760) (-1095.041) -- 0:00:46
278500 -- (-1098.555) (-1095.179) [-1095.043] (-1094.820) * (-1097.854) [-1101.602] (-1094.970) (-1095.525) -- 0:00:46
279000 -- [-1098.808] (-1096.298) (-1095.170) (-1097.998) * (-1096.591) (-1096.669) (-1096.662) [-1098.488] -- 0:00:46
279500 -- (-1097.315) [-1096.301] (-1095.115) (-1096.601) * (-1097.214) [-1097.689] (-1097.785) (-1101.966) -- 0:00:46
280000 -- (-1101.428) (-1096.510) (-1094.884) [-1095.772] * (-1097.303) (-1097.772) [-1095.109] (-1096.619) -- 0:00:46
Average standard deviation of split frequencies: 0.016376
280500 -- (-1097.008) (-1096.781) (-1096.347) [-1097.375] * [-1096.583] (-1095.663) (-1095.464) (-1099.900) -- 0:00:46
281000 -- (-1096.617) (-1096.571) [-1096.751] (-1097.120) * [-1096.441] (-1097.019) (-1095.005) (-1095.589) -- 0:00:46
281500 -- (-1096.618) (-1098.464) (-1096.210) [-1095.296] * [-1095.482] (-1098.181) (-1094.564) (-1098.242) -- 0:00:45
282000 -- (-1097.298) (-1096.942) (-1098.122) [-1100.038] * (-1095.482) (-1096.604) [-1094.658] (-1099.348) -- 0:00:45
282500 -- (-1097.426) [-1096.220] (-1097.236) (-1103.683) * (-1095.616) (-1095.927) (-1095.895) [-1095.650] -- 0:00:45
283000 -- (-1097.760) (-1098.303) [-1095.610] (-1094.971) * [-1096.470] (-1094.829) (-1095.732) (-1095.979) -- 0:00:45
283500 -- (-1103.999) [-1095.698] (-1098.132) (-1096.821) * (-1102.552) (-1100.069) [-1096.074] (-1095.445) -- 0:00:45
284000 -- (-1099.892) [-1096.380] (-1096.236) (-1096.267) * (-1100.064) (-1103.043) [-1098.510] (-1096.595) -- 0:00:45
284500 -- [-1101.721] (-1096.297) (-1095.439) (-1096.233) * (-1098.389) (-1098.230) (-1101.910) [-1097.860] -- 0:00:45
285000 -- (-1103.774) [-1096.230] (-1095.389) (-1094.961) * (-1101.449) [-1096.969] (-1096.831) (-1101.266) -- 0:00:45
Average standard deviation of split frequencies: 0.016916
285500 -- (-1097.310) (-1097.022) (-1096.982) [-1095.021] * (-1105.949) (-1096.236) (-1098.429) [-1101.338] -- 0:00:45
286000 -- (-1095.822) (-1098.057) [-1098.353] (-1096.102) * (-1096.091) [-1096.491] (-1097.399) (-1101.400) -- 0:00:44
286500 -- (-1095.898) (-1097.569) [-1097.028] (-1096.102) * (-1096.041) (-1099.592) (-1098.133) [-1099.248] -- 0:00:44
287000 -- (-1098.074) (-1095.567) [-1095.195] (-1095.636) * (-1097.606) (-1096.026) [-1099.532] (-1096.143) -- 0:00:44
287500 -- (-1095.808) (-1096.327) [-1096.383] (-1096.349) * (-1105.481) (-1097.223) [-1096.316] (-1096.799) -- 0:00:47
288000 -- [-1099.438] (-1097.734) (-1096.114) (-1096.254) * [-1097.344] (-1100.786) (-1096.634) (-1097.109) -- 0:00:46
288500 -- [-1096.190] (-1097.930) (-1095.986) (-1099.111) * [-1095.549] (-1097.989) (-1095.773) (-1096.314) -- 0:00:46
289000 -- [-1097.966] (-1096.035) (-1099.989) (-1095.245) * (-1095.460) (-1095.381) [-1094.837] (-1098.589) -- 0:00:46
289500 -- [-1096.487] (-1095.853) (-1098.106) (-1094.672) * [-1096.518] (-1095.476) (-1095.973) (-1098.412) -- 0:00:46
290000 -- (-1098.540) (-1097.229) (-1095.391) [-1097.983] * [-1099.223] (-1098.065) (-1098.633) (-1096.108) -- 0:00:46
Average standard deviation of split frequencies: 0.017389
290500 -- (-1096.403) (-1097.666) (-1095.426) [-1099.197] * [-1095.875] (-1096.125) (-1095.268) (-1097.825) -- 0:00:46
291000 -- (-1096.719) [-1095.937] (-1096.154) (-1095.707) * [-1098.358] (-1096.354) (-1095.763) (-1096.216) -- 0:00:46
291500 -- (-1095.202) [-1097.342] (-1096.380) (-1097.689) * [-1096.074] (-1096.308) (-1097.891) (-1097.700) -- 0:00:46
292000 -- (-1095.426) (-1095.588) [-1095.727] (-1098.330) * (-1096.213) [-1097.246] (-1095.741) (-1096.494) -- 0:00:46
292500 -- [-1096.483] (-1098.651) (-1095.859) (-1097.265) * (-1095.836) (-1095.736) (-1099.290) [-1098.199] -- 0:00:45
293000 -- (-1097.242) (-1098.699) (-1095.501) [-1097.254] * (-1096.159) (-1098.124) (-1098.372) [-1095.252] -- 0:00:45
293500 -- (-1094.908) (-1097.776) (-1099.037) [-1096.801] * (-1096.820) (-1100.130) (-1097.982) [-1095.252] -- 0:00:45
294000 -- (-1096.564) [-1096.962] (-1096.297) (-1097.637) * (-1095.734) [-1099.158] (-1097.728) (-1094.562) -- 0:00:45
294500 -- (-1098.353) (-1095.420) (-1096.111) [-1096.718] * [-1098.116] (-1097.034) (-1099.038) (-1098.638) -- 0:00:45
295000 -- (-1095.288) (-1095.614) [-1096.384] (-1095.796) * (-1097.018) (-1096.095) [-1098.594] (-1097.218) -- 0:00:45
Average standard deviation of split frequencies: 0.017518
295500 -- (-1095.019) [-1096.404] (-1097.718) (-1097.055) * (-1097.218) (-1095.629) [-1095.260] (-1098.070) -- 0:00:45
296000 -- (-1095.372) (-1097.290) (-1099.781) [-1097.477] * [-1103.417] (-1099.473) (-1095.070) (-1095.012) -- 0:00:45
296500 -- (-1095.406) (-1099.849) (-1095.956) [-1095.611] * (-1096.908) (-1098.744) (-1098.315) [-1096.700] -- 0:00:45
297000 -- (-1100.373) [-1095.285] (-1096.178) (-1095.986) * [-1096.497] (-1097.165) (-1099.053) (-1097.385) -- 0:00:44
297500 -- (-1095.390) (-1096.776) (-1100.837) [-1096.096] * (-1096.181) [-1096.283] (-1098.861) (-1099.975) -- 0:00:44
298000 -- (-1095.409) [-1095.433] (-1095.123) (-1100.338) * [-1095.168] (-1096.955) (-1100.049) (-1098.010) -- 0:00:44
298500 -- (-1095.425) (-1096.627) (-1099.869) [-1096.915] * (-1097.285) (-1097.575) [-1095.001] (-1099.465) -- 0:00:44
299000 -- [-1097.945] (-1096.719) (-1096.565) (-1096.556) * (-1098.782) (-1096.735) [-1095.562] (-1097.664) -- 0:00:44
299500 -- [-1095.673] (-1099.036) (-1098.572) (-1096.028) * (-1096.861) (-1097.030) (-1095.650) [-1095.928] -- 0:00:44
300000 -- (-1096.448) (-1096.662) (-1095.616) [-1095.962] * (-1097.258) [-1096.239] (-1099.229) (-1095.390) -- 0:00:44
Average standard deviation of split frequencies: 0.016811
300500 -- [-1095.681] (-1096.739) (-1097.415) (-1095.677) * (-1097.888) (-1095.934) [-1095.916] (-1096.279) -- 0:00:44
301000 -- (-1096.958) [-1098.015] (-1096.069) (-1098.871) * (-1096.952) (-1094.741) [-1101.678] (-1095.661) -- 0:00:44
301500 -- (-1096.128) (-1096.890) [-1094.899] (-1096.805) * [-1096.076] (-1097.320) (-1097.785) (-1096.147) -- 0:00:44
302000 -- (-1097.304) (-1095.689) [-1096.839] (-1097.786) * (-1095.460) [-1095.327] (-1101.770) (-1095.278) -- 0:00:43
302500 -- (-1095.300) (-1095.221) [-1095.643] (-1101.225) * [-1097.432] (-1099.937) (-1099.917) (-1096.288) -- 0:00:43
303000 -- (-1096.587) (-1097.135) (-1096.049) [-1098.014] * (-1096.237) [-1099.515] (-1098.874) (-1097.266) -- 0:00:43
303500 -- (-1097.211) [-1097.629] (-1095.940) (-1098.463) * [-1095.670] (-1096.930) (-1099.137) (-1095.116) -- 0:00:45
304000 -- [-1098.146] (-1098.215) (-1101.192) (-1095.031) * (-1099.397) (-1101.070) [-1096.318] (-1096.729) -- 0:00:45
304500 -- [-1099.368] (-1095.422) (-1099.560) (-1096.651) * (-1100.488) (-1094.776) [-1099.011] (-1095.675) -- 0:00:45
305000 -- [-1095.624] (-1095.883) (-1099.789) (-1096.301) * (-1099.247) (-1095.829) (-1096.011) [-1097.057] -- 0:00:45
Average standard deviation of split frequencies: 0.017108
305500 -- (-1096.930) (-1096.377) (-1095.398) [-1094.588] * [-1097.935] (-1095.747) (-1095.721) (-1098.021) -- 0:00:45
306000 -- (-1095.617) (-1097.156) (-1096.007) [-1094.667] * (-1098.187) (-1095.802) [-1099.514] (-1100.404) -- 0:00:45
306500 -- (-1096.263) (-1099.050) [-1095.897] (-1095.264) * (-1101.643) (-1096.100) [-1099.510] (-1096.531) -- 0:00:45
307000 -- [-1095.693] (-1099.919) (-1097.745) (-1099.364) * (-1096.499) (-1095.400) (-1098.401) [-1096.439] -- 0:00:45
307500 -- [-1095.192] (-1096.448) (-1099.547) (-1095.201) * (-1097.151) (-1096.183) [-1095.274] (-1097.944) -- 0:00:45
308000 -- (-1096.246) (-1099.064) [-1097.035] (-1094.917) * (-1102.160) [-1098.055] (-1095.350) (-1100.852) -- 0:00:44
308500 -- [-1096.134] (-1095.206) (-1097.259) (-1094.921) * [-1098.014] (-1097.384) (-1095.227) (-1096.942) -- 0:00:44
309000 -- (-1095.161) (-1096.673) (-1095.193) [-1096.422] * (-1098.204) [-1097.838] (-1096.121) (-1096.926) -- 0:00:44
309500 -- [-1096.322] (-1097.868) (-1095.216) (-1096.032) * (-1097.220) [-1095.397] (-1096.395) (-1097.169) -- 0:00:44
310000 -- (-1096.501) [-1097.113] (-1096.906) (-1096.781) * (-1096.001) (-1095.625) [-1095.768] (-1095.151) -- 0:00:44
Average standard deviation of split frequencies: 0.018289
310500 -- (-1098.650) (-1097.087) (-1096.423) [-1097.315] * (-1096.430) (-1096.908) (-1095.873) [-1095.217] -- 0:00:44
311000 -- (-1096.040) (-1095.870) [-1095.542] (-1097.117) * (-1097.945) (-1097.785) [-1096.838] (-1095.407) -- 0:00:44
311500 -- (-1100.396) (-1097.743) [-1095.601] (-1096.896) * (-1096.195) (-1099.652) (-1095.253) [-1096.809] -- 0:00:44
312000 -- (-1098.258) (-1098.311) [-1095.491] (-1096.308) * (-1096.387) (-1098.066) (-1097.851) [-1097.676] -- 0:00:44
312500 -- [-1097.073] (-1097.098) (-1099.134) (-1098.134) * (-1097.703) (-1099.135) (-1097.567) [-1098.177] -- 0:00:44
313000 -- (-1098.215) (-1102.605) [-1095.491] (-1095.952) * [-1097.993] (-1100.378) (-1096.076) (-1101.930) -- 0:00:43
313500 -- (-1101.087) (-1103.245) (-1098.315) [-1097.026] * (-1094.862) [-1094.754] (-1095.457) (-1095.164) -- 0:00:43
314000 -- [-1096.751] (-1100.639) (-1096.796) (-1095.904) * (-1100.496) [-1097.659] (-1096.707) (-1099.633) -- 0:00:43
314500 -- (-1098.325) (-1096.876) (-1096.588) [-1095.547] * (-1098.671) (-1097.349) [-1095.695] (-1096.638) -- 0:00:43
315000 -- (-1097.386) [-1095.071] (-1101.708) (-1095.098) * [-1096.538] (-1100.718) (-1097.351) (-1095.551) -- 0:00:43
Average standard deviation of split frequencies: 0.017430
315500 -- (-1096.187) [-1101.056] (-1103.705) (-1099.604) * (-1096.153) [-1096.981] (-1095.680) (-1103.584) -- 0:00:43
316000 -- (-1096.227) (-1098.684) (-1096.637) [-1098.004] * (-1096.156) [-1095.882] (-1101.984) (-1097.140) -- 0:00:43
316500 -- (-1101.240) [-1096.440] (-1095.918) (-1096.887) * (-1097.259) [-1097.478] (-1096.992) (-1097.337) -- 0:00:43
317000 -- (-1101.010) (-1096.085) [-1100.812] (-1096.735) * (-1098.225) [-1096.744] (-1095.188) (-1098.873) -- 0:00:43
317500 -- [-1095.962] (-1096.801) (-1098.934) (-1096.223) * (-1097.588) (-1098.137) (-1096.931) [-1100.361] -- 0:00:42
318000 -- [-1096.354] (-1097.921) (-1097.189) (-1099.170) * (-1097.845) [-1096.751] (-1097.125) (-1109.899) -- 0:00:42
318500 -- (-1094.628) [-1099.797] (-1096.299) (-1098.458) * (-1101.243) (-1096.686) (-1098.229) [-1108.950] -- 0:00:42
319000 -- [-1095.983] (-1097.907) (-1097.069) (-1099.049) * (-1096.904) [-1096.686] (-1099.882) (-1097.564) -- 0:00:42
319500 -- (-1098.045) [-1097.183] (-1095.609) (-1097.601) * [-1095.169] (-1096.876) (-1097.287) (-1095.706) -- 0:00:42
320000 -- (-1098.062) [-1096.614] (-1097.348) (-1097.041) * (-1096.325) [-1099.259] (-1095.997) (-1095.604) -- 0:00:44
Average standard deviation of split frequencies: 0.017718
320500 -- (-1097.835) (-1097.287) (-1095.676) [-1095.751] * (-1097.050) [-1095.200] (-1098.188) (-1095.851) -- 0:00:44
321000 -- [-1097.666] (-1097.287) (-1095.101) (-1095.559) * [-1096.741] (-1098.739) (-1096.897) (-1099.408) -- 0:00:44
321500 -- [-1097.328] (-1097.836) (-1098.316) (-1095.356) * [-1097.224] (-1099.759) (-1099.642) (-1096.338) -- 0:00:44
322000 -- (-1101.922) [-1096.262] (-1098.882) (-1096.079) * (-1097.238) (-1099.270) [-1096.839] (-1096.186) -- 0:00:44
322500 -- (-1096.670) (-1095.407) (-1096.522) [-1096.141] * (-1097.317) (-1099.230) (-1096.681) [-1094.993] -- 0:00:44
323000 -- (-1100.545) [-1096.553] (-1095.227) (-1096.259) * (-1096.576) (-1099.802) (-1096.882) [-1097.825] -- 0:00:44
323500 -- (-1096.571) [-1096.312] (-1095.746) (-1097.785) * [-1097.046] (-1095.604) (-1100.765) (-1095.501) -- 0:00:43
324000 -- [-1099.822] (-1096.512) (-1095.000) (-1095.516) * (-1096.560) (-1098.271) (-1100.634) [-1095.919] -- 0:00:43
324500 -- (-1096.545) (-1096.877) [-1094.693] (-1095.189) * (-1097.359) (-1100.070) (-1096.620) [-1095.152] -- 0:00:43
325000 -- (-1098.476) (-1098.538) (-1094.998) [-1096.407] * (-1103.671) (-1095.099) (-1095.663) [-1094.955] -- 0:00:43
Average standard deviation of split frequencies: 0.016846
325500 -- (-1094.377) (-1097.084) (-1096.503) [-1097.631] * (-1095.855) [-1101.763] (-1096.649) (-1095.538) -- 0:00:43
326000 -- (-1095.003) (-1094.595) (-1097.287) [-1095.507] * (-1095.545) (-1098.960) [-1099.463] (-1096.295) -- 0:00:43
326500 -- (-1095.956) (-1096.908) [-1095.740] (-1100.217) * (-1094.901) (-1096.359) [-1097.850] (-1097.203) -- 0:00:43
327000 -- (-1095.326) (-1096.759) [-1094.777] (-1099.010) * (-1095.055) (-1095.929) [-1097.134] (-1096.212) -- 0:00:43
327500 -- (-1096.223) (-1097.488) (-1095.218) [-1102.531] * (-1096.224) (-1095.775) [-1098.876] (-1097.524) -- 0:00:43
328000 -- [-1100.034] (-1099.811) (-1094.643) (-1096.558) * [-1095.201] (-1095.978) (-1097.679) (-1095.717) -- 0:00:43
328500 -- (-1097.072) [-1097.050] (-1099.443) (-1096.803) * (-1095.345) (-1099.820) [-1097.290] (-1095.508) -- 0:00:42
329000 -- (-1098.159) (-1095.594) (-1097.797) [-1098.917] * (-1096.050) (-1098.973) (-1098.558) [-1100.613] -- 0:00:42
329500 -- (-1097.362) (-1094.742) (-1098.491) [-1097.173] * (-1095.211) (-1097.199) [-1100.060] (-1098.345) -- 0:00:42
330000 -- (-1097.510) (-1095.515) [-1097.771] (-1098.474) * [-1095.251] (-1095.935) (-1099.859) (-1100.094) -- 0:00:42
Average standard deviation of split frequencies: 0.016870
330500 -- (-1096.734) [-1095.544] (-1096.296) (-1095.520) * (-1099.000) (-1097.041) [-1096.035] (-1094.949) -- 0:00:42
331000 -- (-1094.716) [-1095.414] (-1097.917) (-1100.756) * (-1102.535) (-1096.731) [-1094.554] (-1099.693) -- 0:00:42
331500 -- (-1096.939) (-1096.435) (-1095.406) [-1098.182] * [-1101.492] (-1096.462) (-1095.178) (-1096.314) -- 0:00:42
332000 -- (-1097.716) [-1096.972] (-1095.365) (-1095.473) * (-1096.005) (-1096.756) [-1094.952] (-1096.989) -- 0:00:42
332500 -- (-1100.643) (-1098.661) [-1095.082] (-1100.536) * (-1099.945) (-1100.368) (-1099.866) [-1096.481] -- 0:00:42
333000 -- (-1099.547) (-1099.158) [-1095.905] (-1096.363) * (-1097.420) (-1099.348) (-1098.604) [-1095.481] -- 0:00:42
333500 -- (-1098.323) [-1099.878] (-1094.724) (-1097.093) * (-1097.310) [-1096.972] (-1095.423) (-1096.263) -- 0:00:41
334000 -- (-1100.949) (-1095.525) (-1095.261) [-1096.959] * [-1094.475] (-1095.637) (-1096.354) (-1096.275) -- 0:00:41
334500 -- (-1101.704) (-1094.988) (-1094.730) [-1096.007] * (-1094.934) (-1095.150) [-1096.379] (-1098.027) -- 0:00:41
335000 -- [-1099.647] (-1096.421) (-1098.691) (-1095.535) * (-1097.763) [-1095.646] (-1099.036) (-1097.409) -- 0:00:41
Average standard deviation of split frequencies: 0.016290
335500 -- [-1097.846] (-1097.070) (-1097.717) (-1098.074) * [-1094.870] (-1095.358) (-1097.808) (-1094.548) -- 0:00:41
336000 -- (-1096.224) (-1097.367) (-1096.689) [-1095.234] * (-1097.745) [-1095.001] (-1097.814) (-1096.559) -- 0:00:43
336500 -- (-1096.507) (-1099.322) (-1097.366) [-1095.069] * (-1096.629) (-1095.001) [-1096.470] (-1098.052) -- 0:00:43
337000 -- (-1095.746) [-1096.129] (-1097.527) (-1095.046) * (-1095.603) (-1095.898) (-1097.350) [-1095.335] -- 0:00:43
337500 -- (-1095.758) (-1096.825) [-1097.963] (-1098.752) * (-1096.142) (-1096.981) (-1097.161) [-1098.303] -- 0:00:43
338000 -- (-1099.602) (-1096.065) [-1100.972] (-1098.558) * [-1097.245] (-1099.771) (-1095.605) (-1099.574) -- 0:00:43
338500 -- (-1099.656) (-1096.626) [-1100.015] (-1099.095) * (-1097.328) (-1095.381) [-1097.301] (-1099.927) -- 0:00:42
339000 -- (-1099.215) [-1095.934] (-1095.039) (-1098.047) * (-1094.626) [-1100.247] (-1097.825) (-1098.588) -- 0:00:42
339500 -- (-1097.286) (-1097.361) (-1094.967) [-1096.440] * (-1098.330) (-1098.598) [-1100.966] (-1099.639) -- 0:00:42
340000 -- (-1097.470) [-1098.415] (-1095.742) (-1097.381) * (-1097.850) (-1099.860) (-1097.810) [-1096.322] -- 0:00:42
Average standard deviation of split frequencies: 0.016969
340500 -- (-1097.475) (-1098.388) (-1097.246) [-1097.352] * (-1096.007) (-1096.270) (-1096.718) [-1096.299] -- 0:00:42
341000 -- [-1095.720] (-1095.608) (-1103.057) (-1095.447) * (-1101.889) (-1095.760) (-1095.909) [-1095.202] -- 0:00:42
341500 -- [-1095.367] (-1095.617) (-1095.687) (-1094.929) * (-1095.605) [-1095.401] (-1094.681) (-1096.631) -- 0:00:42
342000 -- (-1097.454) (-1096.194) (-1096.577) [-1098.164] * (-1095.698) [-1097.268] (-1099.356) (-1095.827) -- 0:00:42
342500 -- (-1096.117) (-1097.119) [-1096.522] (-1095.971) * [-1096.123] (-1095.522) (-1098.080) (-1096.154) -- 0:00:42
343000 -- (-1101.929) [-1095.861] (-1098.299) (-1096.643) * (-1100.919) (-1095.098) [-1096.373] (-1096.367) -- 0:00:42
343500 -- (-1098.889) (-1099.996) (-1097.695) [-1095.466] * (-1098.627) (-1095.020) [-1096.030] (-1094.701) -- 0:00:42
344000 -- [-1099.199] (-1103.167) (-1096.231) (-1095.368) * [-1096.294] (-1096.799) (-1096.913) (-1094.701) -- 0:00:41
344500 -- [-1098.594] (-1100.547) (-1098.091) (-1096.489) * (-1096.090) [-1097.199] (-1098.151) (-1095.544) -- 0:00:41
345000 -- (-1095.699) (-1098.759) [-1101.211] (-1095.658) * [-1097.851] (-1095.582) (-1098.613) (-1097.210) -- 0:00:41
Average standard deviation of split frequencies: 0.017353
345500 -- (-1095.925) (-1097.152) [-1100.869] (-1098.556) * (-1096.666) [-1095.742] (-1097.207) (-1095.036) -- 0:00:41
346000 -- (-1096.717) (-1097.233) (-1096.562) [-1095.257] * (-1098.562) (-1099.904) [-1095.677] (-1095.514) -- 0:00:41
346500 -- [-1096.375] (-1096.012) (-1098.640) (-1095.742) * [-1096.742] (-1095.264) (-1096.150) (-1095.116) -- 0:00:41
347000 -- (-1096.165) [-1097.744] (-1097.554) (-1095.581) * (-1100.996) [-1095.318] (-1095.300) (-1096.809) -- 0:00:41
347500 -- (-1096.173) (-1097.246) (-1096.121) [-1096.966] * (-1096.635) (-1095.851) (-1095.612) [-1096.059] -- 0:00:41
348000 -- (-1097.584) (-1095.413) (-1095.506) [-1096.200] * (-1097.641) (-1095.148) (-1095.812) [-1100.592] -- 0:00:41
348500 -- [-1098.905] (-1097.275) (-1099.284) (-1094.776) * (-1100.408) (-1101.237) [-1095.219] (-1096.767) -- 0:00:41
349000 -- (-1097.254) [-1095.963] (-1098.143) (-1094.843) * (-1101.949) (-1098.168) (-1098.871) [-1096.483] -- 0:00:41
349500 -- [-1095.202] (-1097.081) (-1100.118) (-1096.128) * (-1095.852) (-1095.853) [-1099.497] (-1096.437) -- 0:00:40
350000 -- (-1096.086) (-1096.766) [-1099.803] (-1099.779) * (-1095.802) [-1096.286] (-1102.743) (-1098.878) -- 0:00:40
Average standard deviation of split frequencies: 0.016344
350500 -- (-1096.263) [-1096.847] (-1096.815) (-1096.394) * (-1095.249) (-1097.150) [-1099.879] (-1095.533) -- 0:00:40
351000 -- (-1097.467) (-1097.240) [-1095.679] (-1100.486) * [-1095.014] (-1098.781) (-1099.560) (-1095.627) -- 0:00:40
351500 -- [-1095.944] (-1096.351) (-1096.711) (-1103.572) * (-1095.217) (-1097.623) [-1101.420] (-1099.433) -- 0:00:40
352000 -- (-1094.846) (-1098.246) (-1096.778) [-1096.436] * (-1096.244) [-1097.463] (-1100.366) (-1102.058) -- 0:00:40
352500 -- [-1094.533] (-1099.641) (-1100.168) (-1101.208) * [-1098.964] (-1097.093) (-1097.421) (-1099.082) -- 0:00:42
353000 -- [-1096.068] (-1100.259) (-1096.486) (-1101.178) * (-1096.626) (-1096.666) (-1095.485) [-1095.441] -- 0:00:42
353500 -- [-1096.751] (-1098.533) (-1096.640) (-1100.400) * (-1095.768) (-1097.562) [-1096.318] (-1097.390) -- 0:00:42
354000 -- [-1096.890] (-1099.369) (-1095.315) (-1095.535) * [-1095.763] (-1098.338) (-1094.689) (-1098.379) -- 0:00:41
354500 -- (-1097.195) [-1097.548] (-1096.967) (-1096.523) * (-1099.764) (-1099.742) [-1095.625] (-1097.671) -- 0:00:41
355000 -- (-1095.523) (-1094.939) (-1095.888) [-1100.797] * (-1099.234) (-1097.656) [-1097.110] (-1099.021) -- 0:00:41
Average standard deviation of split frequencies: 0.015820
355500 -- (-1097.818) (-1094.864) [-1097.752] (-1100.348) * (-1097.018) [-1096.521] (-1096.260) (-1100.710) -- 0:00:41
356000 -- [-1094.858] (-1096.540) (-1097.173) (-1099.578) * (-1096.590) (-1097.963) (-1096.516) [-1100.963] -- 0:00:41
356500 -- [-1095.967] (-1097.264) (-1096.268) (-1096.100) * (-1095.112) (-1097.930) [-1098.179] (-1101.395) -- 0:00:41
357000 -- (-1096.252) [-1098.523] (-1094.923) (-1095.289) * (-1096.010) (-1096.711) [-1097.038] (-1097.465) -- 0:00:41
357500 -- (-1096.279) (-1096.572) [-1100.236] (-1094.810) * (-1099.030) (-1097.766) (-1096.219) [-1095.781] -- 0:00:41
358000 -- [-1096.181] (-1095.746) (-1095.466) (-1094.828) * [-1094.775] (-1097.592) (-1097.986) (-1098.189) -- 0:00:41
358500 -- (-1096.991) (-1096.732) [-1096.383] (-1094.943) * (-1095.398) (-1096.702) (-1098.521) [-1096.081] -- 0:00:41
359000 -- [-1097.199] (-1097.467) (-1096.298) (-1095.139) * (-1095.142) [-1098.085] (-1099.000) (-1096.563) -- 0:00:41
359500 -- [-1101.393] (-1095.794) (-1098.842) (-1094.961) * (-1096.156) [-1096.015] (-1094.626) (-1095.751) -- 0:00:40
360000 -- (-1099.060) [-1097.513] (-1095.523) (-1096.729) * (-1096.601) [-1095.976] (-1096.956) (-1097.092) -- 0:00:40
Average standard deviation of split frequencies: 0.014377
360500 -- (-1103.115) (-1096.271) (-1096.948) [-1094.626] * [-1099.312] (-1099.900) (-1098.308) (-1094.948) -- 0:00:40
361000 -- [-1096.318] (-1095.966) (-1096.813) (-1094.732) * (-1103.041) (-1103.141) (-1095.281) [-1095.396] -- 0:00:40
361500 -- (-1094.624) (-1096.871) (-1096.056) [-1095.588] * [-1098.229] (-1096.437) (-1097.062) (-1098.039) -- 0:00:40
362000 -- (-1094.642) (-1099.616) (-1096.845) [-1097.067] * (-1097.432) (-1097.295) (-1097.846) [-1104.189] -- 0:00:40
362500 -- (-1095.393) (-1101.497) (-1099.336) [-1098.425] * (-1097.615) (-1098.984) [-1096.205] (-1099.274) -- 0:00:40
363000 -- [-1095.580] (-1097.367) (-1096.337) (-1100.116) * (-1096.439) (-1101.644) [-1098.580] (-1101.646) -- 0:00:40
363500 -- (-1095.158) (-1096.905) [-1103.101] (-1097.578) * [-1096.109] (-1096.659) (-1095.611) (-1099.028) -- 0:00:40
364000 -- (-1097.401) (-1099.192) (-1098.477) [-1098.252] * (-1096.568) (-1101.535) [-1096.467] (-1097.712) -- 0:00:40
364500 -- [-1097.024] (-1096.907) (-1096.423) (-1098.365) * (-1094.640) (-1101.018) (-1096.476) [-1097.687] -- 0:00:40
365000 -- (-1098.276) (-1097.782) (-1097.405) [-1097.883] * (-1094.847) (-1096.719) (-1102.267) [-1099.854] -- 0:00:40
Average standard deviation of split frequencies: 0.014371
365500 -- (-1101.011) (-1095.391) [-1095.585] (-1095.285) * (-1100.055) (-1094.807) [-1103.228] (-1099.086) -- 0:00:39
366000 -- (-1096.553) (-1096.885) (-1096.380) [-1095.290] * [-1097.035] (-1096.035) (-1097.340) (-1096.534) -- 0:00:39
366500 -- (-1094.929) [-1096.539] (-1095.808) (-1095.220) * [-1095.239] (-1099.141) (-1099.960) (-1095.320) -- 0:00:39
367000 -- (-1097.884) (-1096.824) [-1097.686] (-1096.459) * [-1094.565] (-1099.697) (-1097.897) (-1095.662) -- 0:00:39
367500 -- (-1098.098) (-1094.953) (-1095.581) [-1097.551] * (-1095.737) (-1094.970) [-1098.712] (-1099.936) -- 0:00:39
368000 -- (-1096.199) [-1096.337] (-1096.747) (-1096.786) * [-1095.034] (-1095.436) (-1099.198) (-1097.060) -- 0:00:39
368500 -- (-1097.114) [-1095.667] (-1100.215) (-1096.909) * [-1105.282] (-1095.640) (-1096.364) (-1098.953) -- 0:00:41
369000 -- (-1096.970) (-1097.125) (-1099.069) [-1095.794] * (-1095.753) [-1095.619] (-1096.655) (-1098.478) -- 0:00:41
369500 -- (-1096.878) [-1097.695] (-1096.909) (-1096.375) * [-1096.367] (-1096.828) (-1097.230) (-1098.013) -- 0:00:40
370000 -- [-1096.469] (-1095.860) (-1100.797) (-1095.839) * [-1098.008] (-1098.778) (-1095.957) (-1098.274) -- 0:00:40
Average standard deviation of split frequencies: 0.013142
370500 -- (-1095.427) [-1099.033] (-1100.320) (-1095.225) * (-1100.708) (-1099.960) [-1096.574] (-1095.675) -- 0:00:40
371000 -- [-1095.961] (-1097.487) (-1098.992) (-1097.167) * [-1097.100] (-1096.249) (-1100.294) (-1095.910) -- 0:00:40
371500 -- (-1098.675) (-1098.005) (-1098.547) [-1094.685] * (-1098.785) (-1097.772) [-1098.535] (-1095.481) -- 0:00:40
372000 -- [-1096.521] (-1098.390) (-1099.044) (-1097.659) * [-1097.523] (-1100.669) (-1095.262) (-1100.373) -- 0:00:40
372500 -- [-1097.847] (-1099.220) (-1097.791) (-1099.441) * [-1097.370] (-1099.677) (-1096.469) (-1098.379) -- 0:00:40
373000 -- [-1101.192] (-1094.720) (-1097.903) (-1097.882) * (-1094.993) (-1095.063) (-1097.383) [-1097.651] -- 0:00:40
373500 -- (-1096.771) [-1096.190] (-1097.129) (-1097.475) * (-1096.200) [-1095.412] (-1098.858) (-1099.327) -- 0:00:40
374000 -- (-1094.530) [-1097.679] (-1096.541) (-1096.977) * (-1095.186) [-1097.892] (-1098.710) (-1096.627) -- 0:00:40
374500 -- (-1095.317) (-1097.712) (-1096.554) [-1099.824] * (-1095.285) (-1099.683) (-1100.868) [-1100.045] -- 0:00:40
375000 -- (-1095.067) (-1097.650) (-1095.204) [-1097.113] * (-1095.233) (-1097.558) [-1102.139] (-1100.101) -- 0:00:40
Average standard deviation of split frequencies: 0.013512
375500 -- (-1096.366) (-1098.048) (-1095.298) [-1097.315] * (-1098.212) (-1097.142) [-1096.175] (-1097.167) -- 0:00:39
376000 -- (-1096.240) [-1098.075] (-1095.855) (-1100.845) * (-1096.244) (-1096.291) (-1095.806) [-1098.962] -- 0:00:39
376500 -- [-1097.184] (-1096.121) (-1096.255) (-1099.161) * [-1095.179] (-1094.757) (-1097.367) (-1096.809) -- 0:00:39
377000 -- [-1097.584] (-1095.520) (-1096.353) (-1095.176) * (-1095.051) (-1096.457) [-1097.442] (-1098.350) -- 0:00:39
377500 -- [-1097.436] (-1095.628) (-1096.342) (-1099.059) * (-1097.714) (-1096.173) [-1096.026] (-1097.787) -- 0:00:39
378000 -- (-1096.242) (-1096.667) (-1098.220) [-1095.905] * (-1095.181) (-1097.857) [-1098.374] (-1097.525) -- 0:00:39
378500 -- (-1096.471) [-1095.697] (-1098.743) (-1103.370) * (-1096.990) (-1100.010) (-1097.375) [-1098.448] -- 0:00:39
379000 -- (-1097.738) (-1095.965) [-1096.029] (-1101.044) * [-1096.684] (-1095.447) (-1097.915) (-1100.710) -- 0:00:39
379500 -- (-1096.340) (-1096.286) (-1098.385) [-1098.025] * (-1096.531) (-1095.302) [-1100.455] (-1098.355) -- 0:00:39
380000 -- (-1096.043) [-1096.981] (-1100.130) (-1097.756) * (-1098.020) (-1095.528) (-1100.726) [-1096.177] -- 0:00:39
Average standard deviation of split frequencies: 0.013416
380500 -- (-1100.986) (-1095.953) (-1098.071) [-1096.054] * (-1098.701) [-1094.874] (-1096.861) (-1096.958) -- 0:00:39
381000 -- (-1097.560) (-1097.028) [-1095.924] (-1095.906) * (-1097.981) [-1097.160] (-1095.768) (-1100.598) -- 0:00:38
381500 -- (-1096.329) (-1096.233) (-1096.411) [-1095.725] * [-1096.063] (-1094.593) (-1095.845) (-1098.035) -- 0:00:38
382000 -- [-1094.705] (-1095.324) (-1095.957) (-1095.033) * (-1096.447) [-1095.375] (-1096.861) (-1095.576) -- 0:00:38
382500 -- [-1096.173] (-1099.323) (-1094.715) (-1097.763) * (-1098.467) [-1095.018] (-1098.084) (-1096.946) -- 0:00:38
383000 -- (-1096.568) [-1097.622] (-1094.907) (-1098.873) * [-1098.198] (-1096.508) (-1096.874) (-1096.029) -- 0:00:38
383500 -- (-1098.522) [-1097.573] (-1100.550) (-1097.002) * (-1094.582) [-1096.163] (-1096.581) (-1098.671) -- 0:00:38
384000 -- (-1096.847) (-1096.815) (-1099.735) [-1097.367] * (-1095.004) (-1095.741) [-1096.601] (-1096.726) -- 0:00:38
384500 -- [-1097.387] (-1099.983) (-1097.060) (-1096.278) * [-1095.554] (-1104.165) (-1096.056) (-1096.425) -- 0:00:38
385000 -- (-1100.305) (-1096.534) [-1097.083] (-1097.302) * (-1097.729) (-1097.365) (-1096.984) [-1096.156] -- 0:00:39
Average standard deviation of split frequencies: 0.013162
385500 -- (-1095.827) [-1100.371] (-1095.170) (-1100.336) * (-1095.983) (-1097.258) (-1097.326) [-1096.824] -- 0:00:39
386000 -- (-1095.701) (-1102.710) [-1099.015] (-1096.808) * (-1095.415) (-1096.342) [-1097.990] (-1103.226) -- 0:00:39
386500 -- (-1095.512) (-1101.080) (-1096.813) [-1096.322] * [-1096.145] (-1096.257) (-1095.053) (-1098.720) -- 0:00:39
387000 -- (-1096.862) [-1100.268] (-1095.109) (-1096.603) * (-1096.453) (-1097.244) (-1097.106) [-1098.681] -- 0:00:39
387500 -- (-1097.637) (-1099.550) (-1097.244) [-1095.387] * (-1101.171) (-1097.075) [-1096.873] (-1096.654) -- 0:00:39
388000 -- (-1097.413) (-1097.449) (-1095.529) [-1097.268] * [-1100.798] (-1096.797) (-1098.417) (-1094.897) -- 0:00:39
388500 -- (-1095.862) (-1095.259) (-1096.497) [-1095.299] * (-1096.869) (-1095.590) (-1095.553) [-1098.026] -- 0:00:39
389000 -- [-1097.616] (-1097.046) (-1096.644) (-1095.458) * (-1096.606) (-1095.524) [-1095.765] (-1095.270) -- 0:00:39
389500 -- [-1096.304] (-1095.428) (-1098.046) (-1097.714) * [-1097.445] (-1098.295) (-1095.019) (-1094.690) -- 0:00:39
390000 -- [-1096.480] (-1099.173) (-1098.509) (-1100.606) * [-1096.610] (-1097.048) (-1095.899) (-1095.317) -- 0:00:39
Average standard deviation of split frequencies: 0.013210
390500 -- (-1097.429) (-1097.301) [-1095.356] (-1098.304) * [-1095.744] (-1095.633) (-1095.459) (-1096.794) -- 0:00:39
391000 -- (-1096.450) (-1098.764) (-1097.262) [-1099.436] * (-1095.795) (-1095.723) (-1098.034) [-1096.761] -- 0:00:38
391500 -- [-1098.381] (-1095.280) (-1097.367) (-1098.662) * [-1097.471] (-1096.044) (-1096.379) (-1099.478) -- 0:00:38
392000 -- (-1096.028) (-1095.127) [-1098.391] (-1095.328) * [-1096.615] (-1096.456) (-1095.643) (-1098.912) -- 0:00:38
392500 -- (-1097.843) (-1098.844) [-1097.519] (-1094.554) * (-1096.392) [-1098.704] (-1095.802) (-1100.448) -- 0:00:38
393000 -- (-1102.366) [-1095.562] (-1097.133) (-1098.965) * (-1095.284) (-1099.428) [-1097.028] (-1098.068) -- 0:00:38
393500 -- (-1100.450) [-1096.139] (-1099.274) (-1099.391) * (-1095.331) (-1097.636) (-1096.180) [-1095.777] -- 0:00:38
394000 -- (-1097.887) (-1099.014) [-1097.505] (-1097.228) * (-1098.075) (-1096.219) [-1097.020] (-1098.475) -- 0:00:38
394500 -- (-1097.731) [-1097.864] (-1099.258) (-1095.405) * (-1097.089) (-1098.052) [-1100.173] (-1108.135) -- 0:00:38
395000 -- [-1098.233] (-1097.063) (-1101.796) (-1095.269) * [-1096.723] (-1094.602) (-1095.914) (-1097.066) -- 0:00:38
Average standard deviation of split frequencies: 0.012907
395500 -- (-1099.041) [-1094.895] (-1095.705) (-1096.899) * (-1097.747) [-1096.077] (-1098.886) (-1100.599) -- 0:00:38
396000 -- (-1097.503) (-1097.189) [-1095.699] (-1097.129) * (-1097.243) (-1095.316) (-1097.862) [-1094.944] -- 0:00:38
396500 -- (-1100.440) [-1095.926] (-1096.295) (-1095.329) * (-1094.951) (-1100.135) (-1096.741) [-1101.941] -- 0:00:38
397000 -- (-1099.832) (-1099.679) (-1095.909) [-1095.508] * [-1096.678] (-1099.275) (-1100.765) (-1097.831) -- 0:00:37
397500 -- (-1101.425) (-1097.857) [-1095.420] (-1097.853) * (-1098.587) [-1096.715] (-1098.314) (-1100.278) -- 0:00:37
398000 -- (-1099.493) (-1095.871) [-1095.838] (-1098.847) * (-1099.473) (-1096.205) [-1097.299] (-1098.270) -- 0:00:37
398500 -- (-1095.473) (-1097.315) (-1096.803) [-1095.111] * (-1095.621) (-1097.870) [-1098.851] (-1102.968) -- 0:00:37
399000 -- [-1095.398] (-1097.112) (-1097.654) (-1098.565) * (-1096.138) (-1098.063) (-1100.327) [-1095.983] -- 0:00:37
399500 -- [-1095.157] (-1096.705) (-1096.723) (-1095.688) * (-1098.468) (-1098.028) (-1097.103) [-1096.728] -- 0:00:37
400000 -- [-1095.468] (-1095.729) (-1095.974) (-1096.023) * (-1095.572) (-1095.145) [-1100.213] (-1096.983) -- 0:00:37
Average standard deviation of split frequencies: 0.012746
400500 -- (-1102.645) (-1096.882) (-1095.329) [-1094.559] * (-1096.404) (-1096.270) [-1095.255] (-1097.332) -- 0:00:37
401000 -- (-1105.336) (-1096.401) (-1095.128) [-1096.630] * [-1096.125] (-1098.111) (-1097.569) (-1100.135) -- 0:00:38
401500 -- (-1097.296) (-1097.204) (-1097.527) [-1095.937] * (-1096.700) (-1094.782) [-1096.934] (-1098.406) -- 0:00:38
402000 -- (-1098.327) [-1097.871] (-1099.420) (-1097.627) * [-1095.191] (-1095.071) (-1097.147) (-1099.658) -- 0:00:38
402500 -- (-1095.103) [-1096.359] (-1098.380) (-1096.431) * (-1095.694) (-1095.576) [-1095.742] (-1100.135) -- 0:00:38
403000 -- [-1097.567] (-1098.840) (-1097.719) (-1096.507) * (-1096.927) (-1095.570) [-1097.256] (-1098.706) -- 0:00:38
403500 -- [-1095.947] (-1095.173) (-1096.196) (-1096.886) * (-1097.512) (-1097.950) [-1097.310] (-1101.248) -- 0:00:38
404000 -- (-1096.950) (-1096.557) (-1097.992) [-1095.974] * (-1099.887) (-1095.128) [-1096.583] (-1099.785) -- 0:00:38
404500 -- [-1097.013] (-1097.023) (-1098.916) (-1099.992) * (-1100.368) [-1096.856] (-1097.660) (-1097.274) -- 0:00:38
405000 -- [-1095.192] (-1097.262) (-1099.686) (-1098.210) * (-1098.450) [-1096.362] (-1097.946) (-1096.623) -- 0:00:38
Average standard deviation of split frequencies: 0.012579
405500 -- (-1096.052) (-1096.736) (-1098.203) [-1095.435] * [-1098.105] (-1095.999) (-1096.768) (-1097.428) -- 0:00:38
406000 -- (-1098.254) (-1094.679) (-1094.511) [-1095.453] * [-1097.087] (-1101.617) (-1095.639) (-1096.617) -- 0:00:38
406500 -- (-1104.144) (-1096.110) (-1094.511) [-1094.964] * (-1095.359) [-1102.905] (-1095.643) (-1100.693) -- 0:00:37
407000 -- (-1103.230) (-1096.599) (-1098.764) [-1094.501] * (-1097.832) (-1095.936) (-1096.696) [-1096.237] -- 0:00:37
407500 -- (-1097.912) [-1098.231] (-1095.490) (-1094.362) * (-1096.830) (-1096.824) (-1097.725) [-1095.591] -- 0:00:37
408000 -- [-1096.171] (-1096.523) (-1097.178) (-1096.394) * [-1094.535] (-1095.713) (-1095.920) (-1099.717) -- 0:00:37
408500 -- (-1096.789) (-1097.026) (-1098.550) [-1099.861] * (-1096.074) [-1096.327] (-1098.377) (-1100.587) -- 0:00:37
409000 -- (-1096.904) (-1097.972) (-1095.480) [-1102.632] * [-1097.000] (-1096.381) (-1097.107) (-1095.676) -- 0:00:37
409500 -- (-1095.388) (-1097.644) (-1095.405) [-1096.707] * (-1096.386) (-1098.118) [-1095.048] (-1095.162) -- 0:00:37
410000 -- (-1095.409) (-1099.513) (-1097.794) [-1095.927] * [-1097.189] (-1096.964) (-1095.993) (-1097.462) -- 0:00:37
Average standard deviation of split frequencies: 0.012499
410500 -- (-1097.424) [-1098.168] (-1096.578) (-1097.788) * (-1095.017) [-1098.223] (-1096.974) (-1094.755) -- 0:00:37
411000 -- (-1097.743) [-1098.276] (-1096.789) (-1096.145) * (-1094.803) (-1094.709) (-1098.157) [-1098.575] -- 0:00:37
411500 -- (-1096.607) [-1097.091] (-1097.769) (-1094.528) * (-1094.873) (-1098.902) (-1098.447) [-1094.666] -- 0:00:37
412000 -- (-1098.038) (-1100.816) [-1094.804] (-1094.855) * (-1094.727) (-1098.784) (-1097.189) [-1096.225] -- 0:00:37
412500 -- (-1101.657) (-1095.392) (-1094.935) [-1094.524] * (-1099.886) [-1095.969] (-1101.442) (-1099.279) -- 0:00:37
413000 -- (-1097.150) (-1096.426) (-1094.935) [-1094.704] * [-1099.011] (-1095.458) (-1099.598) (-1098.497) -- 0:00:36
413500 -- (-1096.987) (-1098.248) (-1097.919) [-1096.041] * (-1097.433) (-1096.395) [-1095.203] (-1096.414) -- 0:00:36
414000 -- (-1097.031) (-1097.523) (-1098.017) [-1095.609] * (-1098.238) (-1095.740) (-1095.562) [-1097.667] -- 0:00:36
414500 -- (-1097.347) [-1097.660] (-1095.757) (-1096.221) * [-1097.321] (-1097.096) (-1097.225) (-1098.949) -- 0:00:36
415000 -- (-1096.209) (-1098.344) (-1095.713) [-1095.174] * (-1099.936) [-1098.189] (-1094.748) (-1095.117) -- 0:00:36
Average standard deviation of split frequencies: 0.011465
415500 -- [-1095.150] (-1096.630) (-1095.370) (-1094.660) * [-1096.547] (-1099.431) (-1094.748) (-1098.373) -- 0:00:36
416000 -- (-1097.400) (-1102.236) (-1102.393) [-1096.366] * (-1097.400) (-1101.626) (-1096.644) [-1096.506] -- 0:00:36
416500 -- (-1097.596) (-1101.130) (-1101.205) [-1097.775] * (-1095.448) [-1101.398] (-1096.318) (-1098.038) -- 0:00:36
417000 -- [-1097.629] (-1096.500) (-1097.992) (-1097.765) * [-1096.604] (-1099.693) (-1095.962) (-1096.520) -- 0:00:36
417500 -- (-1098.382) (-1096.590) (-1106.176) [-1096.628] * (-1097.786) (-1100.257) (-1098.151) [-1096.156] -- 0:00:37
418000 -- (-1095.018) (-1096.329) [-1097.689] (-1098.516) * (-1096.580) (-1096.060) (-1101.775) [-1095.858] -- 0:00:37
418500 -- [-1095.145] (-1097.478) (-1099.336) (-1098.975) * (-1095.878) [-1095.898] (-1098.611) (-1096.860) -- 0:00:37
419000 -- (-1095.652) (-1096.957) (-1096.770) [-1097.096] * [-1097.437] (-1097.570) (-1098.718) (-1097.567) -- 0:00:37
419500 -- (-1096.800) (-1095.215) (-1097.869) [-1096.770] * (-1101.082) (-1096.785) (-1097.955) [-1094.971] -- 0:00:37
420000 -- [-1096.539] (-1096.291) (-1095.378) (-1095.039) * (-1096.675) [-1098.033] (-1097.255) (-1096.729) -- 0:00:37
Average standard deviation of split frequencies: 0.011136
420500 -- (-1097.238) (-1095.702) (-1095.284) [-1096.298] * (-1095.332) [-1094.816] (-1098.091) (-1094.830) -- 0:00:37
421000 -- (-1096.190) (-1096.304) [-1095.648] (-1095.429) * (-1094.786) (-1097.048) [-1095.775] (-1097.563) -- 0:00:37
421500 -- (-1095.079) (-1097.219) (-1097.119) [-1095.438] * (-1096.418) (-1097.455) (-1095.552) [-1097.180] -- 0:00:37
422000 -- [-1095.090] (-1102.913) (-1098.521) (-1096.173) * (-1097.648) (-1102.411) [-1095.677] (-1095.346) -- 0:00:36
422500 -- [-1094.965] (-1097.222) (-1095.245) (-1095.667) * [-1095.262] (-1099.106) (-1095.900) (-1097.752) -- 0:00:36
423000 -- (-1097.639) (-1103.100) (-1096.049) [-1097.374] * (-1096.432) [-1095.926] (-1098.191) (-1096.165) -- 0:00:36
423500 -- [-1096.351] (-1102.051) (-1095.155) (-1096.265) * (-1099.254) (-1095.663) [-1096.107] (-1096.324) -- 0:00:36
424000 -- (-1098.122) (-1100.413) [-1096.689] (-1101.217) * (-1099.925) [-1095.790] (-1097.420) (-1096.448) -- 0:00:36
424500 -- (-1097.503) (-1098.195) (-1100.158) [-1095.423] * (-1098.325) (-1098.784) (-1095.833) [-1096.141] -- 0:00:36
425000 -- (-1097.710) (-1098.507) [-1101.173] (-1096.482) * [-1096.346] (-1096.193) (-1095.420) (-1096.149) -- 0:00:36
Average standard deviation of split frequencies: 0.011326
425500 -- (-1097.091) [-1096.710] (-1095.408) (-1096.407) * [-1097.256] (-1099.316) (-1095.016) (-1096.802) -- 0:00:36
426000 -- (-1095.191) (-1096.140) [-1097.138] (-1097.084) * (-1099.236) [-1097.338] (-1099.710) (-1095.042) -- 0:00:36
426500 -- [-1096.037] (-1096.268) (-1095.913) (-1097.522) * (-1095.901) (-1094.647) [-1095.848] (-1096.442) -- 0:00:36
427000 -- (-1095.976) [-1098.765] (-1095.650) (-1095.707) * (-1099.659) (-1095.926) [-1097.057] (-1095.461) -- 0:00:36
427500 -- (-1096.667) (-1097.371) [-1094.648] (-1095.266) * (-1096.106) [-1095.887] (-1095.299) (-1094.644) -- 0:00:36
428000 -- (-1096.476) (-1097.325) (-1096.402) [-1095.549] * [-1096.064] (-1096.918) (-1095.831) (-1094.631) -- 0:00:36
428500 -- [-1096.423] (-1097.240) (-1095.042) (-1095.618) * (-1097.192) (-1099.344) (-1097.419) [-1094.648] -- 0:00:36
429000 -- (-1096.225) (-1100.365) [-1095.660] (-1097.146) * (-1100.959) [-1097.466] (-1095.591) (-1094.708) -- 0:00:35
429500 -- (-1099.063) (-1099.693) (-1095.453) [-1098.842] * (-1100.043) (-1099.752) [-1096.536] (-1098.381) -- 0:00:35
430000 -- (-1098.892) [-1095.483] (-1095.537) (-1098.863) * (-1100.579) (-1096.658) (-1095.379) [-1095.475] -- 0:00:35
Average standard deviation of split frequencies: 0.011075
430500 -- [-1096.046] (-1095.663) (-1095.627) (-1100.620) * (-1096.773) [-1095.662] (-1096.128) (-1099.645) -- 0:00:35
431000 -- (-1096.518) [-1095.172] (-1097.495) (-1097.383) * (-1096.424) [-1098.310] (-1095.626) (-1102.275) -- 0:00:35
431500 -- (-1094.919) (-1096.988) [-1096.642] (-1095.598) * [-1095.314] (-1098.195) (-1096.947) (-1101.220) -- 0:00:35
432000 -- (-1098.775) (-1097.218) [-1096.049] (-1096.550) * (-1097.381) [-1095.673] (-1098.223) (-1095.997) -- 0:00:35
432500 -- [-1096.354] (-1096.601) (-1098.075) (-1099.131) * (-1098.175) [-1096.022] (-1096.371) (-1095.774) -- 0:00:35
433000 -- [-1094.475] (-1098.820) (-1097.349) (-1096.638) * (-1096.601) [-1095.915] (-1095.198) (-1095.754) -- 0:00:35
433500 -- [-1095.733] (-1096.105) (-1102.584) (-1096.451) * (-1096.535) (-1097.471) [-1095.038] (-1096.622) -- 0:00:35
434000 -- [-1095.946] (-1099.078) (-1097.875) (-1097.572) * (-1095.326) (-1098.485) (-1095.237) [-1096.559] -- 0:00:36
434500 -- (-1096.195) (-1099.846) [-1095.363] (-1098.941) * (-1095.099) (-1097.950) [-1095.951] (-1098.484) -- 0:00:36
435000 -- (-1096.305) (-1098.680) (-1096.299) [-1094.839] * (-1094.883) (-1095.803) (-1097.141) [-1099.042] -- 0:00:36
Average standard deviation of split frequencies: 0.011639
435500 -- [-1102.625] (-1098.908) (-1096.078) (-1095.426) * [-1095.723] (-1097.655) (-1096.372) (-1098.011) -- 0:00:36
436000 -- (-1103.823) (-1097.091) [-1095.356] (-1094.860) * (-1094.703) (-1098.840) (-1097.310) [-1100.846] -- 0:00:36
436500 -- (-1104.087) [-1097.732] (-1096.215) (-1095.301) * (-1097.395) [-1097.828] (-1097.257) (-1098.658) -- 0:00:36
437000 -- (-1101.801) (-1097.019) [-1096.001] (-1097.031) * (-1098.563) (-1098.280) (-1097.406) [-1098.974] -- 0:00:36
437500 -- (-1099.205) (-1096.551) [-1095.569] (-1098.025) * [-1097.314] (-1097.389) (-1096.304) (-1097.322) -- 0:00:36
438000 -- [-1098.066] (-1100.273) (-1096.194) (-1099.397) * (-1099.498) [-1097.302] (-1096.576) (-1103.028) -- 0:00:35
438500 -- (-1097.351) (-1101.480) [-1096.736] (-1096.958) * [-1098.395] (-1096.034) (-1095.218) (-1097.948) -- 0:00:35
439000 -- [-1098.726] (-1098.106) (-1094.696) (-1096.053) * (-1098.793) (-1095.601) [-1095.237] (-1101.139) -- 0:00:35
439500 -- (-1096.325) (-1097.732) [-1095.344] (-1097.039) * (-1100.744) (-1095.830) [-1100.941] (-1096.688) -- 0:00:35
440000 -- (-1097.571) (-1096.364) (-1094.569) [-1096.980] * [-1101.231] (-1095.349) (-1098.553) (-1098.134) -- 0:00:35
Average standard deviation of split frequencies: 0.011054
440500 -- (-1101.296) (-1094.990) (-1097.346) [-1097.462] * (-1097.714) [-1095.593] (-1097.339) (-1098.478) -- 0:00:35
441000 -- (-1097.871) [-1096.843] (-1096.752) (-1097.515) * [-1094.976] (-1095.285) (-1099.648) (-1096.954) -- 0:00:35
441500 -- (-1096.673) (-1097.749) [-1097.496] (-1099.474) * (-1096.011) (-1095.870) [-1096.631] (-1099.182) -- 0:00:35
442000 -- (-1095.300) [-1099.678] (-1097.380) (-1095.425) * (-1097.643) (-1096.474) [-1096.256] (-1097.222) -- 0:00:35
442500 -- (-1095.658) (-1096.405) (-1101.182) [-1096.453] * (-1094.860) (-1095.152) [-1094.787] (-1098.095) -- 0:00:35
443000 -- [-1094.538] (-1096.478) (-1101.368) (-1095.993) * (-1095.396) (-1095.044) [-1097.376] (-1095.873) -- 0:00:35
443500 -- (-1097.406) (-1095.997) (-1100.929) [-1096.318] * (-1097.161) [-1097.783] (-1095.219) (-1102.923) -- 0:00:35
444000 -- (-1095.091) [-1097.067] (-1096.416) (-1099.255) * [-1097.007] (-1096.955) (-1099.230) (-1097.642) -- 0:00:35
444500 -- [-1096.779] (-1097.575) (-1097.481) (-1096.823) * (-1095.621) (-1099.784) (-1097.582) [-1099.147] -- 0:00:34
445000 -- (-1095.934) (-1101.170) (-1095.316) [-1098.276] * (-1097.005) (-1098.589) [-1098.250] (-1096.743) -- 0:00:34
Average standard deviation of split frequencies: 0.011957
445500 -- [-1099.711] (-1104.394) (-1096.445) (-1098.159) * [-1095.604] (-1098.550) (-1099.372) (-1095.615) -- 0:00:34
446000 -- (-1101.976) [-1098.023] (-1097.523) (-1096.934) * (-1097.503) [-1096.051] (-1096.119) (-1100.248) -- 0:00:34
446500 -- (-1097.255) (-1098.092) (-1099.261) [-1096.591] * (-1102.764) (-1095.227) (-1098.888) [-1095.443] -- 0:00:34
447000 -- (-1097.019) [-1097.286] (-1096.347) (-1095.421) * (-1100.812) (-1095.560) [-1096.827] (-1095.277) -- 0:00:34
447500 -- (-1097.808) (-1097.782) [-1097.464] (-1096.456) * (-1098.382) (-1095.902) (-1096.191) [-1096.423] -- 0:00:34
448000 -- (-1098.824) [-1098.663] (-1097.150) (-1097.561) * (-1098.443) [-1096.758] (-1097.471) (-1095.975) -- 0:00:34
448500 -- [-1097.535] (-1103.377) (-1095.560) (-1097.175) * [-1095.980] (-1096.329) (-1095.655) (-1096.788) -- 0:00:34
449000 -- [-1096.249] (-1099.018) (-1095.503) (-1094.823) * (-1095.012) [-1095.052] (-1098.147) (-1096.264) -- 0:00:34
449500 -- [-1096.862] (-1101.483) (-1097.712) (-1094.988) * (-1099.342) (-1098.783) (-1095.750) [-1097.207] -- 0:00:34
450000 -- (-1097.611) [-1096.476] (-1097.699) (-1094.987) * (-1097.340) (-1098.134) [-1097.830] (-1097.384) -- 0:00:34
Average standard deviation of split frequencies: 0.011702
450500 -- (-1094.491) (-1095.963) (-1096.558) [-1096.276] * (-1100.709) [-1097.984] (-1098.843) (-1097.188) -- 0:00:35
451000 -- [-1094.733] (-1097.119) (-1095.317) (-1096.991) * (-1104.992) [-1095.643] (-1095.818) (-1097.192) -- 0:00:35
451500 -- (-1099.687) (-1099.404) [-1094.800] (-1096.842) * (-1098.344) (-1095.743) (-1097.781) [-1095.943] -- 0:00:35
452000 -- (-1099.189) (-1097.856) (-1099.003) [-1096.104] * [-1096.241] (-1096.260) (-1096.077) (-1096.499) -- 0:00:35
452500 -- (-1098.390) [-1095.896] (-1094.874) (-1095.580) * [-1096.738] (-1095.139) (-1098.763) (-1097.203) -- 0:00:35
453000 -- (-1097.163) (-1096.769) (-1095.277) [-1099.155] * (-1095.908) [-1096.044] (-1098.082) (-1095.821) -- 0:00:35
453500 -- (-1096.503) (-1097.200) (-1102.090) [-1096.721] * [-1096.249] (-1098.002) (-1098.758) (-1097.308) -- 0:00:34
454000 -- (-1096.207) (-1095.027) [-1097.830] (-1100.107) * (-1095.892) (-1096.738) (-1097.573) [-1095.897] -- 0:00:34
454500 -- (-1096.008) (-1098.053) [-1098.344] (-1096.949) * [-1096.456] (-1097.057) (-1097.740) (-1096.681) -- 0:00:34
455000 -- [-1095.292] (-1096.566) (-1095.728) (-1096.092) * (-1097.129) (-1101.497) [-1097.570] (-1095.670) -- 0:00:34
Average standard deviation of split frequencies: 0.011441
455500 -- (-1095.653) [-1097.682] (-1097.234) (-1096.273) * [-1097.217] (-1099.424) (-1095.731) (-1095.241) -- 0:00:34
456000 -- [-1100.048] (-1096.531) (-1097.992) (-1097.040) * (-1097.535) [-1098.894] (-1096.547) (-1103.484) -- 0:00:34
456500 -- [-1097.492] (-1095.354) (-1099.615) (-1095.119) * [-1096.116] (-1099.525) (-1096.700) (-1096.164) -- 0:00:34
457000 -- (-1099.193) [-1096.345] (-1096.779) (-1097.695) * (-1097.692) (-1095.538) [-1097.699] (-1095.209) -- 0:00:34
457500 -- (-1097.028) (-1096.215) [-1096.996] (-1097.921) * [-1097.915] (-1096.089) (-1095.212) (-1100.831) -- 0:00:34
458000 -- (-1095.094) (-1096.528) [-1096.004] (-1097.315) * (-1099.070) [-1096.664] (-1095.334) (-1099.111) -- 0:00:34
458500 -- (-1098.252) (-1097.006) [-1096.273] (-1095.859) * [-1099.344] (-1096.753) (-1095.651) (-1101.046) -- 0:00:34
459000 -- [-1098.027] (-1097.386) (-1097.253) (-1097.032) * (-1097.390) (-1095.532) [-1095.343] (-1098.922) -- 0:00:34
459500 -- (-1101.404) [-1097.138] (-1096.481) (-1099.832) * (-1096.445) [-1097.532] (-1095.518) (-1095.885) -- 0:00:34
460000 -- (-1096.312) [-1095.262] (-1095.813) (-1096.676) * (-1098.494) [-1095.820] (-1099.713) (-1097.410) -- 0:00:34
Average standard deviation of split frequencies: 0.011448
460500 -- (-1096.487) [-1097.182] (-1095.654) (-1098.019) * (-1097.921) [-1094.520] (-1095.852) (-1099.043) -- 0:00:33
461000 -- (-1095.897) (-1096.000) [-1096.524] (-1100.402) * (-1096.541) (-1095.576) [-1094.924] (-1099.144) -- 0:00:33
461500 -- [-1096.818] (-1096.982) (-1095.561) (-1096.065) * (-1096.547) (-1098.605) (-1097.039) [-1096.634] -- 0:00:33
462000 -- (-1096.977) (-1098.469) [-1096.123] (-1095.818) * [-1095.491] (-1096.119) (-1096.383) (-1096.180) -- 0:00:33
462500 -- [-1099.535] (-1097.485) (-1097.161) (-1095.367) * (-1096.790) (-1095.308) [-1096.908] (-1095.799) -- 0:00:33
463000 -- (-1098.998) [-1098.460] (-1098.034) (-1097.115) * [-1097.339] (-1096.340) (-1098.175) (-1095.279) -- 0:00:33
463500 -- [-1097.430] (-1096.517) (-1097.367) (-1097.335) * [-1100.658] (-1096.759) (-1101.660) (-1099.130) -- 0:00:33
464000 -- (-1096.732) (-1098.152) (-1097.000) [-1095.621] * (-1099.196) (-1098.535) [-1100.954] (-1100.758) -- 0:00:33
464500 -- (-1096.099) (-1099.671) [-1097.376] (-1098.133) * (-1097.881) (-1097.387) [-1097.484] (-1100.961) -- 0:00:33
465000 -- (-1096.064) (-1096.324) (-1095.731) [-1098.426] * (-1100.220) [-1097.924] (-1097.142) (-1098.121) -- 0:00:33
Average standard deviation of split frequencies: 0.011697
465500 -- (-1095.511) (-1096.241) (-1094.663) [-1101.102] * (-1097.265) [-1097.439] (-1098.281) (-1099.333) -- 0:00:33
466000 -- (-1097.310) [-1095.148] (-1099.864) (-1096.345) * (-1097.409) [-1095.618] (-1096.122) (-1098.958) -- 0:00:34
466500 -- (-1094.872) (-1098.827) [-1096.545] (-1100.002) * [-1097.463] (-1097.263) (-1095.700) (-1099.723) -- 0:00:34
467000 -- (-1100.252) [-1099.465] (-1098.408) (-1101.725) * (-1096.831) (-1098.295) (-1098.472) [-1095.044] -- 0:00:34
467500 -- (-1101.268) (-1099.818) [-1096.860] (-1095.418) * [-1096.473] (-1097.883) (-1096.883) (-1098.776) -- 0:00:34
468000 -- (-1097.619) [-1097.674] (-1096.151) (-1095.836) * (-1100.020) (-1100.010) (-1096.492) [-1096.011] -- 0:00:34
468500 -- [-1097.005] (-1097.473) (-1096.101) (-1094.722) * (-1094.814) (-1096.990) [-1095.979] (-1097.070) -- 0:00:34
469000 -- [-1096.223] (-1095.769) (-1096.403) (-1094.873) * (-1099.637) (-1095.532) [-1098.339] (-1097.651) -- 0:00:33
469500 -- [-1096.284] (-1095.882) (-1096.748) (-1095.652) * [-1097.835] (-1098.383) (-1099.372) (-1094.996) -- 0:00:33
470000 -- (-1096.122) (-1100.943) [-1097.248] (-1095.978) * [-1094.995] (-1101.045) (-1099.457) (-1095.813) -- 0:00:33
Average standard deviation of split frequencies: 0.010642
470500 -- [-1096.160] (-1098.347) (-1096.650) (-1099.796) * (-1096.457) (-1100.408) (-1096.022) [-1097.047] -- 0:00:33
471000 -- (-1099.053) (-1096.821) [-1098.115] (-1095.394) * [-1095.842] (-1095.408) (-1097.871) (-1096.953) -- 0:00:33
471500 -- (-1097.412) (-1096.217) [-1097.181] (-1098.038) * (-1095.732) [-1102.259] (-1095.190) (-1098.932) -- 0:00:33
472000 -- [-1095.414] (-1096.875) (-1095.085) (-1102.524) * (-1094.923) (-1097.945) [-1095.522] (-1098.832) -- 0:00:33
472500 -- [-1097.166] (-1098.945) (-1095.701) (-1099.459) * [-1101.459] (-1097.161) (-1096.077) (-1097.114) -- 0:00:33
473000 -- [-1095.725] (-1097.150) (-1096.297) (-1094.726) * [-1095.586] (-1097.343) (-1096.181) (-1098.011) -- 0:00:33
473500 -- (-1096.223) [-1097.134] (-1097.079) (-1095.582) * [-1099.144] (-1098.441) (-1097.177) (-1096.201) -- 0:00:33
474000 -- (-1096.402) [-1097.209] (-1097.984) (-1094.651) * (-1101.612) (-1097.068) [-1097.551] (-1096.143) -- 0:00:33
474500 -- (-1098.259) (-1097.178) [-1096.354] (-1095.360) * [-1101.272] (-1098.188) (-1100.145) (-1095.050) -- 0:00:33
475000 -- (-1098.714) [-1103.801] (-1098.201) (-1095.560) * [-1097.681] (-1097.039) (-1096.174) (-1099.600) -- 0:00:33
Average standard deviation of split frequencies: 0.010522
475500 -- [-1095.305] (-1094.678) (-1097.347) (-1098.892) * [-1095.852] (-1096.971) (-1096.785) (-1096.835) -- 0:00:33
476000 -- (-1096.061) [-1097.425] (-1096.533) (-1097.989) * [-1095.623] (-1097.413) (-1098.734) (-1096.584) -- 0:00:33
476500 -- (-1096.048) (-1095.073) (-1095.502) [-1095.362] * [-1096.113] (-1097.813) (-1096.818) (-1098.906) -- 0:00:32
477000 -- (-1097.062) (-1099.135) (-1097.460) [-1096.505] * (-1096.773) (-1097.509) (-1097.531) [-1095.463] -- 0:00:32
477500 -- (-1096.513) (-1098.897) (-1098.168) [-1099.169] * (-1097.547) (-1099.441) [-1096.947] (-1099.887) -- 0:00:32
478000 -- (-1096.269) (-1096.891) (-1095.296) [-1097.264] * [-1095.128] (-1097.074) (-1095.553) (-1095.909) -- 0:00:32
478500 -- (-1095.622) [-1095.583] (-1099.893) (-1100.805) * (-1099.905) (-1096.658) (-1097.103) [-1098.865] -- 0:00:32
479000 -- (-1095.003) (-1094.924) (-1096.498) [-1098.289] * (-1097.562) [-1095.749] (-1095.535) (-1097.586) -- 0:00:32
479500 -- (-1101.587) (-1097.193) (-1095.786) [-1097.844] * (-1096.681) [-1097.613] (-1096.425) (-1098.151) -- 0:00:32
480000 -- (-1102.453) [-1099.400] (-1100.199) (-1099.799) * [-1095.780] (-1098.751) (-1097.367) (-1099.520) -- 0:00:32
Average standard deviation of split frequencies: 0.010298
480500 -- (-1101.788) (-1094.385) (-1106.128) [-1095.758] * (-1095.339) (-1100.173) (-1099.050) [-1096.401] -- 0:00:33
481000 -- (-1100.420) (-1097.702) [-1098.483] (-1096.877) * [-1095.481] (-1096.002) (-1096.655) (-1097.526) -- 0:00:33
481500 -- [-1099.136] (-1095.672) (-1098.446) (-1095.715) * (-1095.888) [-1095.822] (-1100.645) (-1098.767) -- 0:00:33
482000 -- [-1096.604] (-1094.602) (-1095.779) (-1096.339) * (-1098.897) (-1098.637) [-1096.905] (-1098.457) -- 0:00:33
482500 -- (-1095.048) (-1099.148) (-1099.083) [-1098.678] * (-1096.520) (-1098.300) (-1097.124) [-1096.451] -- 0:00:33
483000 -- (-1097.381) (-1101.505) [-1097.357] (-1102.908) * (-1097.676) [-1097.035] (-1095.518) (-1098.745) -- 0:00:33
483500 -- (-1096.110) (-1097.381) (-1097.329) [-1097.505] * (-1094.776) (-1098.091) [-1095.939] (-1095.186) -- 0:00:33
484000 -- [-1095.540] (-1095.908) (-1097.147) (-1101.765) * (-1094.343) [-1095.731] (-1098.906) (-1096.670) -- 0:00:33
484500 -- [-1096.626] (-1097.422) (-1096.862) (-1101.111) * [-1098.079] (-1096.544) (-1098.008) (-1096.709) -- 0:00:32
485000 -- (-1096.624) (-1097.285) (-1095.664) [-1097.329] * (-1095.750) (-1094.865) [-1097.016] (-1095.231) -- 0:00:32
Average standard deviation of split frequencies: 0.010152
485500 -- (-1096.944) (-1097.347) [-1097.539] (-1098.570) * (-1097.462) [-1095.034] (-1098.129) (-1097.967) -- 0:00:32
486000 -- (-1098.689) (-1096.694) [-1097.703] (-1098.402) * (-1096.178) [-1096.627] (-1097.460) (-1097.286) -- 0:00:32
486500 -- [-1094.882] (-1096.230) (-1097.648) (-1097.072) * (-1096.503) (-1095.344) [-1099.175] (-1103.011) -- 0:00:32
487000 -- (-1095.965) (-1096.693) (-1099.377) [-1095.818] * (-1098.704) (-1094.985) (-1097.682) [-1095.335] -- 0:00:32
487500 -- (-1096.506) (-1100.213) (-1095.840) [-1097.823] * (-1097.459) [-1095.206] (-1100.445) (-1094.935) -- 0:00:32
488000 -- (-1097.122) [-1096.879] (-1094.613) (-1099.575) * [-1095.885] (-1098.772) (-1106.742) (-1095.320) -- 0:00:32
488500 -- (-1097.806) (-1094.707) [-1094.740] (-1098.055) * (-1097.303) [-1098.679] (-1100.881) (-1099.753) -- 0:00:32
489000 -- [-1098.310] (-1095.065) (-1094.776) (-1099.133) * (-1096.083) (-1095.518) (-1096.366) [-1098.933] -- 0:00:32
489500 -- [-1097.830] (-1097.332) (-1095.287) (-1095.998) * (-1096.664) [-1096.747] (-1100.139) (-1095.084) -- 0:00:32
490000 -- (-1095.979) [-1097.200] (-1097.830) (-1096.491) * (-1095.807) (-1095.875) (-1095.353) [-1096.674] -- 0:00:32
Average standard deviation of split frequencies: 0.009287
490500 -- (-1096.163) [-1098.616] (-1097.899) (-1097.331) * (-1094.579) [-1099.143] (-1096.837) (-1096.619) -- 0:00:32
491000 -- (-1096.502) [-1097.382] (-1098.398) (-1098.382) * (-1094.420) (-1095.736) [-1096.574] (-1097.028) -- 0:00:32
491500 -- (-1098.050) (-1096.596) [-1097.401] (-1095.118) * (-1096.471) (-1096.345) [-1097.297] (-1096.278) -- 0:00:32
492000 -- (-1095.629) (-1098.345) [-1097.785] (-1096.109) * [-1094.456] (-1096.678) (-1095.198) (-1095.165) -- 0:00:32
492500 -- (-1102.023) (-1097.058) (-1096.494) [-1095.747] * [-1095.836] (-1095.806) (-1095.655) (-1095.418) -- 0:00:31
493000 -- (-1098.350) (-1095.305) [-1096.423] (-1097.568) * (-1096.281) (-1095.893) (-1096.917) [-1097.102] -- 0:00:31
493500 -- [-1096.895] (-1095.218) (-1095.620) (-1097.627) * (-1096.714) [-1097.209] (-1096.438) (-1097.296) -- 0:00:31
494000 -- [-1097.254] (-1096.244) (-1096.678) (-1096.926) * (-1097.747) (-1098.735) [-1098.767] (-1095.425) -- 0:00:31
494500 -- [-1095.721] (-1096.651) (-1096.661) (-1102.782) * (-1098.290) [-1095.925] (-1100.036) (-1095.747) -- 0:00:31
495000 -- [-1095.979] (-1097.357) (-1100.259) (-1095.791) * [-1098.147] (-1098.693) (-1098.082) (-1099.080) -- 0:00:32
Average standard deviation of split frequencies: 0.010098
495500 -- (-1097.170) (-1099.848) [-1095.560] (-1095.872) * (-1097.235) [-1097.296] (-1098.139) (-1097.000) -- 0:00:32
496000 -- (-1095.702) (-1099.242) (-1096.866) [-1095.075] * (-1098.272) [-1099.952] (-1094.578) (-1094.626) -- 0:00:32
496500 -- (-1094.539) [-1095.541] (-1098.805) (-1096.163) * (-1096.062) (-1099.322) (-1094.910) [-1095.887] -- 0:00:32
497000 -- (-1094.536) (-1096.647) [-1096.027] (-1098.250) * [-1095.875] (-1100.153) (-1095.496) (-1096.069) -- 0:00:32
497500 -- (-1094.723) (-1098.382) [-1094.977] (-1097.476) * [-1096.530] (-1096.661) (-1095.296) (-1095.029) -- 0:00:32
498000 -- (-1098.656) [-1095.600] (-1094.848) (-1097.851) * [-1096.546] (-1095.014) (-1098.567) (-1100.218) -- 0:00:32
498500 -- (-1098.649) [-1096.492] (-1096.014) (-1098.334) * [-1094.719] (-1095.484) (-1097.361) (-1096.947) -- 0:00:32
499000 -- (-1096.863) (-1096.492) (-1101.697) [-1096.570] * [-1097.720] (-1096.212) (-1095.792) (-1096.711) -- 0:00:32
499500 -- (-1097.125) [-1096.273] (-1100.088) (-1095.757) * [-1096.487] (-1097.027) (-1095.860) (-1096.010) -- 0:00:32
500000 -- (-1099.015) (-1095.715) (-1100.413) [-1095.836] * (-1100.786) (-1095.255) (-1096.135) [-1098.054] -- 0:00:32
Average standard deviation of split frequencies: 0.009416
500500 -- [-1097.920] (-1096.536) (-1098.234) (-1095.987) * (-1095.215) (-1094.795) [-1095.758] (-1098.415) -- 0:00:31
501000 -- (-1096.964) [-1096.480] (-1096.254) (-1095.704) * (-1095.596) (-1096.290) (-1095.793) [-1097.727] -- 0:00:31
501500 -- (-1098.342) (-1096.384) [-1096.918] (-1094.916) * [-1097.152] (-1098.475) (-1095.677) (-1096.932) -- 0:00:31
502000 -- (-1097.268) [-1095.957] (-1096.534) (-1095.084) * (-1098.438) (-1096.417) [-1096.646] (-1102.674) -- 0:00:31
502500 -- [-1099.988] (-1096.829) (-1096.486) (-1096.957) * (-1095.790) (-1098.301) [-1094.430] (-1097.691) -- 0:00:31
503000 -- (-1101.511) [-1095.724] (-1095.783) (-1095.009) * (-1097.287) (-1099.100) [-1094.394] (-1095.893) -- 0:00:31
503500 -- (-1095.485) [-1095.291] (-1098.089) (-1099.430) * [-1097.178] (-1098.959) (-1095.418) (-1097.428) -- 0:00:31
504000 -- (-1099.640) (-1095.908) (-1097.172) [-1095.457] * (-1096.386) (-1096.412) [-1095.718] (-1096.554) -- 0:00:31
504500 -- (-1096.628) (-1095.218) (-1095.592) [-1094.966] * (-1096.406) (-1097.926) [-1096.020] (-1098.547) -- 0:00:31
505000 -- (-1098.067) (-1096.018) (-1103.445) [-1095.834] * (-1095.252) (-1096.082) [-1099.175] (-1096.846) -- 0:00:31
Average standard deviation of split frequencies: 0.009666
505500 -- (-1098.811) (-1095.614) (-1101.585) [-1098.554] * (-1097.710) (-1096.178) [-1094.876] (-1095.965) -- 0:00:31
506000 -- (-1095.994) (-1097.176) [-1097.088] (-1095.899) * (-1096.789) [-1094.697] (-1095.193) (-1096.024) -- 0:00:31
506500 -- (-1098.700) [-1097.415] (-1096.294) (-1095.181) * (-1097.227) (-1094.785) (-1096.190) [-1096.101] -- 0:00:31
507000 -- [-1097.746] (-1097.086) (-1095.321) (-1094.612) * [-1095.601] (-1095.898) (-1096.152) (-1095.557) -- 0:00:31
507500 -- (-1096.793) (-1096.093) [-1097.133] (-1095.353) * (-1097.195) (-1096.377) [-1095.766] (-1095.472) -- 0:00:31
508000 -- (-1096.740) (-1098.386) [-1096.485] (-1096.485) * (-1098.553) [-1094.799] (-1099.915) (-1096.109) -- 0:00:30
508500 -- [-1098.122] (-1095.045) (-1096.451) (-1096.190) * [-1096.291] (-1098.208) (-1097.541) (-1098.174) -- 0:00:30
509000 -- (-1095.221) (-1097.563) (-1097.308) [-1095.759] * (-1096.725) (-1098.519) (-1099.898) [-1096.570] -- 0:00:30
509500 -- (-1098.737) [-1097.407] (-1098.622) (-1095.171) * (-1097.806) [-1099.233] (-1096.877) (-1096.249) -- 0:00:30
510000 -- [-1094.452] (-1095.233) (-1097.158) (-1095.504) * (-1099.730) (-1096.798) [-1096.005] (-1099.611) -- 0:00:31
Average standard deviation of split frequencies: 0.009503
510500 -- [-1095.031] (-1099.054) (-1100.204) (-1097.375) * (-1099.229) [-1096.401] (-1097.314) (-1097.458) -- 0:00:31
511000 -- (-1097.321) (-1096.661) (-1096.762) [-1096.146] * (-1098.936) (-1095.608) [-1096.451] (-1096.330) -- 0:00:31
511500 -- (-1101.623) (-1096.795) (-1095.406) [-1100.190] * (-1101.721) (-1095.777) [-1098.533] (-1096.256) -- 0:00:31
512000 -- [-1096.741] (-1099.782) (-1094.853) (-1095.712) * (-1096.868) (-1102.077) (-1096.747) [-1095.562] -- 0:00:31
512500 -- (-1095.845) (-1100.226) (-1096.527) [-1095.596] * (-1097.705) (-1096.762) [-1095.656] (-1101.531) -- 0:00:31
513000 -- (-1096.753) (-1097.048) (-1097.091) [-1097.181] * [-1104.619] (-1096.685) (-1097.794) (-1098.112) -- 0:00:31
513500 -- (-1097.139) [-1097.260] (-1098.078) (-1096.634) * (-1099.501) [-1095.020] (-1095.844) (-1096.159) -- 0:00:31
514000 -- (-1103.913) (-1096.541) (-1096.254) [-1095.997] * (-1096.940) (-1095.160) (-1096.129) [-1096.289] -- 0:00:31
514500 -- [-1098.428] (-1096.620) (-1100.813) (-1100.012) * [-1095.337] (-1097.047) (-1094.905) (-1096.148) -- 0:00:31
515000 -- (-1100.574) [-1096.764] (-1096.661) (-1096.965) * [-1096.101] (-1096.756) (-1099.420) (-1097.035) -- 0:00:31
Average standard deviation of split frequencies: 0.009764
515500 -- [-1098.749] (-1099.450) (-1101.090) (-1096.773) * (-1100.352) [-1097.571] (-1098.550) (-1096.517) -- 0:00:31
516000 -- (-1097.651) [-1095.765] (-1096.430) (-1095.728) * [-1097.054] (-1098.207) (-1096.436) (-1096.571) -- 0:00:30
516500 -- (-1095.383) (-1097.164) [-1096.414] (-1096.422) * (-1098.890) (-1096.462) [-1096.568] (-1096.061) -- 0:00:30
517000 -- (-1097.498) (-1097.268) [-1095.861] (-1097.539) * (-1097.175) [-1097.634] (-1096.516) (-1096.702) -- 0:00:30
517500 -- [-1095.862] (-1095.112) (-1097.422) (-1098.057) * (-1096.968) (-1099.692) (-1094.792) [-1094.892] -- 0:00:30
518000 -- (-1095.634) [-1095.104] (-1094.650) (-1099.663) * [-1096.633] (-1095.318) (-1095.751) (-1097.809) -- 0:00:30
518500 -- (-1095.286) [-1096.453] (-1094.801) (-1099.749) * (-1100.119) (-1095.396) [-1098.049] (-1095.594) -- 0:00:30
519000 -- (-1095.503) [-1095.887] (-1095.054) (-1096.930) * (-1096.053) (-1098.806) (-1102.080) [-1097.181] -- 0:00:30
519500 -- [-1095.257] (-1096.947) (-1099.832) (-1097.248) * [-1097.657] (-1100.057) (-1099.628) (-1097.345) -- 0:00:30
520000 -- (-1096.834) (-1096.544) (-1096.391) [-1096.328] * [-1095.894] (-1098.974) (-1099.205) (-1096.733) -- 0:00:30
Average standard deviation of split frequencies: 0.009799
520500 -- (-1097.931) (-1095.580) [-1096.289] (-1099.344) * [-1099.506] (-1098.788) (-1097.772) (-1095.514) -- 0:00:30
521000 -- (-1097.648) (-1097.248) (-1096.293) [-1099.094] * [-1096.097] (-1101.879) (-1095.414) (-1097.529) -- 0:00:30
521500 -- (-1099.032) [-1098.291] (-1095.285) (-1097.731) * (-1098.174) (-1099.906) [-1094.853] (-1096.333) -- 0:00:30
522000 -- (-1099.270) [-1100.189] (-1095.071) (-1095.030) * (-1095.849) (-1099.316) [-1094.814] (-1096.817) -- 0:00:30
522500 -- [-1097.403] (-1098.091) (-1095.680) (-1097.475) * [-1095.791] (-1098.698) (-1097.118) (-1097.842) -- 0:00:30
523000 -- (-1095.902) [-1095.464] (-1096.416) (-1097.532) * (-1095.738) [-1095.224] (-1095.666) (-1098.885) -- 0:00:30
523500 -- (-1096.275) (-1095.171) (-1096.227) [-1097.089] * (-1096.483) [-1098.321] (-1098.156) (-1095.791) -- 0:00:30
524000 -- (-1096.178) [-1094.799] (-1095.898) (-1096.661) * (-1098.461) (-1095.234) (-1096.422) [-1096.230] -- 0:00:29
524500 -- [-1096.373] (-1097.987) (-1095.748) (-1095.330) * (-1100.112) (-1098.990) (-1096.824) [-1097.108] -- 0:00:29
525000 -- (-1097.418) (-1096.938) [-1095.986] (-1095.867) * (-1094.706) (-1096.763) (-1095.677) [-1096.680] -- 0:00:29
Average standard deviation of split frequencies: 0.010306
525500 -- (-1097.387) (-1096.831) [-1101.689] (-1096.213) * (-1095.337) (-1095.638) (-1095.374) [-1095.847] -- 0:00:29
526000 -- (-1096.752) [-1096.738] (-1099.341) (-1097.898) * (-1098.544) (-1097.351) [-1095.784] (-1096.170) -- 0:00:29
526500 -- (-1095.901) (-1096.035) (-1094.555) [-1097.153] * (-1097.920) [-1097.293] (-1095.066) (-1098.785) -- 0:00:30
527000 -- (-1096.384) [-1096.094] (-1096.113) (-1099.973) * (-1098.368) (-1095.783) (-1095.393) [-1097.528] -- 0:00:30
527500 -- (-1097.954) (-1094.692) (-1096.866) [-1099.587] * (-1097.776) (-1101.042) (-1096.149) [-1098.564] -- 0:00:30
528000 -- (-1096.907) (-1095.650) [-1096.246] (-1101.771) * (-1097.513) (-1096.553) (-1096.794) [-1096.654] -- 0:00:30
528500 -- (-1098.050) [-1095.413] (-1099.314) (-1099.007) * [-1096.412] (-1096.703) (-1099.236) (-1096.570) -- 0:00:30
529000 -- (-1102.935) (-1095.354) [-1098.224] (-1097.159) * (-1097.796) [-1095.275] (-1096.398) (-1095.757) -- 0:00:30
529500 -- (-1098.366) (-1095.354) (-1096.006) [-1096.522] * (-1098.707) (-1097.112) [-1096.199] (-1098.440) -- 0:00:30
530000 -- [-1098.271] (-1100.246) (-1095.908) (-1097.007) * [-1097.187] (-1099.289) (-1096.331) (-1095.128) -- 0:00:30
Average standard deviation of split frequencies: 0.009827
530500 -- (-1102.280) [-1096.939] (-1103.383) (-1100.319) * [-1095.248] (-1096.895) (-1101.540) (-1095.781) -- 0:00:30
531000 -- (-1095.526) (-1094.845) [-1097.710] (-1097.957) * (-1098.352) [-1096.640] (-1096.494) (-1099.200) -- 0:00:30
531500 -- (-1095.945) (-1099.801) [-1096.896] (-1098.181) * (-1100.160) [-1097.719] (-1094.529) (-1100.346) -- 0:00:29
532000 -- (-1098.262) [-1098.546] (-1100.710) (-1101.996) * [-1094.647] (-1098.127) (-1101.101) (-1095.439) -- 0:00:29
532500 -- (-1096.184) (-1100.630) [-1097.281] (-1099.441) * [-1095.983] (-1098.087) (-1101.030) (-1099.278) -- 0:00:29
533000 -- (-1096.520) [-1096.905] (-1101.100) (-1096.509) * (-1095.982) (-1096.435) [-1095.877] (-1097.421) -- 0:00:29
533500 -- (-1097.128) (-1097.892) (-1097.580) [-1095.284] * (-1097.893) (-1096.210) (-1099.868) [-1096.275] -- 0:00:29
534000 -- (-1095.893) (-1098.778) [-1097.252] (-1095.725) * (-1099.269) (-1097.453) [-1095.811] (-1095.803) -- 0:00:29
534500 -- (-1095.354) [-1098.702] (-1097.101) (-1095.717) * [-1097.250] (-1095.465) (-1099.587) (-1096.889) -- 0:00:29
535000 -- [-1095.996] (-1098.068) (-1100.787) (-1099.228) * [-1097.969] (-1095.936) (-1096.456) (-1096.438) -- 0:00:29
Average standard deviation of split frequencies: 0.009729
535500 -- (-1095.872) (-1095.982) (-1100.964) [-1098.729] * (-1098.270) [-1097.856] (-1099.362) (-1099.071) -- 0:00:29
536000 -- (-1097.387) [-1094.775] (-1099.436) (-1096.639) * (-1099.110) [-1095.534] (-1100.703) (-1104.335) -- 0:00:29
536500 -- (-1098.243) (-1094.675) [-1096.176] (-1095.492) * [-1094.605] (-1096.499) (-1100.146) (-1097.347) -- 0:00:29
537000 -- (-1100.168) (-1096.750) [-1096.737] (-1097.378) * (-1097.533) (-1096.428) (-1096.808) [-1096.344] -- 0:00:29
537500 -- [-1097.541] (-1097.780) (-1100.174) (-1096.894) * [-1096.757] (-1099.756) (-1095.455) (-1095.697) -- 0:00:29
538000 -- (-1095.690) [-1096.696] (-1102.112) (-1098.492) * (-1096.450) (-1095.951) [-1095.186] (-1095.964) -- 0:00:29
538500 -- [-1095.648] (-1096.976) (-1098.044) (-1094.842) * (-1095.193) [-1095.298] (-1094.783) (-1096.421) -- 0:00:29
539000 -- (-1096.060) (-1099.769) (-1098.038) [-1095.941] * (-1095.092) (-1095.236) (-1099.007) [-1095.941] -- 0:00:29
539500 -- [-1095.238] (-1095.618) (-1099.764) (-1096.072) * (-1094.999) (-1096.731) (-1096.237) [-1096.274] -- 0:00:29
540000 -- (-1094.578) (-1100.164) (-1095.048) [-1095.855] * (-1096.269) [-1099.336] (-1095.156) (-1094.796) -- 0:00:28
Average standard deviation of split frequencies: 0.009863
540500 -- [-1101.356] (-1095.959) (-1095.331) (-1094.558) * [-1095.328] (-1097.347) (-1096.833) (-1097.235) -- 0:00:28
541000 -- (-1095.831) (-1095.148) (-1097.271) [-1094.593] * [-1094.589] (-1098.824) (-1095.615) (-1097.212) -- 0:00:28
541500 -- (-1095.761) (-1095.150) [-1094.953] (-1097.373) * (-1096.217) (-1098.876) [-1094.799] (-1094.956) -- 0:00:28
542000 -- (-1095.809) (-1097.358) [-1095.690] (-1096.621) * (-1097.475) (-1095.145) (-1095.428) [-1097.392] -- 0:00:28
542500 -- [-1097.764] (-1097.730) (-1101.081) (-1094.875) * [-1097.347] (-1095.209) (-1101.138) (-1096.128) -- 0:00:28
543000 -- (-1100.699) (-1098.669) [-1099.054] (-1097.235) * [-1097.268] (-1097.947) (-1096.014) (-1098.532) -- 0:00:29
543500 -- (-1097.750) [-1096.169] (-1096.978) (-1097.273) * (-1100.636) [-1101.636] (-1097.016) (-1095.876) -- 0:00:29
544000 -- (-1095.705) (-1096.309) [-1098.099] (-1096.714) * [-1097.575] (-1096.574) (-1100.218) (-1099.857) -- 0:00:29
544500 -- (-1098.857) (-1095.550) [-1096.462] (-1097.200) * [-1095.315] (-1096.435) (-1097.855) (-1098.561) -- 0:00:29
545000 -- (-1100.316) [-1098.389] (-1096.642) (-1095.443) * (-1101.872) (-1096.614) [-1095.149] (-1100.012) -- 0:00:29
Average standard deviation of split frequencies: 0.009605
545500 -- (-1098.871) (-1097.769) (-1097.082) [-1098.839] * (-1098.512) [-1094.387] (-1096.004) (-1096.749) -- 0:00:29
546000 -- (-1096.333) [-1097.501] (-1097.181) (-1095.833) * (-1095.623) (-1101.711) (-1097.297) [-1097.101] -- 0:00:29
546500 -- (-1095.791) [-1095.073] (-1095.714) (-1096.680) * [-1095.670] (-1097.195) (-1096.115) (-1095.865) -- 0:00:29
547000 -- (-1096.198) [-1095.258] (-1098.044) (-1098.670) * [-1094.737] (-1097.928) (-1095.301) (-1096.070) -- 0:00:28
547500 -- [-1095.719] (-1097.079) (-1099.631) (-1097.721) * (-1099.874) (-1098.548) (-1098.001) [-1095.851] -- 0:00:28
548000 -- (-1096.026) (-1096.050) [-1099.151] (-1100.239) * (-1101.378) (-1097.205) [-1094.892] (-1095.674) -- 0:00:28
548500 -- (-1094.701) (-1096.977) (-1098.370) [-1096.724] * (-1101.450) (-1096.412) [-1097.267] (-1096.011) -- 0:00:28
549000 -- (-1095.495) (-1095.994) (-1097.698) [-1098.613] * (-1101.261) (-1096.689) [-1095.030] (-1098.369) -- 0:00:28
549500 -- (-1097.981) (-1101.760) [-1094.631] (-1094.748) * [-1100.662] (-1096.769) (-1097.784) (-1099.423) -- 0:00:28
550000 -- (-1095.944) (-1096.207) (-1094.965) [-1095.241] * [-1098.835] (-1098.121) (-1097.554) (-1097.153) -- 0:00:28
Average standard deviation of split frequencies: 0.009316
550500 -- (-1095.601) (-1095.884) (-1095.331) [-1096.129] * (-1095.784) (-1094.983) (-1099.776) [-1096.007] -- 0:00:28
551000 -- (-1099.526) (-1094.565) [-1095.947] (-1095.717) * (-1098.259) (-1095.101) (-1096.321) [-1097.765] -- 0:00:28
551500 -- (-1099.979) (-1096.809) [-1096.423] (-1095.615) * (-1100.652) (-1097.467) (-1096.412) [-1096.227] -- 0:00:28
552000 -- [-1096.830] (-1097.905) (-1096.125) (-1098.382) * (-1099.067) [-1096.751] (-1097.495) (-1100.863) -- 0:00:28
552500 -- (-1097.554) [-1096.867] (-1100.588) (-1102.675) * (-1098.144) [-1096.227] (-1099.011) (-1098.437) -- 0:00:28
553000 -- [-1095.182] (-1100.083) (-1100.763) (-1099.025) * (-1098.235) [-1095.644] (-1095.315) (-1098.386) -- 0:00:28
553500 -- (-1097.715) (-1099.675) [-1098.794] (-1099.871) * (-1096.586) [-1095.241] (-1100.024) (-1096.072) -- 0:00:28
554000 -- [-1095.567] (-1095.904) (-1097.255) (-1096.498) * (-1095.832) (-1097.465) (-1097.682) [-1095.492] -- 0:00:28
554500 -- (-1094.894) (-1097.908) [-1095.816] (-1099.270) * [-1096.094] (-1096.840) (-1096.121) (-1096.887) -- 0:00:28
555000 -- (-1095.182) [-1096.432] (-1094.978) (-1099.589) * (-1095.741) (-1097.671) [-1096.529] (-1096.045) -- 0:00:28
Average standard deviation of split frequencies: 0.009426
555500 -- (-1096.657) (-1099.163) (-1096.691) [-1098.469] * [-1098.898] (-1096.793) (-1095.845) (-1098.435) -- 0:00:28
556000 -- (-1095.523) [-1096.209] (-1095.271) (-1099.110) * (-1100.968) (-1097.766) [-1095.226] (-1095.473) -- 0:00:27
556500 -- [-1095.738] (-1098.129) (-1095.253) (-1096.567) * [-1099.887] (-1098.388) (-1097.997) (-1096.003) -- 0:00:27
557000 -- (-1096.093) (-1096.532) (-1095.831) [-1095.933] * (-1094.822) (-1100.664) [-1097.392] (-1095.395) -- 0:00:27
557500 -- (-1098.904) [-1097.586] (-1097.484) (-1102.519) * (-1095.129) (-1100.794) [-1095.392] (-1095.665) -- 0:00:27
558000 -- (-1100.260) [-1096.146] (-1098.686) (-1100.700) * (-1096.013) [-1096.971] (-1096.076) (-1095.599) -- 0:00:27
558500 -- (-1100.422) [-1098.592] (-1095.562) (-1100.808) * (-1095.706) [-1096.731] (-1095.649) (-1094.879) -- 0:00:27
559000 -- (-1096.998) [-1097.834] (-1098.321) (-1101.652) * [-1098.111] (-1096.267) (-1095.568) (-1096.949) -- 0:00:28
559500 -- [-1095.568] (-1095.455) (-1095.824) (-1097.605) * (-1096.321) (-1096.106) (-1098.300) [-1096.417] -- 0:00:28
560000 -- [-1098.214] (-1096.799) (-1096.002) (-1097.797) * (-1097.698) (-1095.097) [-1096.270] (-1095.812) -- 0:00:28
Average standard deviation of split frequencies: 0.008688
560500 -- (-1100.678) [-1095.027] (-1099.699) (-1097.573) * (-1095.352) (-1097.421) [-1097.947] (-1098.480) -- 0:00:28
561000 -- (-1100.440) [-1095.088] (-1097.302) (-1098.721) * (-1096.697) [-1095.256] (-1095.841) (-1100.457) -- 0:00:28
561500 -- (-1103.583) (-1098.377) (-1096.094) [-1099.229] * (-1095.795) [-1095.400] (-1097.160) (-1101.229) -- 0:00:28
562000 -- [-1100.146] (-1096.021) (-1097.189) (-1097.405) * [-1096.249] (-1095.148) (-1097.321) (-1098.132) -- 0:00:28
562500 -- (-1096.634) [-1096.157] (-1095.875) (-1097.698) * [-1095.455] (-1096.164) (-1099.296) (-1095.861) -- 0:00:28
563000 -- (-1095.961) [-1097.121] (-1095.265) (-1097.229) * (-1095.035) [-1095.149] (-1096.366) (-1096.177) -- 0:00:27
563500 -- (-1096.129) [-1096.037] (-1100.599) (-1097.153) * (-1095.510) [-1095.579] (-1096.103) (-1097.608) -- 0:00:27
564000 -- (-1095.966) (-1095.338) (-1099.587) [-1096.805] * (-1095.471) (-1098.216) [-1097.341] (-1099.843) -- 0:00:27
564500 -- (-1097.649) (-1097.262) [-1099.745] (-1099.603) * [-1095.075] (-1097.135) (-1097.999) (-1099.477) -- 0:00:27
565000 -- (-1096.451) [-1097.567] (-1097.309) (-1097.567) * [-1096.963] (-1097.980) (-1102.095) (-1099.548) -- 0:00:27
Average standard deviation of split frequencies: 0.009266
565500 -- (-1096.704) (-1098.121) (-1099.003) [-1095.492] * (-1096.209) (-1095.722) (-1097.738) [-1095.638] -- 0:00:27
566000 -- (-1100.565) (-1095.181) (-1095.699) [-1095.993] * (-1095.520) [-1096.200] (-1095.221) (-1098.268) -- 0:00:27
566500 -- (-1099.997) [-1095.740] (-1097.096) (-1095.816) * (-1096.741) (-1095.230) [-1094.875] (-1096.829) -- 0:00:27
567000 -- [-1096.462] (-1097.698) (-1096.196) (-1098.658) * (-1095.943) (-1095.359) (-1095.971) [-1096.420] -- 0:00:27
567500 -- (-1095.285) (-1104.214) [-1098.644] (-1101.589) * (-1094.781) (-1097.768) (-1096.590) [-1095.012] -- 0:00:27
568000 -- (-1095.868) (-1097.219) (-1095.253) [-1103.905] * [-1095.517] (-1097.350) (-1098.948) (-1098.284) -- 0:00:27
568500 -- (-1097.818) [-1098.240] (-1095.601) (-1099.073) * (-1095.328) (-1100.808) (-1097.905) [-1096.111] -- 0:00:27
569000 -- [-1097.485] (-1095.924) (-1097.372) (-1102.479) * [-1094.958] (-1097.729) (-1097.403) (-1095.428) -- 0:00:27
569500 -- (-1097.359) (-1097.487) [-1094.863] (-1098.700) * (-1096.150) (-1098.321) [-1097.413] (-1095.253) -- 0:00:27
570000 -- (-1099.880) [-1096.281] (-1095.718) (-1094.763) * [-1095.434] (-1096.737) (-1098.463) (-1097.618) -- 0:00:27
Average standard deviation of split frequencies: 0.008725
570500 -- [-1099.899] (-1096.092) (-1097.608) (-1096.475) * (-1099.131) (-1097.390) (-1098.445) [-1095.578] -- 0:00:27
571000 -- (-1097.836) (-1095.940) [-1095.618] (-1095.957) * [-1097.131] (-1097.871) (-1096.977) (-1096.301) -- 0:00:27
571500 -- [-1098.007] (-1095.490) (-1095.250) (-1099.036) * [-1099.909] (-1095.937) (-1098.951) (-1094.832) -- 0:00:26
572000 -- (-1095.168) (-1099.691) (-1096.260) [-1097.514] * (-1097.687) (-1095.401) (-1095.439) [-1096.966] -- 0:00:26
572500 -- [-1095.850] (-1095.603) (-1097.163) (-1095.389) * (-1098.812) [-1095.401] (-1095.748) (-1100.769) -- 0:00:26
573000 -- (-1099.378) (-1097.111) [-1095.776] (-1100.292) * (-1097.905) (-1098.805) [-1096.507] (-1095.666) -- 0:00:26
573500 -- (-1096.766) [-1097.367] (-1097.527) (-1096.691) * (-1103.870) (-1101.452) [-1097.245] (-1095.191) -- 0:00:26
574000 -- [-1095.191] (-1098.656) (-1095.771) (-1098.708) * (-1104.603) (-1096.345) (-1094.803) [-1096.133] -- 0:00:26
574500 -- [-1099.983] (-1097.060) (-1095.937) (-1101.133) * (-1097.504) (-1096.701) [-1100.584] (-1095.289) -- 0:00:26
575000 -- (-1099.713) (-1097.268) (-1095.955) [-1097.116] * (-1094.464) (-1098.724) (-1097.464) [-1098.270] -- 0:00:27
Average standard deviation of split frequencies: 0.008696
575500 -- (-1099.254) [-1096.196] (-1095.052) (-1097.845) * (-1096.351) [-1097.973] (-1095.633) (-1094.780) -- 0:00:27
576000 -- [-1095.079] (-1096.414) (-1095.987) (-1097.567) * (-1097.239) (-1097.739) (-1094.700) [-1094.837] -- 0:00:27
576500 -- [-1094.896] (-1094.847) (-1096.529) (-1099.449) * (-1095.880) (-1096.748) (-1095.937) [-1095.063] -- 0:00:27
577000 -- (-1097.972) (-1097.773) [-1095.561] (-1097.100) * [-1096.033] (-1095.395) (-1099.410) (-1097.556) -- 0:00:27
577500 -- [-1097.968] (-1098.130) (-1098.281) (-1098.369) * (-1097.513) (-1097.203) (-1098.653) [-1096.640] -- 0:00:27
578000 -- (-1095.290) (-1100.085) [-1095.804] (-1096.042) * (-1096.164) [-1094.658] (-1099.775) (-1096.926) -- 0:00:27
578500 -- (-1095.493) (-1099.525) (-1097.624) [-1098.558] * (-1097.251) (-1096.626) (-1102.652) [-1095.136] -- 0:00:26
579000 -- [-1097.590] (-1099.223) (-1103.330) (-1095.817) * (-1103.512) (-1103.130) (-1095.865) [-1097.465] -- 0:00:26
579500 -- (-1098.791) (-1098.996) [-1099.535] (-1095.740) * [-1099.911] (-1097.864) (-1100.950) (-1094.786) -- 0:00:26
580000 -- [-1100.673] (-1101.691) (-1095.735) (-1094.947) * (-1099.662) (-1095.207) (-1100.743) [-1095.562] -- 0:00:26
Average standard deviation of split frequencies: 0.008778
580500 -- (-1095.917) [-1095.422] (-1097.879) (-1096.078) * (-1097.066) (-1097.747) [-1095.172] (-1095.357) -- 0:00:26
581000 -- (-1099.302) (-1096.608) (-1095.090) [-1095.711] * [-1097.066] (-1097.225) (-1094.985) (-1095.874) -- 0:00:26
581500 -- (-1098.265) (-1099.691) (-1095.904) [-1096.891] * [-1096.570] (-1096.583) (-1094.948) (-1101.193) -- 0:00:26
582000 -- (-1098.246) (-1100.352) (-1098.172) [-1095.396] * [-1099.987] (-1096.238) (-1094.987) (-1097.033) -- 0:00:26
582500 -- (-1097.721) (-1099.748) (-1104.678) [-1094.801] * (-1102.348) (-1097.148) [-1095.028] (-1096.233) -- 0:00:26
583000 -- (-1097.051) (-1097.359) [-1095.114] (-1098.165) * (-1096.784) [-1097.653] (-1096.570) (-1100.378) -- 0:00:26
583500 -- (-1098.304) (-1095.665) (-1095.928) [-1096.912] * (-1096.739) (-1096.523) [-1097.179] (-1098.699) -- 0:00:26
584000 -- (-1096.748) (-1098.478) (-1097.403) [-1098.148] * [-1095.235] (-1096.835) (-1098.562) (-1096.927) -- 0:00:26
584500 -- [-1096.682] (-1097.468) (-1095.032) (-1095.935) * (-1094.659) [-1097.244] (-1097.232) (-1097.903) -- 0:00:26
585000 -- (-1095.194) [-1096.126] (-1097.639) (-1096.118) * [-1094.973] (-1095.858) (-1102.144) (-1095.826) -- 0:00:26
Average standard deviation of split frequencies: 0.007997
585500 -- (-1097.177) (-1094.804) [-1095.727] (-1097.866) * (-1095.394) (-1095.470) [-1097.376] (-1095.016) -- 0:00:26
586000 -- [-1095.710] (-1094.804) (-1102.621) (-1098.163) * [-1096.650] (-1098.068) (-1098.298) (-1095.754) -- 0:00:26
586500 -- (-1095.854) [-1094.805] (-1101.233) (-1095.811) * [-1096.318] (-1099.095) (-1102.393) (-1095.819) -- 0:00:26
587000 -- [-1095.345] (-1095.172) (-1097.209) (-1097.276) * [-1096.259] (-1098.402) (-1096.336) (-1095.613) -- 0:00:26
587500 -- (-1095.269) (-1096.268) (-1099.690) [-1099.151] * (-1097.998) (-1099.466) [-1098.153] (-1097.560) -- 0:00:25
588000 -- [-1097.631] (-1100.778) (-1099.801) (-1098.514) * (-1100.045) (-1097.658) [-1095.121] (-1098.911) -- 0:00:25
588500 -- (-1098.026) [-1099.415] (-1095.365) (-1095.275) * (-1095.797) (-1097.684) [-1096.126] (-1097.077) -- 0:00:25
589000 -- (-1097.598) [-1099.046] (-1098.141) (-1096.953) * (-1098.858) (-1095.151) [-1099.207] (-1095.813) -- 0:00:25
589500 -- (-1095.862) (-1098.241) (-1096.588) [-1096.725] * (-1098.021) (-1095.122) [-1096.693] (-1095.115) -- 0:00:25
590000 -- (-1095.694) [-1095.659] (-1095.953) (-1096.691) * (-1097.591) [-1096.282] (-1101.031) (-1095.875) -- 0:00:25
Average standard deviation of split frequencies: 0.007931
590500 -- (-1095.489) [-1095.037] (-1098.039) (-1101.030) * [-1097.853] (-1100.863) (-1096.022) (-1096.022) -- 0:00:25
591000 -- [-1098.542] (-1095.315) (-1099.194) (-1096.720) * [-1097.894] (-1097.185) (-1099.390) (-1095.641) -- 0:00:25
591500 -- [-1095.419] (-1097.232) (-1098.306) (-1100.625) * (-1098.199) (-1095.181) (-1096.671) [-1094.631] -- 0:00:26
592000 -- (-1099.165) [-1096.586] (-1099.340) (-1100.033) * (-1097.792) (-1094.447) [-1097.420] (-1102.053) -- 0:00:26
592500 -- [-1097.017] (-1096.192) (-1098.900) (-1101.385) * (-1096.878) (-1095.505) (-1097.982) [-1096.061] -- 0:00:26
593000 -- (-1097.561) (-1097.392) (-1100.100) [-1096.763] * (-1096.250) (-1096.260) (-1099.552) [-1095.871] -- 0:00:26
593500 -- (-1096.552) [-1097.051] (-1096.237) (-1098.056) * (-1096.884) (-1095.238) (-1096.043) [-1096.530] -- 0:00:26
594000 -- (-1099.236) [-1098.678] (-1097.524) (-1096.520) * (-1096.133) [-1098.385] (-1094.710) (-1095.622) -- 0:00:25
594500 -- (-1096.059) (-1095.800) [-1096.335] (-1098.325) * [-1095.615] (-1096.258) (-1095.441) (-1097.884) -- 0:00:25
595000 -- (-1097.762) (-1097.022) [-1095.080] (-1096.833) * [-1096.545] (-1096.119) (-1099.502) (-1094.927) -- 0:00:25
Average standard deviation of split frequencies: 0.008747
595500 -- (-1104.065) [-1097.462] (-1097.228) (-1097.781) * (-1095.780) (-1094.717) [-1098.092] (-1096.495) -- 0:00:25
596000 -- (-1100.471) [-1097.334] (-1095.877) (-1096.404) * (-1098.293) (-1095.203) [-1095.140] (-1095.644) -- 0:00:25
596500 -- (-1101.300) (-1095.144) [-1094.722] (-1095.549) * (-1096.072) [-1095.497] (-1095.203) (-1095.766) -- 0:00:25
597000 -- [-1097.498] (-1095.299) (-1094.752) (-1099.893) * [-1096.718] (-1094.918) (-1096.591) (-1098.411) -- 0:00:25
597500 -- [-1096.911] (-1095.125) (-1095.540) (-1097.820) * [-1096.605] (-1096.724) (-1098.363) (-1094.639) -- 0:00:25
598000 -- (-1097.087) [-1095.600] (-1096.050) (-1094.776) * (-1097.717) (-1095.320) [-1097.767] (-1095.056) -- 0:00:25
598500 -- (-1099.436) [-1097.725] (-1095.351) (-1095.430) * (-1095.909) (-1096.675) (-1102.516) [-1098.865] -- 0:00:25
599000 -- (-1095.394) [-1096.898] (-1096.232) (-1097.632) * (-1096.039) (-1096.574) [-1095.997] (-1098.736) -- 0:00:25
599500 -- [-1098.223] (-1099.692) (-1100.599) (-1094.475) * [-1095.786] (-1100.141) (-1095.421) (-1096.077) -- 0:00:25
600000 -- (-1097.811) [-1099.236] (-1098.349) (-1098.097) * (-1094.374) (-1097.588) (-1096.255) [-1096.271] -- 0:00:25
Average standard deviation of split frequencies: 0.008771
600500 -- [-1096.080] (-1095.822) (-1094.807) (-1094.821) * (-1096.210) [-1095.855] (-1096.721) (-1097.878) -- 0:00:25
601000 -- (-1097.046) [-1094.531] (-1096.170) (-1095.038) * (-1097.075) [-1096.065] (-1095.529) (-1097.342) -- 0:00:25
601500 -- (-1097.073) (-1095.448) [-1096.040] (-1095.277) * (-1098.664) (-1095.443) (-1097.502) [-1101.164] -- 0:00:25
602000 -- (-1095.687) (-1095.852) [-1095.442] (-1096.900) * (-1097.166) (-1099.566) [-1095.680] (-1095.382) -- 0:00:25
602500 -- [-1095.825] (-1095.958) (-1096.561) (-1095.914) * (-1095.563) (-1099.616) [-1095.850] (-1097.085) -- 0:00:25
603000 -- (-1096.429) (-1096.866) [-1096.303] (-1096.144) * [-1096.764] (-1097.280) (-1096.626) (-1095.429) -- 0:00:25
603500 -- (-1097.826) (-1095.416) (-1096.314) [-1095.043] * (-1099.626) (-1095.927) [-1096.181] (-1097.636) -- 0:00:24
604000 -- (-1098.210) (-1096.242) (-1104.131) [-1097.053] * [-1099.903] (-1097.646) (-1095.845) (-1098.243) -- 0:00:24
604500 -- (-1097.838) (-1098.801) [-1101.760] (-1095.884) * (-1095.645) (-1103.385) [-1095.859] (-1099.702) -- 0:00:24
605000 -- [-1100.947] (-1099.209) (-1094.388) (-1096.312) * [-1096.472] (-1100.597) (-1094.937) (-1101.898) -- 0:00:24
Average standard deviation of split frequencies: 0.008420
605500 -- [-1100.957] (-1097.715) (-1095.425) (-1094.758) * [-1095.403] (-1098.736) (-1095.120) (-1095.617) -- 0:00:24
606000 -- (-1104.158) (-1096.423) [-1095.220] (-1095.344) * (-1095.701) (-1097.102) (-1098.640) [-1095.987] -- 0:00:24
606500 -- (-1095.976) (-1099.824) (-1096.525) [-1095.543] * (-1097.335) (-1095.512) [-1095.102] (-1097.438) -- 0:00:24
607000 -- (-1096.499) (-1101.784) [-1096.433] (-1094.679) * [-1098.237] (-1097.832) (-1097.118) (-1096.038) -- 0:00:24
607500 -- (-1096.857) [-1098.245] (-1096.030) (-1096.365) * (-1096.194) (-1102.153) (-1096.555) [-1095.623] -- 0:00:24
608000 -- [-1098.982] (-1094.936) (-1108.231) (-1097.934) * (-1095.998) (-1098.892) (-1096.629) [-1096.085] -- 0:00:25
608500 -- [-1097.250] (-1097.694) (-1097.966) (-1097.741) * (-1097.010) [-1097.687] (-1101.872) (-1095.079) -- 0:00:25
609000 -- (-1096.852) [-1099.307] (-1097.247) (-1097.181) * (-1096.209) (-1095.959) [-1098.174] (-1098.625) -- 0:00:25
609500 -- (-1096.980) [-1098.934] (-1096.937) (-1097.470) * [-1097.630] (-1095.445) (-1097.433) (-1097.922) -- 0:00:24
610000 -- (-1098.527) (-1096.229) (-1098.746) [-1095.126] * (-1098.363) [-1096.018] (-1096.493) (-1095.293) -- 0:00:24
Average standard deviation of split frequencies: 0.007720
610500 -- (-1098.333) [-1097.333] (-1097.582) (-1096.942) * (-1100.800) (-1095.865) (-1098.362) [-1095.341] -- 0:00:24
611000 -- (-1101.508) (-1099.950) (-1099.326) [-1095.577] * (-1097.612) (-1096.367) [-1095.654] (-1096.610) -- 0:00:24
611500 -- [-1103.489] (-1099.867) (-1098.614) (-1097.551) * (-1097.050) (-1100.081) [-1095.602] (-1096.767) -- 0:00:24
612000 -- (-1102.191) [-1097.055] (-1096.300) (-1098.097) * (-1097.492) [-1095.025] (-1096.548) (-1099.680) -- 0:00:24
612500 -- [-1097.650] (-1096.480) (-1099.084) (-1097.427) * [-1102.753] (-1097.602) (-1100.019) (-1099.388) -- 0:00:24
613000 -- [-1096.431] (-1097.389) (-1096.470) (-1099.072) * (-1097.854) (-1097.715) [-1096.002] (-1098.281) -- 0:00:24
613500 -- (-1099.034) (-1095.135) [-1096.846] (-1098.805) * (-1096.178) (-1099.130) (-1095.538) [-1095.157] -- 0:00:24
614000 -- [-1095.895] (-1097.924) (-1097.665) (-1096.505) * (-1099.509) (-1097.623) (-1095.114) [-1099.252] -- 0:00:24
614500 -- [-1097.838] (-1097.547) (-1098.335) (-1095.631) * [-1094.430] (-1095.623) (-1095.529) (-1097.081) -- 0:00:24
615000 -- (-1096.654) (-1098.222) (-1097.323) [-1096.923] * (-1101.126) (-1098.475) [-1095.852] (-1095.613) -- 0:00:24
Average standard deviation of split frequencies: 0.007857
615500 -- (-1099.281) (-1095.435) [-1095.626] (-1106.021) * (-1098.900) (-1101.437) (-1095.627) [-1095.624] -- 0:00:24
616000 -- [-1095.276] (-1096.011) (-1100.060) (-1102.333) * (-1098.856) (-1098.597) [-1095.651] (-1100.681) -- 0:00:24
616500 -- (-1095.250) [-1095.906] (-1102.677) (-1096.450) * (-1095.537) (-1096.854) (-1095.836) [-1098.379] -- 0:00:24
617000 -- (-1095.038) (-1099.685) (-1096.056) [-1096.238] * (-1095.629) (-1095.462) [-1097.835] (-1100.964) -- 0:00:24
617500 -- [-1095.200] (-1096.689) (-1098.093) (-1097.457) * (-1096.498) (-1096.039) (-1095.434) [-1098.453] -- 0:00:24
618000 -- (-1095.543) [-1099.094] (-1099.760) (-1095.162) * (-1096.705) [-1097.214] (-1095.076) (-1100.326) -- 0:00:24
618500 -- (-1097.250) [-1097.960] (-1096.592) (-1096.180) * [-1095.488] (-1099.695) (-1098.632) (-1097.356) -- 0:00:24
619000 -- [-1098.662] (-1101.354) (-1095.558) (-1101.263) * (-1095.622) (-1095.519) [-1096.811] (-1096.726) -- 0:00:24
619500 -- [-1096.581] (-1098.694) (-1096.976) (-1097.685) * (-1097.543) [-1099.900] (-1098.729) (-1097.020) -- 0:00:23
620000 -- (-1096.558) (-1096.802) (-1096.579) [-1099.675] * (-1095.183) (-1098.660) (-1097.847) [-1096.975] -- 0:00:23
Average standard deviation of split frequencies: 0.007747
620500 -- (-1095.988) [-1095.528] (-1095.657) (-1099.931) * (-1097.540) (-1101.064) [-1095.761] (-1095.915) -- 0:00:23
621000 -- (-1097.607) [-1098.901] (-1097.218) (-1099.138) * [-1097.436] (-1095.204) (-1096.655) (-1096.144) -- 0:00:23
621500 -- (-1094.950) [-1096.364] (-1096.014) (-1097.812) * (-1095.607) (-1095.501) [-1097.843] (-1096.131) -- 0:00:23
622000 -- (-1094.892) (-1101.801) (-1095.402) [-1095.784] * (-1097.851) (-1097.895) (-1098.411) [-1094.588] -- 0:00:23
622500 -- (-1095.635) (-1095.616) (-1095.909) [-1096.990] * (-1097.182) (-1096.964) [-1099.549] (-1095.164) -- 0:00:23
623000 -- (-1100.780) (-1096.622) [-1095.892] (-1100.934) * (-1096.784) (-1096.299) (-1098.327) [-1095.869] -- 0:00:23
623500 -- [-1099.331] (-1095.240) (-1100.515) (-1098.076) * (-1100.701) (-1098.551) (-1099.342) [-1096.738] -- 0:00:23
624000 -- (-1100.275) (-1095.658) [-1107.359] (-1094.579) * (-1096.960) (-1098.828) (-1095.474) [-1099.928] -- 0:00:24
624500 -- (-1097.663) [-1097.066] (-1102.478) (-1097.636) * (-1103.050) (-1096.493) [-1095.390] (-1096.886) -- 0:00:24
625000 -- (-1097.125) (-1096.891) [-1095.285] (-1095.833) * (-1095.508) (-1097.785) (-1096.249) [-1097.743] -- 0:00:24
Average standard deviation of split frequencies: 0.008133
625500 -- (-1095.082) (-1097.942) [-1096.443] (-1097.547) * [-1099.916] (-1097.126) (-1094.807) (-1098.973) -- 0:00:23
626000 -- (-1095.642) [-1096.028] (-1096.215) (-1096.442) * (-1097.587) (-1095.942) [-1095.894] (-1096.218) -- 0:00:23
626500 -- [-1096.191] (-1097.766) (-1096.785) (-1096.141) * [-1096.519] (-1099.570) (-1095.915) (-1096.587) -- 0:00:23
627000 -- (-1096.186) (-1096.389) (-1097.201) [-1097.241] * (-1098.594) [-1096.272] (-1097.284) (-1096.228) -- 0:00:23
627500 -- [-1096.658] (-1098.575) (-1096.647) (-1096.391) * [-1095.953] (-1099.843) (-1097.967) (-1095.043) -- 0:00:23
628000 -- (-1095.173) [-1100.283] (-1096.360) (-1098.211) * [-1095.909] (-1097.397) (-1099.175) (-1097.481) -- 0:00:23
628500 -- (-1096.918) (-1097.027) [-1096.718] (-1098.993) * [-1097.219] (-1096.676) (-1102.922) (-1097.589) -- 0:00:23
629000 -- (-1095.763) (-1096.433) [-1097.058] (-1097.800) * (-1098.442) (-1098.276) (-1098.167) [-1096.993] -- 0:00:23
629500 -- (-1095.311) (-1099.524) [-1097.835] (-1097.971) * (-1097.733) (-1097.239) [-1096.703] (-1096.239) -- 0:00:23
630000 -- (-1095.075) (-1097.523) [-1094.757] (-1096.899) * [-1099.902] (-1097.623) (-1098.424) (-1099.788) -- 0:00:23
Average standard deviation of split frequencies: 0.007873
630500 -- [-1095.350] (-1103.159) (-1099.203) (-1095.858) * (-1095.808) (-1097.684) (-1094.585) [-1097.392] -- 0:00:23
631000 -- (-1097.208) [-1095.714] (-1100.932) (-1098.449) * [-1095.143] (-1095.240) (-1098.583) (-1096.946) -- 0:00:23
631500 -- (-1095.087) (-1095.014) [-1097.193] (-1095.690) * (-1095.662) [-1096.621] (-1096.685) (-1096.911) -- 0:00:23
632000 -- [-1098.947] (-1099.240) (-1096.699) (-1095.224) * [-1095.826] (-1098.206) (-1095.334) (-1095.202) -- 0:00:23
632500 -- (-1097.163) (-1096.198) [-1096.907] (-1094.929) * [-1097.090] (-1095.440) (-1095.062) (-1096.056) -- 0:00:23
633000 -- (-1098.746) (-1095.724) [-1100.646] (-1095.090) * (-1096.256) (-1096.199) (-1094.887) [-1100.083] -- 0:00:23
633500 -- [-1095.414] (-1096.190) (-1101.576) (-1094.720) * (-1096.549) [-1095.831] (-1095.755) (-1095.727) -- 0:00:23
634000 -- [-1096.514] (-1095.321) (-1109.058) (-1095.944) * [-1098.018] (-1096.741) (-1098.260) (-1098.039) -- 0:00:23
634500 -- (-1096.094) [-1098.634] (-1097.413) (-1096.470) * (-1098.808) [-1097.822] (-1098.059) (-1097.115) -- 0:00:23
635000 -- (-1099.311) (-1097.375) (-1095.844) [-1096.827] * (-1097.465) [-1097.887] (-1097.151) (-1096.213) -- 0:00:22
Average standard deviation of split frequencies: 0.007313
635500 -- (-1098.038) (-1095.738) [-1098.586] (-1096.159) * (-1097.055) [-1096.295] (-1096.379) (-1096.556) -- 0:00:22
636000 -- (-1102.428) (-1095.943) [-1098.853] (-1096.438) * (-1097.111) (-1099.941) (-1098.560) [-1095.332] -- 0:00:22
636500 -- [-1096.977] (-1095.849) (-1097.529) (-1096.661) * (-1095.049) (-1097.058) [-1095.452] (-1094.628) -- 0:00:22
637000 -- [-1097.244] (-1098.643) (-1099.476) (-1096.249) * (-1094.943) [-1098.198] (-1096.045) (-1098.126) -- 0:00:22
637500 -- (-1095.317) (-1095.417) (-1096.806) [-1096.871] * (-1095.477) (-1098.086) (-1096.088) [-1096.781] -- 0:00:22
638000 -- [-1094.953] (-1094.823) (-1097.462) (-1098.609) * (-1095.782) (-1097.827) (-1096.470) [-1096.660] -- 0:00:22
638500 -- (-1097.166) (-1097.319) (-1097.823) [-1096.593] * [-1098.006] (-1100.249) (-1100.537) (-1099.581) -- 0:00:22
639000 -- (-1097.007) (-1095.520) (-1096.657) [-1097.467] * [-1096.646] (-1094.937) (-1096.734) (-1096.994) -- 0:00:23
639500 -- (-1096.919) (-1097.830) (-1095.819) [-1099.506] * (-1095.390) (-1097.921) (-1103.375) [-1094.579] -- 0:00:23
640000 -- (-1095.097) (-1095.424) [-1096.779] (-1097.533) * [-1095.371] (-1098.087) (-1106.450) (-1095.926) -- 0:00:23
Average standard deviation of split frequencies: 0.007505
640500 -- (-1095.419) [-1097.165] (-1096.895) (-1100.499) * [-1094.887] (-1097.662) (-1107.040) (-1095.876) -- 0:00:23
641000 -- [-1099.030] (-1098.599) (-1099.022) (-1100.598) * (-1096.431) (-1097.053) (-1096.918) [-1094.499] -- 0:00:22
641500 -- (-1096.102) (-1099.530) [-1095.893] (-1101.741) * [-1096.004] (-1097.559) (-1099.178) (-1094.545) -- 0:00:22
642000 -- (-1099.635) (-1099.800) (-1095.066) [-1096.287] * (-1097.736) (-1096.893) [-1096.829] (-1095.617) -- 0:00:22
642500 -- [-1098.832] (-1099.323) (-1095.449) (-1095.941) * [-1095.390] (-1096.780) (-1097.561) (-1097.123) -- 0:00:22
643000 -- (-1098.155) (-1095.095) (-1096.485) [-1095.938] * (-1095.041) (-1096.508) (-1097.456) [-1097.698] -- 0:00:22
643500 -- (-1098.321) (-1095.554) [-1095.180] (-1096.047) * [-1095.701] (-1100.645) (-1096.348) (-1095.264) -- 0:00:22
644000 -- (-1095.649) (-1094.732) [-1094.929] (-1097.253) * [-1095.091] (-1098.675) (-1094.997) (-1094.570) -- 0:00:22
644500 -- (-1096.014) [-1094.493] (-1095.592) (-1095.992) * (-1096.434) [-1096.808] (-1096.623) (-1097.900) -- 0:00:22
645000 -- (-1098.731) [-1094.933] (-1097.896) (-1096.318) * (-1097.864) (-1102.797) [-1095.167] (-1096.510) -- 0:00:22
Average standard deviation of split frequencies: 0.007541
645500 -- [-1098.130] (-1095.557) (-1095.176) (-1096.648) * (-1095.554) (-1095.634) (-1098.034) [-1097.716] -- 0:00:22
646000 -- [-1097.491] (-1095.796) (-1094.810) (-1097.048) * [-1095.847] (-1095.631) (-1095.530) (-1097.421) -- 0:00:22
646500 -- (-1096.190) [-1095.909] (-1095.073) (-1095.280) * [-1095.849] (-1096.163) (-1096.607) (-1100.396) -- 0:00:22
647000 -- (-1096.050) (-1097.041) [-1098.243] (-1094.777) * [-1095.999] (-1096.445) (-1095.406) (-1098.486) -- 0:00:22
647500 -- (-1098.534) (-1101.611) [-1099.962] (-1095.310) * (-1098.210) (-1097.920) [-1096.207] (-1097.862) -- 0:00:22
648000 -- (-1096.060) (-1097.890) (-1094.751) [-1095.088] * [-1097.505] (-1098.699) (-1097.264) (-1096.979) -- 0:00:22
648500 -- (-1097.368) (-1095.472) [-1095.936] (-1095.038) * (-1098.716) (-1097.497) (-1096.828) [-1094.774] -- 0:00:22
649000 -- (-1095.082) [-1097.196] (-1097.744) (-1097.638) * (-1102.321) (-1096.123) [-1096.375] (-1095.447) -- 0:00:22
649500 -- (-1101.296) (-1096.415) (-1096.623) [-1095.029] * (-1099.087) [-1096.831] (-1097.801) (-1094.572) -- 0:00:22
650000 -- (-1096.554) (-1098.399) (-1097.660) [-1094.936] * [-1095.805] (-1095.374) (-1096.004) (-1097.654) -- 0:00:22
Average standard deviation of split frequencies: 0.007873
650500 -- (-1100.972) [-1096.041] (-1097.120) (-1094.661) * (-1096.706) (-1098.150) [-1098.880] (-1095.494) -- 0:00:22
651000 -- [-1096.239] (-1100.328) (-1097.711) (-1096.278) * [-1096.356] (-1096.671) (-1103.580) (-1097.555) -- 0:00:21
651500 -- (-1095.966) (-1097.781) (-1097.883) [-1096.833] * (-1095.530) (-1094.898) (-1097.573) [-1095.830] -- 0:00:21
652000 -- (-1099.282) [-1098.935] (-1096.767) (-1098.007) * [-1097.703] (-1097.498) (-1096.925) (-1095.728) -- 0:00:21
652500 -- (-1095.892) (-1097.437) (-1099.200) [-1097.154] * (-1100.339) [-1095.807] (-1097.171) (-1102.034) -- 0:00:21
653000 -- [-1095.534] (-1096.942) (-1097.461) (-1095.591) * (-1098.485) (-1096.503) (-1097.693) [-1098.182] -- 0:00:21
653500 -- [-1097.719] (-1096.519) (-1096.077) (-1096.088) * (-1100.916) [-1098.260] (-1097.526) (-1097.097) -- 0:00:21
654000 -- (-1096.647) (-1096.827) (-1097.281) [-1096.088] * (-1100.190) (-1099.519) (-1095.719) [-1095.707] -- 0:00:22
654500 -- [-1097.204] (-1096.190) (-1098.900) (-1099.758) * (-1096.673) [-1095.650] (-1095.350) (-1098.563) -- 0:00:22
655000 -- (-1097.111) (-1096.539) [-1095.543] (-1096.055) * (-1098.115) (-1095.713) [-1095.830] (-1098.829) -- 0:00:22
Average standard deviation of split frequencies: 0.008384
655500 -- (-1097.107) (-1096.940) [-1096.181] (-1102.207) * (-1096.841) (-1102.110) (-1096.411) [-1096.803] -- 0:00:22
656000 -- [-1096.408] (-1096.483) (-1098.697) (-1097.244) * (-1099.269) (-1094.616) [-1096.789] (-1094.756) -- 0:00:22
656500 -- (-1095.719) [-1096.795] (-1094.790) (-1098.588) * [-1096.435] (-1095.248) (-1098.746) (-1096.865) -- 0:00:21
657000 -- (-1098.466) [-1096.592] (-1096.031) (-1099.810) * (-1095.510) [-1097.726] (-1098.489) (-1097.715) -- 0:00:21
657500 -- [-1099.144] (-1096.595) (-1096.448) (-1099.567) * [-1101.907] (-1097.333) (-1096.781) (-1096.268) -- 0:00:21
658000 -- (-1096.354) (-1096.668) [-1096.824] (-1096.999) * (-1095.269) [-1099.061] (-1096.945) (-1096.394) -- 0:00:21
658500 -- (-1104.106) (-1094.996) (-1095.808) [-1096.607] * (-1099.821) (-1095.072) [-1097.017] (-1097.762) -- 0:00:21
659000 -- (-1099.580) (-1097.808) [-1096.412] (-1097.721) * [-1095.207] (-1095.797) (-1095.491) (-1095.381) -- 0:00:21
659500 -- (-1097.665) (-1098.252) (-1099.596) [-1096.766] * (-1095.820) (-1095.625) [-1096.160] (-1102.064) -- 0:00:21
660000 -- (-1097.146) (-1096.002) (-1097.746) [-1095.248] * [-1095.576] (-1094.588) (-1098.179) (-1096.228) -- 0:00:21
Average standard deviation of split frequencies: 0.008134
660500 -- [-1098.217] (-1096.673) (-1101.743) (-1095.324) * (-1095.758) (-1095.046) [-1095.622] (-1097.390) -- 0:00:21
661000 -- (-1097.918) [-1096.198] (-1099.049) (-1096.396) * (-1095.592) (-1094.611) (-1095.234) [-1095.807] -- 0:00:21
661500 -- (-1096.177) (-1096.873) (-1100.202) [-1097.428] * (-1097.378) (-1095.517) [-1097.151] (-1097.247) -- 0:00:21
662000 -- (-1096.520) [-1096.084] (-1097.998) (-1095.780) * (-1098.119) [-1095.471] (-1098.628) (-1095.092) -- 0:00:21
662500 -- (-1096.476) [-1095.378] (-1100.535) (-1097.189) * [-1095.140] (-1098.106) (-1099.585) (-1099.302) -- 0:00:21
663000 -- (-1101.723) [-1097.068] (-1099.846) (-1103.024) * (-1098.861) (-1100.396) (-1099.265) [-1099.613] -- 0:00:21
663500 -- (-1096.085) [-1096.622] (-1097.563) (-1103.599) * (-1096.928) [-1099.435] (-1098.947) (-1097.314) -- 0:00:21
664000 -- (-1097.802) [-1096.692] (-1097.531) (-1097.469) * [-1096.488] (-1095.154) (-1099.462) (-1098.580) -- 0:00:21
664500 -- [-1097.322] (-1097.368) (-1097.343) (-1098.468) * (-1100.483) (-1096.834) (-1103.237) [-1097.048] -- 0:00:21
665000 -- [-1097.080] (-1103.198) (-1095.748) (-1095.761) * [-1098.871] (-1096.333) (-1098.212) (-1099.088) -- 0:00:21
Average standard deviation of split frequencies: 0.007739
665500 -- [-1094.979] (-1098.706) (-1098.695) (-1098.414) * (-1100.026) (-1097.132) [-1095.614] (-1097.797) -- 0:00:21
666000 -- (-1096.753) [-1094.910] (-1099.193) (-1098.820) * (-1095.228) (-1095.647) (-1095.437) [-1096.765] -- 0:00:21
666500 -- (-1098.037) (-1095.227) (-1100.645) [-1100.024] * (-1098.449) [-1095.916] (-1095.874) (-1096.797) -- 0:00:21
667000 -- (-1096.418) (-1096.144) [-1095.903] (-1097.362) * [-1097.634] (-1097.857) (-1098.889) (-1097.560) -- 0:00:20
667500 -- (-1096.966) (-1094.354) [-1096.319] (-1096.018) * [-1094.691] (-1096.437) (-1097.754) (-1098.340) -- 0:00:20
668000 -- (-1096.237) (-1094.634) (-1096.013) [-1095.731] * (-1098.117) (-1095.804) [-1096.367] (-1096.327) -- 0:00:20
668500 -- [-1096.411] (-1095.639) (-1095.083) (-1094.920) * (-1098.123) (-1096.570) (-1095.230) [-1096.574] -- 0:00:20
669000 -- (-1102.548) [-1097.999] (-1096.213) (-1098.556) * (-1096.833) (-1098.014) [-1097.777] (-1096.038) -- 0:00:20
669500 -- (-1095.754) (-1100.055) [-1096.832] (-1098.843) * (-1097.016) [-1096.048] (-1096.447) (-1098.238) -- 0:00:20
670000 -- (-1097.989) [-1098.122] (-1102.659) (-1097.238) * (-1096.659) (-1097.124) (-1095.283) [-1097.770] -- 0:00:20
Average standard deviation of split frequencies: 0.008200
670500 -- (-1097.445) (-1098.160) [-1095.973] (-1096.741) * (-1097.613) (-1095.052) (-1099.747) [-1095.367] -- 0:00:21
671000 -- (-1097.562) (-1097.430) [-1096.471] (-1098.837) * (-1098.592) (-1097.543) (-1100.685) [-1097.484] -- 0:00:21
671500 -- (-1098.072) (-1094.889) (-1096.359) [-1096.773] * (-1097.377) [-1095.486] (-1099.557) (-1097.050) -- 0:00:21
672000 -- (-1100.882) (-1094.676) (-1095.163) [-1096.809] * (-1096.728) (-1094.935) [-1095.097] (-1096.006) -- 0:00:20
672500 -- (-1096.262) (-1102.699) (-1095.951) [-1097.452] * [-1097.968] (-1099.658) (-1096.014) (-1095.350) -- 0:00:20
673000 -- (-1095.320) (-1096.945) [-1094.806] (-1098.206) * (-1099.368) (-1096.653) (-1104.107) [-1096.748] -- 0:00:20
673500 -- (-1096.048) (-1099.265) (-1105.161) [-1094.833] * (-1098.161) (-1095.895) (-1100.734) [-1096.812] -- 0:00:20
674000 -- (-1096.919) (-1102.214) [-1097.990] (-1095.304) * (-1096.403) [-1096.247] (-1096.585) (-1097.487) -- 0:00:20
674500 -- (-1095.005) [-1098.711] (-1095.416) (-1103.229) * (-1099.013) [-1096.335] (-1100.580) (-1099.905) -- 0:00:20
675000 -- (-1095.496) [-1095.807] (-1097.221) (-1100.372) * (-1096.344) [-1096.690] (-1096.266) (-1096.895) -- 0:00:20
Average standard deviation of split frequencies: 0.008136
675500 -- (-1097.554) (-1098.065) [-1096.990] (-1097.323) * (-1097.021) (-1095.644) [-1096.172] (-1096.788) -- 0:00:20
676000 -- (-1097.748) (-1099.226) (-1097.850) [-1097.648] * (-1100.451) (-1094.718) (-1097.570) [-1095.489] -- 0:00:20
676500 -- (-1095.427) (-1099.417) [-1095.782] (-1096.613) * (-1096.008) (-1096.336) [-1094.683] (-1097.763) -- 0:00:20
677000 -- (-1095.892) [-1096.092] (-1098.830) (-1096.697) * (-1097.546) (-1097.145) [-1094.914] (-1098.491) -- 0:00:20
677500 -- (-1098.592) (-1097.290) [-1096.196] (-1099.128) * [-1095.695] (-1096.767) (-1096.497) (-1099.021) -- 0:00:20
678000 -- [-1097.512] (-1097.944) (-1095.836) (-1098.155) * (-1096.348) [-1097.688] (-1095.762) (-1100.124) -- 0:00:20
678500 -- [-1100.807] (-1096.484) (-1098.914) (-1095.393) * (-1098.259) (-1097.415) (-1095.790) [-1096.661] -- 0:00:20
679000 -- (-1099.804) (-1096.005) [-1095.648] (-1096.004) * (-1096.334) (-1096.392) [-1095.885] (-1095.631) -- 0:00:20
679500 -- (-1094.694) (-1099.357) [-1099.236] (-1098.219) * (-1095.680) (-1095.613) [-1096.567] (-1096.071) -- 0:00:20
680000 -- [-1095.361] (-1097.498) (-1097.755) (-1098.646) * (-1096.952) (-1095.757) [-1095.715] (-1096.446) -- 0:00:20
Average standard deviation of split frequencies: 0.007895
680500 -- [-1095.963] (-1095.307) (-1095.121) (-1099.969) * (-1096.613) (-1095.442) (-1095.886) [-1096.453] -- 0:00:20
681000 -- [-1094.899] (-1095.296) (-1097.618) (-1098.619) * (-1095.804) (-1096.213) (-1096.266) [-1098.872] -- 0:00:20
681500 -- (-1097.028) (-1098.260) [-1098.575] (-1095.699) * [-1095.581] (-1095.617) (-1098.356) (-1097.740) -- 0:00:20
682000 -- (-1097.677) (-1095.402) [-1096.202] (-1096.418) * (-1097.975) (-1097.460) (-1096.009) [-1097.093] -- 0:00:20
682500 -- [-1094.892] (-1099.869) (-1096.860) (-1096.847) * (-1099.172) [-1100.953] (-1095.533) (-1098.858) -- 0:00:20
683000 -- (-1096.723) (-1095.716) [-1096.078] (-1096.805) * (-1100.882) [-1096.132] (-1100.307) (-1099.671) -- 0:00:19
683500 -- [-1096.824] (-1095.839) (-1096.269) (-1098.371) * [-1098.709] (-1095.235) (-1096.563) (-1096.471) -- 0:00:19
684000 -- (-1099.034) [-1097.327] (-1096.297) (-1096.761) * (-1099.262) [-1098.501] (-1098.370) (-1100.623) -- 0:00:19
684500 -- (-1098.955) [-1095.451] (-1095.611) (-1097.633) * [-1099.104] (-1094.616) (-1099.880) (-1104.395) -- 0:00:19
685000 -- [-1097.303] (-1096.850) (-1095.475) (-1097.018) * (-1097.037) [-1095.587] (-1100.622) (-1097.448) -- 0:00:19
Average standard deviation of split frequencies: 0.007467
685500 -- (-1097.750) (-1098.772) [-1099.215] (-1096.380) * (-1096.319) (-1095.065) (-1099.968) [-1098.341] -- 0:00:19
686000 -- (-1095.545) [-1100.573] (-1097.692) (-1098.435) * (-1096.380) (-1095.731) [-1096.929] (-1095.540) -- 0:00:19
686500 -- [-1098.351] (-1095.263) (-1097.944) (-1101.149) * (-1094.903) [-1097.479] (-1098.242) (-1095.670) -- 0:00:20
687000 -- (-1102.304) (-1095.101) [-1096.188] (-1099.272) * (-1095.103) [-1095.331] (-1099.439) (-1098.342) -- 0:00:20
687500 -- (-1098.078) [-1097.393] (-1095.434) (-1100.580) * (-1096.968) (-1095.469) [-1096.018] (-1098.084) -- 0:00:20
688000 -- [-1102.080] (-1098.163) (-1096.320) (-1098.716) * (-1094.823) (-1100.634) (-1098.905) [-1096.044] -- 0:00:19
688500 -- (-1097.899) [-1095.301] (-1094.838) (-1100.792) * (-1097.048) [-1099.251] (-1098.056) (-1100.528) -- 0:00:19
689000 -- (-1097.054) [-1096.909] (-1095.123) (-1097.612) * [-1099.029] (-1097.490) (-1095.917) (-1099.349) -- 0:00:19
689500 -- (-1102.764) (-1099.014) (-1094.837) [-1100.509] * (-1099.113) (-1097.465) [-1095.654] (-1096.077) -- 0:00:19
690000 -- (-1096.283) (-1097.259) (-1095.495) [-1095.975] * (-1096.505) (-1096.421) [-1097.666] (-1098.828) -- 0:00:19
Average standard deviation of split frequencies: 0.007417
690500 -- (-1096.893) (-1095.854) (-1099.079) [-1097.329] * (-1096.368) (-1095.274) (-1100.847) [-1095.031] -- 0:00:19
691000 -- (-1096.427) (-1095.553) [-1096.615] (-1095.061) * (-1097.511) (-1097.024) (-1097.910) [-1094.920] -- 0:00:19
691500 -- (-1095.080) [-1095.971] (-1095.902) (-1096.385) * (-1098.097) (-1099.251) [-1098.679] (-1095.375) -- 0:00:19
692000 -- (-1097.363) (-1097.805) [-1095.520] (-1102.060) * (-1098.114) (-1096.922) (-1102.936) [-1096.795] -- 0:00:19
692500 -- (-1095.588) [-1095.361] (-1096.127) (-1096.023) * (-1095.600) [-1097.180] (-1098.137) (-1098.283) -- 0:00:19
693000 -- (-1097.678) (-1095.437) (-1099.265) [-1096.732] * [-1097.004] (-1095.443) (-1100.241) (-1101.281) -- 0:00:19
693500 -- [-1098.472] (-1097.299) (-1097.842) (-1097.039) * (-1096.938) (-1097.869) [-1095.272] (-1098.444) -- 0:00:19
694000 -- (-1094.965) [-1099.193] (-1098.868) (-1096.234) * (-1097.941) [-1097.855] (-1095.263) (-1098.098) -- 0:00:19
694500 -- (-1100.948) (-1097.053) [-1099.572] (-1098.071) * (-1097.375) [-1095.412] (-1095.865) (-1096.657) -- 0:00:19
695000 -- (-1100.766) (-1096.269) (-1101.516) [-1097.451] * (-1099.411) [-1096.724] (-1096.824) (-1096.862) -- 0:00:19
Average standard deviation of split frequencies: 0.006999
695500 -- [-1098.584] (-1094.742) (-1095.275) (-1097.410) * (-1098.349) (-1094.691) (-1096.990) [-1094.986] -- 0:00:19
696000 -- (-1098.864) [-1095.700] (-1098.396) (-1096.818) * (-1095.859) (-1094.699) [-1095.684] (-1098.939) -- 0:00:19
696500 -- (-1094.939) (-1097.148) [-1101.082] (-1096.726) * [-1096.732] (-1094.953) (-1097.645) (-1096.186) -- 0:00:19
697000 -- [-1095.055] (-1095.536) (-1099.105) (-1098.523) * (-1096.569) (-1094.996) [-1096.202] (-1096.949) -- 0:00:19
697500 -- (-1096.097) [-1094.774] (-1099.123) (-1096.909) * (-1096.202) (-1094.862) [-1095.208] (-1095.033) -- 0:00:19
698000 -- (-1095.351) (-1095.885) (-1094.652) [-1097.170] * [-1095.823] (-1097.629) (-1099.468) (-1096.446) -- 0:00:19
698500 -- (-1094.752) (-1096.718) [-1099.510] (-1100.364) * [-1096.515] (-1096.662) (-1098.910) (-1101.539) -- 0:00:18
699000 -- (-1100.609) (-1102.047) (-1098.945) [-1095.485] * (-1098.261) [-1097.160] (-1095.151) (-1100.198) -- 0:00:18
699500 -- (-1096.706) (-1102.119) [-1097.728] (-1095.769) * (-1095.582) (-1095.286) (-1095.946) [-1099.898] -- 0:00:18
700000 -- [-1095.507] (-1095.274) (-1096.375) (-1095.222) * (-1096.509) (-1098.762) (-1097.865) [-1097.089] -- 0:00:18
Average standard deviation of split frequencies: 0.007132
700500 -- (-1095.347) (-1096.593) (-1097.354) [-1095.712] * [-1095.562] (-1095.599) (-1095.098) (-1098.659) -- 0:00:18
701000 -- (-1096.234) [-1098.043] (-1095.715) (-1095.059) * (-1095.023) (-1095.880) [-1095.161] (-1097.802) -- 0:00:18
701500 -- (-1096.971) (-1097.575) (-1094.719) [-1096.086] * (-1098.237) (-1097.351) [-1095.081] (-1097.576) -- 0:00:18
702000 -- (-1096.712) (-1101.463) [-1095.689] (-1096.726) * (-1096.598) [-1096.031] (-1098.115) (-1097.033) -- 0:00:18
702500 -- (-1095.607) (-1098.458) [-1095.267] (-1097.946) * (-1099.638) (-1094.768) [-1095.871] (-1100.853) -- 0:00:18
703000 -- (-1095.528) (-1095.508) (-1096.036) [-1097.735] * [-1098.704] (-1095.905) (-1095.484) (-1097.229) -- 0:00:19
703500 -- [-1096.316] (-1094.770) (-1095.243) (-1098.553) * [-1099.555] (-1096.384) (-1096.139) (-1099.553) -- 0:00:18
704000 -- (-1097.753) [-1100.532] (-1095.327) (-1101.184) * (-1095.647) (-1101.146) (-1097.727) [-1097.251] -- 0:00:18
704500 -- (-1096.162) (-1098.237) (-1099.124) [-1097.503] * [-1095.826] (-1098.587) (-1095.298) (-1096.369) -- 0:00:18
705000 -- (-1094.833) (-1097.708) (-1099.430) [-1094.803] * [-1100.567] (-1097.153) (-1097.128) (-1096.289) -- 0:00:18
Average standard deviation of split frequencies: 0.007167
705500 -- (-1095.000) [-1101.283] (-1096.339) (-1096.043) * (-1095.339) (-1099.095) (-1095.255) [-1097.345] -- 0:00:18
706000 -- (-1097.267) [-1096.455] (-1101.975) (-1095.658) * [-1096.233] (-1097.991) (-1097.769) (-1095.108) -- 0:00:18
706500 -- (-1095.623) [-1095.145] (-1095.941) (-1097.317) * (-1097.152) [-1097.648] (-1098.499) (-1096.905) -- 0:00:18
707000 -- (-1094.493) [-1097.040] (-1095.197) (-1095.621) * (-1098.161) (-1095.801) [-1098.590] (-1096.803) -- 0:00:18
707500 -- [-1095.762] (-1096.878) (-1097.238) (-1095.884) * (-1096.427) (-1096.220) [-1094.705] (-1098.472) -- 0:00:18
708000 -- (-1095.711) [-1097.267] (-1099.526) (-1096.045) * [-1096.700] (-1095.600) (-1095.644) (-1098.227) -- 0:00:18
708500 -- (-1095.061) (-1095.491) (-1095.265) [-1095.439] * [-1097.067] (-1096.549) (-1096.603) (-1098.051) -- 0:00:18
709000 -- [-1098.653] (-1099.760) (-1094.610) (-1097.244) * (-1098.981) (-1097.014) [-1098.109] (-1098.094) -- 0:00:18
709500 -- (-1097.252) (-1097.729) [-1094.937] (-1097.364) * (-1099.740) [-1097.259] (-1096.202) (-1097.363) -- 0:00:18
710000 -- (-1101.292) (-1096.533) (-1096.210) [-1095.914] * (-1097.325) (-1097.160) [-1095.238] (-1099.019) -- 0:00:18
Average standard deviation of split frequencies: 0.006854
710500 -- [-1098.743] (-1096.783) (-1096.319) (-1095.876) * (-1100.090) (-1100.247) [-1097.675] (-1098.272) -- 0:00:18
711000 -- (-1095.239) [-1094.719] (-1095.396) (-1095.023) * (-1096.640) [-1097.725] (-1097.773) (-1097.009) -- 0:00:18
711500 -- (-1097.539) (-1099.099) [-1097.077] (-1095.950) * (-1094.858) [-1096.455] (-1096.234) (-1095.113) -- 0:00:18
712000 -- [-1099.069] (-1097.044) (-1095.537) (-1097.262) * (-1096.489) (-1096.024) [-1097.494] (-1099.881) -- 0:00:18
712500 -- (-1097.961) (-1098.475) [-1098.127] (-1098.318) * (-1099.386) (-1095.715) [-1096.375] (-1100.938) -- 0:00:18
713000 -- (-1094.599) [-1097.020] (-1095.071) (-1097.107) * (-1096.638) (-1096.829) (-1096.583) [-1100.165] -- 0:00:18
713500 -- (-1094.807) [-1098.476] (-1097.687) (-1098.978) * (-1097.882) [-1096.176] (-1096.796) (-1097.378) -- 0:00:18
714000 -- (-1097.908) (-1097.887) (-1097.251) [-1097.281] * (-1097.905) (-1097.733) [-1095.484] (-1095.154) -- 0:00:18
714500 -- (-1096.441) (-1099.053) [-1095.928] (-1097.417) * [-1097.517] (-1098.965) (-1095.389) (-1097.080) -- 0:00:17
715000 -- (-1102.653) (-1098.015) (-1097.245) [-1097.978] * (-1101.139) [-1099.600] (-1096.733) (-1094.697) -- 0:00:17
Average standard deviation of split frequencies: 0.006935
715500 -- [-1099.360] (-1096.838) (-1100.205) (-1096.081) * [-1097.660] (-1097.679) (-1099.433) (-1101.221) -- 0:00:17
716000 -- (-1097.070) [-1100.235] (-1096.611) (-1096.945) * (-1096.250) [-1095.701] (-1106.349) (-1095.874) -- 0:00:17
716500 -- [-1096.435] (-1095.519) (-1094.924) (-1098.505) * [-1094.473] (-1096.419) (-1106.590) (-1099.849) -- 0:00:17
717000 -- [-1095.776] (-1100.818) (-1098.337) (-1097.620) * [-1095.071] (-1095.364) (-1096.812) (-1097.862) -- 0:00:17
717500 -- [-1096.169] (-1097.456) (-1095.354) (-1102.096) * (-1098.835) (-1095.781) (-1099.663) [-1095.218] -- 0:00:17
718000 -- [-1098.456] (-1101.595) (-1095.105) (-1100.329) * [-1095.058] (-1095.185) (-1096.423) (-1098.300) -- 0:00:17
718500 -- (-1096.695) [-1096.267] (-1099.892) (-1097.386) * [-1095.574] (-1100.074) (-1096.773) (-1095.509) -- 0:00:17
719000 -- (-1096.583) (-1098.506) [-1097.126] (-1098.903) * (-1099.529) (-1097.961) (-1096.741) [-1095.332] -- 0:00:17
719500 -- (-1097.073) (-1095.393) (-1099.390) [-1096.643] * (-1095.069) (-1097.284) [-1098.753] (-1095.141) -- 0:00:17
720000 -- (-1097.704) [-1096.662] (-1097.066) (-1096.545) * (-1095.607) (-1097.505) (-1097.062) [-1097.687] -- 0:00:17
Average standard deviation of split frequencies: 0.008013
720500 -- [-1095.830] (-1097.285) (-1095.439) (-1095.613) * (-1101.305) (-1097.266) (-1094.786) [-1095.973] -- 0:00:17
721000 -- (-1095.266) (-1099.132) [-1095.896] (-1097.430) * [-1096.622] (-1096.782) (-1098.059) (-1095.107) -- 0:00:17
721500 -- (-1097.155) (-1097.654) [-1096.444] (-1095.323) * (-1095.029) (-1097.080) (-1097.301) [-1094.822] -- 0:00:17
722000 -- (-1098.116) (-1096.277) (-1096.134) [-1096.309] * (-1096.009) (-1097.071) [-1101.379] (-1096.203) -- 0:00:17
722500 -- (-1095.043) (-1101.090) [-1096.382] (-1100.154) * (-1095.918) [-1095.592] (-1103.206) (-1098.837) -- 0:00:17
723000 -- (-1096.145) (-1095.303) (-1097.285) [-1097.497] * [-1097.500] (-1096.071) (-1101.071) (-1098.484) -- 0:00:17
723500 -- (-1096.645) [-1095.415] (-1096.279) (-1095.434) * (-1096.189) (-1096.679) (-1096.386) [-1098.560] -- 0:00:17
724000 -- (-1097.166) (-1096.137) [-1095.188] (-1103.729) * (-1098.092) (-1098.012) (-1098.660) [-1097.906] -- 0:00:17
724500 -- (-1098.874) (-1096.966) [-1098.212] (-1099.184) * (-1098.082) (-1095.962) [-1097.120] (-1098.140) -- 0:00:17
725000 -- [-1098.039] (-1094.809) (-1095.898) (-1095.996) * (-1098.756) (-1096.662) (-1096.039) [-1100.508] -- 0:00:17
Average standard deviation of split frequencies: 0.008198
725500 -- [-1101.249] (-1096.175) (-1096.262) (-1095.066) * [-1096.011] (-1095.700) (-1096.313) (-1097.140) -- 0:00:17
726000 -- [-1096.507] (-1095.699) (-1096.645) (-1095.240) * (-1096.344) (-1094.777) (-1101.286) [-1096.290] -- 0:00:17
726500 -- (-1095.987) [-1096.660] (-1095.543) (-1097.461) * (-1101.995) (-1096.218) [-1097.275] (-1101.969) -- 0:00:17
727000 -- (-1096.551) (-1096.392) (-1097.164) [-1096.297] * (-1098.053) (-1100.549) (-1097.376) [-1095.132] -- 0:00:17
727500 -- (-1096.177) [-1097.000] (-1095.728) (-1095.845) * [-1095.199] (-1096.676) (-1098.432) (-1096.546) -- 0:00:17
728000 -- (-1099.612) (-1095.033) (-1096.648) [-1098.264] * [-1095.704] (-1098.456) (-1098.939) (-1097.834) -- 0:00:17
728500 -- [-1098.827] (-1095.616) (-1096.202) (-1101.795) * (-1096.272) (-1095.537) (-1101.460) [-1097.468] -- 0:00:17
729000 -- [-1096.296] (-1099.363) (-1096.876) (-1098.871) * (-1096.333) [-1094.521] (-1101.238) (-1097.260) -- 0:00:17
729500 -- (-1096.843) (-1100.130) (-1096.848) [-1096.325] * (-1094.778) [-1094.841] (-1101.817) (-1098.728) -- 0:00:17
730000 -- (-1097.153) (-1101.364) [-1097.628] (-1100.932) * (-1096.427) (-1097.387) [-1094.861] (-1097.478) -- 0:00:17
Average standard deviation of split frequencies: 0.008226
730500 -- (-1097.717) [-1100.764] (-1097.150) (-1101.105) * [-1095.561] (-1096.949) (-1095.810) (-1097.392) -- 0:00:16
731000 -- [-1095.825] (-1095.365) (-1095.902) (-1098.404) * (-1098.544) (-1097.609) (-1096.197) [-1096.007] -- 0:00:16
731500 -- (-1097.127) (-1095.767) [-1094.869] (-1099.516) * (-1095.232) [-1097.812] (-1097.458) (-1096.702) -- 0:00:16
732000 -- (-1099.613) (-1096.221) [-1094.849] (-1095.533) * [-1095.253] (-1097.299) (-1097.956) (-1096.275) -- 0:00:16
732500 -- (-1099.454) [-1096.647] (-1095.822) (-1098.863) * [-1095.466] (-1095.439) (-1098.441) (-1099.916) -- 0:00:16
733000 -- (-1099.470) [-1095.885] (-1096.582) (-1097.683) * (-1100.592) (-1100.920) [-1097.478] (-1096.732) -- 0:00:16
733500 -- [-1099.881] (-1098.351) (-1094.829) (-1094.978) * (-1095.846) (-1097.769) (-1096.548) [-1098.621] -- 0:00:16
734000 -- (-1095.335) (-1098.539) [-1094.638] (-1095.996) * [-1095.240] (-1097.326) (-1096.650) (-1095.162) -- 0:00:16
734500 -- [-1095.371] (-1096.081) (-1096.949) (-1095.745) * (-1097.039) (-1095.553) (-1096.564) [-1097.265] -- 0:00:16
735000 -- [-1097.442] (-1101.467) (-1097.760) (-1095.818) * (-1096.115) (-1095.681) (-1098.920) [-1096.496] -- 0:00:16
Average standard deviation of split frequencies: 0.008366
735500 -- (-1096.863) [-1096.362] (-1098.214) (-1096.831) * (-1095.646) [-1098.782] (-1094.867) (-1095.326) -- 0:00:16
736000 -- (-1095.782) (-1096.357) (-1098.733) [-1098.357] * [-1096.303] (-1095.925) (-1096.130) (-1097.295) -- 0:00:16
736500 -- [-1096.013] (-1097.499) (-1096.450) (-1095.550) * (-1097.082) [-1096.165] (-1102.405) (-1097.291) -- 0:00:16
737000 -- (-1095.449) (-1096.746) [-1095.543] (-1098.180) * (-1098.127) [-1094.820] (-1096.246) (-1096.773) -- 0:00:16
737500 -- (-1095.789) [-1100.067] (-1094.777) (-1099.708) * (-1097.521) (-1096.217) [-1097.132] (-1096.401) -- 0:00:16
738000 -- (-1095.759) (-1097.873) [-1095.826] (-1097.188) * (-1094.921) [-1096.800] (-1095.387) (-1097.580) -- 0:00:16
738500 -- (-1096.655) (-1096.455) [-1095.163] (-1098.157) * (-1096.944) (-1096.282) [-1097.577] (-1100.136) -- 0:00:16
739000 -- [-1095.512] (-1097.604) (-1095.862) (-1095.641) * (-1097.742) (-1096.522) [-1101.721] (-1098.490) -- 0:00:16
739500 -- [-1098.557] (-1098.784) (-1095.124) (-1094.680) * (-1097.543) [-1097.842] (-1100.064) (-1095.834) -- 0:00:16
740000 -- (-1096.515) [-1096.131] (-1095.009) (-1100.190) * (-1094.683) [-1096.703] (-1099.607) (-1097.189) -- 0:00:16
Average standard deviation of split frequencies: 0.008147
740500 -- (-1097.540) (-1097.567) (-1096.140) [-1098.358] * [-1095.647] (-1097.100) (-1097.067) (-1095.799) -- 0:00:16
741000 -- (-1097.544) (-1095.833) [-1097.553] (-1095.830) * [-1096.735] (-1095.701) (-1096.354) (-1095.134) -- 0:00:16
741500 -- [-1097.417] (-1095.698) (-1098.184) (-1095.750) * (-1097.138) (-1099.336) [-1096.805] (-1098.046) -- 0:00:16
742000 -- (-1102.009) [-1095.157] (-1096.579) (-1095.780) * (-1097.666) (-1098.511) [-1101.176] (-1095.982) -- 0:00:16
742500 -- (-1100.693) [-1095.267] (-1094.779) (-1099.060) * [-1096.406] (-1098.083) (-1101.736) (-1096.166) -- 0:00:16
743000 -- (-1097.237) (-1095.315) [-1097.082] (-1095.389) * (-1097.959) (-1095.808) [-1096.904] (-1097.894) -- 0:00:16
743500 -- (-1098.883) [-1096.983] (-1096.575) (-1096.120) * (-1097.261) (-1096.092) [-1096.374] (-1095.401) -- 0:00:16
744000 -- (-1098.434) (-1098.043) [-1097.958] (-1096.023) * (-1096.347) (-1097.919) (-1095.555) [-1096.247] -- 0:00:16
744500 -- (-1100.324) [-1094.808] (-1097.892) (-1099.588) * [-1095.959] (-1095.850) (-1096.340) (-1095.181) -- 0:00:16
745000 -- (-1100.582) (-1096.351) (-1100.150) [-1096.120] * (-1100.017) [-1097.520] (-1101.483) (-1097.810) -- 0:00:16
Average standard deviation of split frequencies: 0.007920
745500 -- (-1097.017) (-1098.341) (-1104.353) [-1096.953] * (-1096.993) (-1097.365) [-1096.011] (-1098.142) -- 0:00:16
746000 -- (-1096.764) (-1098.263) [-1097.978] (-1096.221) * (-1096.855) [-1095.880] (-1099.490) (-1095.460) -- 0:00:16
746500 -- (-1097.825) [-1098.256] (-1097.913) (-1095.724) * (-1097.083) (-1096.205) [-1095.380] (-1095.355) -- 0:00:15
747000 -- (-1098.574) (-1095.926) [-1095.338] (-1099.208) * [-1096.613] (-1096.392) (-1098.691) (-1099.722) -- 0:00:15
747500 -- (-1098.615) [-1096.143] (-1095.518) (-1103.465) * [-1097.964] (-1097.852) (-1098.601) (-1101.409) -- 0:00:15
748000 -- (-1095.726) [-1095.429] (-1097.903) (-1097.262) * (-1098.076) (-1096.215) [-1098.412] (-1101.309) -- 0:00:15
748500 -- (-1096.345) [-1095.281] (-1099.963) (-1096.564) * (-1096.560) [-1095.921] (-1096.939) (-1096.961) -- 0:00:15
749000 -- (-1094.723) [-1095.159] (-1095.417) (-1098.644) * [-1097.358] (-1095.340) (-1098.763) (-1097.855) -- 0:00:15
749500 -- (-1097.840) (-1096.856) [-1097.607] (-1096.665) * (-1096.821) (-1095.428) [-1098.290] (-1097.661) -- 0:00:15
750000 -- (-1096.432) (-1095.485) [-1099.664] (-1103.162) * (-1096.309) [-1096.219] (-1095.662) (-1095.210) -- 0:00:15
Average standard deviation of split frequencies: 0.007703
750500 -- (-1095.293) (-1096.474) (-1097.301) [-1097.088] * (-1096.253) (-1098.960) (-1098.229) [-1096.174] -- 0:00:15
751000 -- [-1096.450] (-1095.498) (-1099.044) (-1096.452) * (-1096.358) (-1095.401) [-1096.755] (-1095.695) -- 0:00:15
751500 -- [-1095.502] (-1095.887) (-1096.372) (-1097.561) * (-1098.009) (-1097.194) (-1098.302) [-1095.226] -- 0:00:15
752000 -- (-1096.300) (-1095.898) (-1099.070) [-1097.421] * (-1095.611) (-1097.046) (-1096.643) [-1095.234] -- 0:00:15
752500 -- (-1100.072) [-1097.564] (-1099.147) (-1098.332) * (-1096.243) (-1096.916) [-1095.664] (-1100.353) -- 0:00:15
753000 -- [-1095.471] (-1098.058) (-1099.926) (-1101.065) * (-1097.707) (-1097.115) [-1096.822] (-1103.749) -- 0:00:15
753500 -- (-1098.347) (-1096.656) [-1099.566] (-1097.283) * [-1096.581] (-1099.751) (-1099.521) (-1096.700) -- 0:00:15
754000 -- (-1104.867) [-1098.393] (-1102.203) (-1096.677) * [-1097.616] (-1095.648) (-1097.306) (-1095.836) -- 0:00:15
754500 -- (-1104.786) (-1100.732) (-1102.233) [-1095.707] * [-1094.872] (-1094.785) (-1095.459) (-1095.960) -- 0:00:15
755000 -- (-1097.128) (-1094.997) [-1096.699] (-1095.612) * (-1095.047) (-1096.569) [-1097.948] (-1096.038) -- 0:00:15
Average standard deviation of split frequencies: 0.007732
755500 -- (-1099.175) [-1095.286] (-1095.933) (-1096.478) * [-1095.014] (-1096.625) (-1096.951) (-1096.990) -- 0:00:15
756000 -- (-1099.723) [-1095.713] (-1098.441) (-1096.214) * [-1095.047] (-1096.272) (-1097.536) (-1096.020) -- 0:00:15
756500 -- (-1097.042) (-1101.173) (-1096.683) [-1096.309] * [-1095.268] (-1097.244) (-1096.136) (-1096.381) -- 0:00:15
757000 -- [-1096.446] (-1096.891) (-1097.239) (-1102.305) * (-1096.345) [-1097.950] (-1098.326) (-1098.553) -- 0:00:15
757500 -- (-1096.646) (-1096.752) [-1099.795] (-1094.821) * (-1098.837) (-1096.437) (-1097.443) [-1101.907] -- 0:00:15
758000 -- (-1097.060) (-1097.663) (-1103.805) [-1096.457] * (-1095.289) (-1095.451) [-1099.490] (-1097.241) -- 0:00:15
758500 -- (-1098.776) [-1096.300] (-1096.685) (-1108.171) * (-1097.615) [-1096.082] (-1095.399) (-1096.449) -- 0:00:15
759000 -- (-1097.494) [-1094.984] (-1095.822) (-1104.323) * (-1097.214) [-1095.984] (-1098.493) (-1099.352) -- 0:00:15
759500 -- [-1095.582] (-1095.921) (-1099.860) (-1096.580) * (-1098.208) (-1099.178) (-1095.490) [-1099.958] -- 0:00:15
760000 -- [-1102.383] (-1096.446) (-1097.510) (-1098.985) * (-1097.922) (-1097.850) [-1095.158] (-1097.905) -- 0:00:15
Average standard deviation of split frequencies: 0.007767
760500 -- (-1096.355) [-1096.523] (-1100.276) (-1097.875) * (-1097.960) [-1096.091] (-1096.967) (-1099.296) -- 0:00:15
761000 -- (-1098.303) (-1097.352) (-1096.652) [-1097.580] * (-1096.620) [-1097.158] (-1098.280) (-1095.768) -- 0:00:15
761500 -- (-1096.719) (-1099.570) (-1097.998) [-1097.703] * (-1096.937) [-1095.165] (-1100.466) (-1095.774) -- 0:00:15
762000 -- (-1097.285) (-1098.971) [-1098.599] (-1099.306) * (-1095.275) (-1096.432) [-1099.080] (-1097.521) -- 0:00:14
762500 -- (-1097.054) (-1099.503) (-1097.703) [-1098.822] * (-1098.247) (-1096.065) [-1096.816] (-1096.387) -- 0:00:14
763000 -- [-1100.043] (-1096.764) (-1096.932) (-1099.340) * (-1096.369) [-1098.509] (-1096.695) (-1098.248) -- 0:00:14
763500 -- (-1098.032) (-1102.497) [-1099.622] (-1098.284) * (-1096.250) (-1098.917) [-1097.877] (-1099.612) -- 0:00:14
764000 -- (-1095.904) (-1099.000) (-1100.005) [-1096.774] * (-1095.491) (-1103.336) (-1096.086) [-1098.396] -- 0:00:14
764500 -- (-1096.228) (-1099.399) (-1099.885) [-1095.856] * (-1095.688) (-1100.056) (-1097.883) [-1096.055] -- 0:00:14
765000 -- (-1096.363) [-1097.935] (-1101.510) (-1095.304) * [-1094.791] (-1095.059) (-1096.125) (-1097.068) -- 0:00:14
Average standard deviation of split frequencies: 0.007262
765500 -- [-1099.013] (-1097.976) (-1102.264) (-1095.046) * [-1097.281] (-1095.837) (-1098.123) (-1095.733) -- 0:00:14
766000 -- (-1096.186) [-1097.893] (-1099.627) (-1096.691) * (-1097.858) [-1095.880] (-1096.521) (-1097.229) -- 0:00:14
766500 -- [-1096.777] (-1096.245) (-1096.940) (-1096.798) * (-1097.276) [-1095.884] (-1095.299) (-1098.038) -- 0:00:14
767000 -- (-1097.171) (-1097.088) (-1097.153) [-1096.388] * [-1096.089] (-1097.260) (-1095.880) (-1097.744) -- 0:00:14
767500 -- [-1096.149] (-1096.774) (-1097.656) (-1096.009) * (-1100.512) (-1097.563) (-1100.318) [-1097.543] -- 0:00:14
768000 -- (-1097.468) (-1095.286) (-1099.187) [-1095.627] * [-1097.998] (-1100.081) (-1095.683) (-1099.540) -- 0:00:14
768500 -- (-1096.971) (-1099.552) [-1096.254] (-1094.938) * [-1097.211] (-1096.698) (-1099.416) (-1096.321) -- 0:00:14
769000 -- [-1095.555] (-1098.465) (-1096.594) (-1094.878) * (-1096.659) (-1095.165) [-1097.352] (-1097.408) -- 0:00:14
769500 -- (-1100.063) [-1095.140] (-1096.169) (-1095.895) * (-1095.952) [-1094.871] (-1099.116) (-1097.236) -- 0:00:14
770000 -- (-1098.093) (-1099.163) [-1095.493] (-1097.989) * (-1095.996) (-1095.724) (-1095.164) [-1096.180] -- 0:00:14
Average standard deviation of split frequencies: 0.007096
770500 -- (-1097.611) (-1097.667) [-1097.037] (-1096.502) * (-1095.176) [-1096.173] (-1096.267) (-1094.752) -- 0:00:14
771000 -- (-1098.451) (-1101.418) [-1100.787] (-1096.423) * [-1095.086] (-1095.603) (-1098.381) (-1098.074) -- 0:00:14
771500 -- (-1097.043) [-1096.608] (-1103.641) (-1095.048) * (-1094.577) (-1097.607) [-1096.343] (-1097.700) -- 0:00:14
772000 -- (-1097.602) (-1097.065) (-1097.351) [-1094.645] * (-1095.737) (-1095.856) [-1098.417] (-1097.660) -- 0:00:14
772500 -- (-1096.368) [-1095.579] (-1096.259) (-1095.146) * (-1097.546) (-1102.305) [-1097.829] (-1097.448) -- 0:00:14
773000 -- (-1096.108) (-1100.000) (-1097.013) [-1097.826] * (-1098.106) (-1096.009) [-1099.940] (-1098.650) -- 0:00:14
773500 -- [-1096.514] (-1098.173) (-1095.240) (-1097.354) * (-1095.648) (-1096.517) (-1097.504) [-1099.147] -- 0:00:14
774000 -- (-1095.845) [-1096.806] (-1099.190) (-1098.428) * (-1095.152) (-1096.417) [-1096.280] (-1098.961) -- 0:00:14
774500 -- (-1095.683) [-1094.893] (-1100.057) (-1094.775) * (-1095.683) (-1096.055) (-1099.545) [-1097.183] -- 0:00:14
775000 -- (-1096.040) (-1096.334) [-1096.609] (-1096.319) * (-1096.506) (-1096.726) [-1097.130] (-1095.291) -- 0:00:14
Average standard deviation of split frequencies: 0.007006
775500 -- (-1096.870) [-1096.609] (-1095.787) (-1098.451) * [-1095.313] (-1094.489) (-1097.831) (-1095.722) -- 0:00:14
776000 -- (-1095.882) (-1095.766) (-1099.817) [-1097.291] * (-1096.910) [-1094.829] (-1098.887) (-1097.371) -- 0:00:14
776500 -- (-1098.374) (-1095.075) [-1097.384] (-1095.194) * (-1097.240) [-1096.404] (-1095.872) (-1098.225) -- 0:00:14
777000 -- [-1096.887] (-1104.222) (-1101.044) (-1095.316) * (-1097.770) [-1098.576] (-1099.591) (-1096.490) -- 0:00:14
777500 -- (-1096.554) (-1103.845) [-1098.893] (-1095.871) * (-1102.696) (-1095.847) (-1096.480) [-1096.090] -- 0:00:14
778000 -- (-1097.231) (-1101.932) (-1101.585) [-1096.582] * [-1100.207] (-1096.368) (-1097.767) (-1096.238) -- 0:00:13
778500 -- [-1096.323] (-1100.245) (-1102.316) (-1098.111) * [-1095.537] (-1098.100) (-1098.627) (-1096.371) -- 0:00:13
779000 -- (-1096.949) [-1099.233] (-1098.105) (-1096.659) * (-1097.588) [-1097.664] (-1099.603) (-1097.462) -- 0:00:13
779500 -- [-1096.138] (-1097.079) (-1098.320) (-1098.229) * (-1098.544) [-1096.172] (-1096.323) (-1102.463) -- 0:00:13
780000 -- (-1094.820) (-1097.521) (-1097.162) [-1097.127] * (-1098.440) (-1095.992) [-1095.450] (-1096.296) -- 0:00:13
Average standard deviation of split frequencies: 0.006280
780500 -- (-1096.140) [-1096.916] (-1098.186) (-1096.864) * (-1096.148) [-1096.180] (-1097.308) (-1100.339) -- 0:00:13
781000 -- (-1095.181) (-1098.426) (-1095.336) [-1097.853] * (-1101.628) (-1098.533) [-1097.265] (-1098.382) -- 0:00:13
781500 -- (-1096.777) (-1096.944) [-1095.480] (-1095.911) * (-1095.395) (-1098.160) [-1097.359] (-1100.925) -- 0:00:13
782000 -- (-1100.261) (-1095.433) [-1095.954] (-1095.419) * (-1097.485) [-1096.378] (-1100.986) (-1094.900) -- 0:00:13
782500 -- (-1098.006) (-1095.871) (-1096.917) [-1096.279] * [-1098.169] (-1095.072) (-1095.789) (-1095.448) -- 0:00:13
783000 -- (-1096.471) [-1096.414] (-1097.114) (-1097.179) * (-1097.153) (-1101.262) (-1095.560) [-1095.443] -- 0:00:13
783500 -- (-1095.228) (-1097.915) (-1095.889) [-1095.716] * (-1095.021) (-1097.298) [-1096.738] (-1101.088) -- 0:00:13
784000 -- (-1097.160) [-1095.961] (-1095.307) (-1096.552) * (-1096.240) (-1096.341) [-1096.804] (-1096.203) -- 0:00:13
784500 -- (-1095.938) (-1097.622) (-1098.583) [-1097.475] * (-1095.865) (-1096.519) (-1097.746) [-1095.671] -- 0:00:13
785000 -- (-1096.301) (-1098.126) [-1097.943] (-1098.842) * (-1096.697) [-1095.517] (-1096.534) (-1097.141) -- 0:00:13
Average standard deviation of split frequencies: 0.006437
785500 -- (-1097.343) (-1095.174) [-1098.358] (-1096.812) * (-1095.949) (-1098.515) (-1098.365) [-1095.558] -- 0:00:13
786000 -- (-1095.136) [-1098.891] (-1100.191) (-1095.929) * [-1098.015] (-1098.723) (-1095.949) (-1095.835) -- 0:00:13
786500 -- (-1097.901) (-1098.711) (-1097.748) [-1096.444] * (-1097.116) (-1096.945) (-1095.299) [-1095.890] -- 0:00:13
787000 -- (-1098.585) (-1099.521) [-1100.655] (-1096.730) * [-1098.158] (-1099.690) (-1095.629) (-1095.035) -- 0:00:13
787500 -- [-1096.740] (-1098.177) (-1096.017) (-1095.071) * (-1096.118) (-1095.822) (-1101.327) [-1096.836] -- 0:00:13
788000 -- (-1094.896) [-1096.775] (-1100.460) (-1097.320) * (-1096.091) [-1095.703] (-1099.272) (-1095.932) -- 0:00:13
788500 -- [-1095.210] (-1097.332) (-1100.453) (-1097.376) * (-1098.602) [-1096.169] (-1099.578) (-1097.090) -- 0:00:13
789000 -- (-1096.194) [-1097.015] (-1097.882) (-1096.609) * (-1100.854) [-1096.765] (-1102.983) (-1096.591) -- 0:00:13
789500 -- (-1098.448) (-1098.980) [-1095.380] (-1097.232) * (-1095.757) [-1095.572] (-1097.615) (-1096.199) -- 0:00:13
790000 -- [-1097.592] (-1103.461) (-1096.361) (-1103.725) * (-1098.021) (-1096.868) [-1095.891] (-1098.134) -- 0:00:13
Average standard deviation of split frequencies: 0.006876
790500 -- (-1096.645) (-1103.045) [-1098.312] (-1098.041) * (-1098.609) (-1096.813) (-1095.078) [-1095.856] -- 0:00:13
791000 -- (-1099.938) [-1099.184] (-1096.404) (-1095.343) * (-1096.316) (-1096.933) (-1095.477) [-1098.552] -- 0:00:13
791500 -- [-1095.048] (-1096.252) (-1099.058) (-1096.705) * [-1095.691] (-1097.958) (-1096.087) (-1096.229) -- 0:00:13
792000 -- (-1097.868) (-1095.312) (-1102.647) [-1095.184] * (-1097.379) (-1097.798) [-1097.106] (-1096.489) -- 0:00:13
792500 -- (-1096.208) (-1097.502) (-1095.876) [-1096.616] * (-1094.539) [-1098.117] (-1096.440) (-1099.064) -- 0:00:13
793000 -- (-1098.851) (-1097.005) (-1095.821) [-1096.325] * (-1096.743) [-1096.873] (-1097.086) (-1096.601) -- 0:00:13
793500 -- (-1097.463) (-1097.252) [-1095.734] (-1097.353) * (-1096.899) [-1095.460] (-1096.382) (-1095.025) -- 0:00:13
794000 -- (-1099.872) [-1099.054] (-1101.401) (-1098.603) * (-1096.377) (-1096.446) (-1097.166) [-1097.345] -- 0:00:12
794500 -- (-1097.211) [-1098.515] (-1096.793) (-1097.016) * (-1099.409) [-1096.536] (-1098.145) (-1096.049) -- 0:00:12
795000 -- [-1098.448] (-1097.430) (-1097.439) (-1096.490) * (-1094.980) (-1096.970) [-1098.416] (-1095.802) -- 0:00:12
Average standard deviation of split frequencies: 0.006791
795500 -- (-1103.240) (-1094.655) [-1095.193] (-1095.954) * [-1095.418] (-1096.860) (-1098.705) (-1101.290) -- 0:00:12
796000 -- [-1095.665] (-1095.242) (-1096.518) (-1097.639) * (-1099.135) [-1097.113] (-1096.048) (-1096.812) -- 0:00:12
796500 -- (-1096.424) (-1097.869) [-1097.820] (-1100.499) * (-1096.492) (-1096.027) (-1104.137) [-1095.415] -- 0:00:12
797000 -- (-1096.772) [-1097.460] (-1095.536) (-1100.314) * (-1096.555) (-1097.085) (-1099.010) [-1095.710] -- 0:00:12
797500 -- (-1096.743) [-1097.755] (-1098.780) (-1095.798) * (-1096.145) (-1095.607) (-1094.787) [-1094.487] -- 0:00:12
798000 -- (-1095.925) (-1097.376) (-1095.470) [-1096.300] * [-1094.653] (-1096.521) (-1094.637) (-1097.876) -- 0:00:12
798500 -- (-1097.666) (-1097.649) (-1097.451) [-1098.579] * (-1095.204) (-1100.157) (-1101.595) [-1097.407] -- 0:00:12
799000 -- (-1097.062) [-1096.770] (-1097.981) (-1096.634) * [-1097.728] (-1097.314) (-1099.630) (-1097.482) -- 0:00:12
799500 -- [-1097.798] (-1095.538) (-1095.220) (-1097.769) * (-1096.782) (-1096.626) (-1095.745) [-1097.450] -- 0:00:12
800000 -- (-1096.695) (-1095.923) [-1095.697] (-1096.080) * (-1096.100) (-1096.248) [-1096.364] (-1096.420) -- 0:00:12
Average standard deviation of split frequencies: 0.006437
800500 -- [-1095.278] (-1098.393) (-1098.804) (-1095.413) * [-1095.986] (-1097.256) (-1096.426) (-1097.430) -- 0:00:12
801000 -- (-1095.331) (-1094.654) [-1095.231] (-1095.701) * (-1096.003) [-1096.006] (-1096.204) (-1095.880) -- 0:00:12
801500 -- (-1098.235) (-1097.733) (-1095.488) [-1096.260] * (-1096.880) [-1097.292] (-1095.584) (-1097.286) -- 0:00:12
802000 -- (-1100.121) [-1097.090] (-1097.671) (-1095.712) * [-1098.282] (-1097.866) (-1096.387) (-1104.621) -- 0:00:12
802500 -- (-1095.151) (-1099.633) [-1096.876] (-1098.045) * [-1098.724] (-1098.568) (-1095.416) (-1097.404) -- 0:00:12
803000 -- [-1096.995] (-1098.036) (-1099.042) (-1098.522) * [-1096.813] (-1096.771) (-1095.291) (-1095.470) -- 0:00:12
803500 -- [-1096.544] (-1095.943) (-1096.813) (-1097.317) * (-1097.734) (-1098.739) (-1095.632) [-1095.611] -- 0:00:12
804000 -- (-1096.257) (-1095.242) [-1101.003] (-1098.214) * [-1096.969] (-1098.840) (-1097.275) (-1094.965) -- 0:00:12
804500 -- (-1096.129) (-1100.774) [-1096.414] (-1096.201) * (-1096.392) [-1095.722] (-1098.259) (-1095.104) -- 0:00:12
805000 -- (-1096.019) (-1098.162) (-1095.645) [-1095.746] * [-1096.551] (-1098.303) (-1096.204) (-1095.905) -- 0:00:12
Average standard deviation of split frequencies: 0.006551
805500 -- (-1097.018) [-1095.638] (-1098.876) (-1096.349) * [-1095.736] (-1100.498) (-1097.545) (-1099.607) -- 0:00:12
806000 -- (-1096.936) [-1096.594] (-1097.612) (-1094.894) * (-1095.205) [-1098.869] (-1096.217) (-1094.946) -- 0:00:12
806500 -- (-1096.200) [-1095.652] (-1098.343) (-1095.909) * (-1096.240) [-1097.987] (-1097.314) (-1096.318) -- 0:00:12
807000 -- (-1097.501) (-1096.185) [-1096.534] (-1096.400) * [-1098.375] (-1100.549) (-1097.178) (-1096.186) -- 0:00:12
807500 -- [-1099.197] (-1099.458) (-1096.852) (-1095.545) * [-1096.736] (-1096.139) (-1096.438) (-1095.644) -- 0:00:12
808000 -- (-1097.669) (-1101.111) [-1097.354] (-1095.507) * (-1096.673) (-1098.729) (-1097.073) [-1097.809] -- 0:00:12
808500 -- (-1095.579) (-1098.469) [-1094.713] (-1095.507) * (-1102.076) [-1096.216] (-1097.004) (-1097.444) -- 0:00:12
809000 -- (-1100.980) (-1104.068) [-1097.356] (-1097.916) * (-1097.922) (-1097.543) [-1096.656] (-1097.649) -- 0:00:12
809500 -- (-1094.948) (-1095.605) [-1096.739] (-1096.144) * (-1095.459) (-1095.554) (-1099.970) [-1096.573] -- 0:00:12
810000 -- (-1097.048) [-1096.211] (-1094.757) (-1095.721) * [-1095.813] (-1100.998) (-1097.515) (-1095.105) -- 0:00:11
Average standard deviation of split frequencies: 0.007404
810500 -- (-1096.580) [-1097.671] (-1096.573) (-1096.158) * [-1096.276] (-1096.496) (-1100.351) (-1098.974) -- 0:00:11
811000 -- (-1100.317) (-1095.380) [-1095.412] (-1097.292) * (-1096.003) (-1100.846) [-1097.148] (-1096.875) -- 0:00:11
811500 -- [-1097.281] (-1097.915) (-1096.032) (-1102.176) * (-1096.735) [-1095.563] (-1100.126) (-1100.371) -- 0:00:11
812000 -- [-1100.258] (-1097.259) (-1094.906) (-1097.815) * [-1095.634] (-1101.650) (-1095.500) (-1101.296) -- 0:00:11
812500 -- (-1100.558) (-1096.712) [-1095.292] (-1095.117) * (-1095.715) [-1098.070] (-1097.888) (-1095.897) -- 0:00:11
813000 -- (-1099.394) [-1096.496] (-1108.737) (-1095.588) * (-1094.861) (-1096.987) [-1096.738] (-1095.697) -- 0:00:11
813500 -- (-1099.011) [-1095.306] (-1102.971) (-1101.391) * (-1094.912) (-1095.526) [-1096.521] (-1095.927) -- 0:00:11
814000 -- (-1097.079) (-1099.159) (-1097.009) [-1095.609] * [-1095.619] (-1095.294) (-1095.826) (-1102.354) -- 0:00:11
814500 -- (-1096.423) (-1096.898) (-1095.096) [-1096.066] * [-1095.543] (-1099.005) (-1096.798) (-1097.368) -- 0:00:11
815000 -- (-1099.475) [-1096.524] (-1099.575) (-1096.066) * [-1097.733] (-1098.516) (-1096.129) (-1097.945) -- 0:00:11
Average standard deviation of split frequencies: 0.007895
815500 -- [-1097.341] (-1096.988) (-1095.372) (-1095.386) * (-1097.681) (-1095.830) (-1096.034) [-1096.950] -- 0:00:11
816000 -- (-1097.691) [-1096.020] (-1097.047) (-1104.732) * (-1098.322) (-1096.581) [-1096.044] (-1095.992) -- 0:00:11
816500 -- (-1098.413) (-1099.507) [-1095.751] (-1098.877) * [-1094.952] (-1097.027) (-1095.569) (-1095.114) -- 0:00:11
817000 -- [-1097.869] (-1095.810) (-1096.025) (-1095.297) * (-1095.773) (-1094.556) [-1096.639] (-1098.071) -- 0:00:11
817500 -- (-1096.876) (-1095.423) (-1097.981) [-1099.548] * [-1095.907] (-1095.377) (-1094.989) (-1096.658) -- 0:00:11
818000 -- (-1095.143) (-1095.321) [-1097.686] (-1099.052) * (-1097.857) [-1098.424] (-1098.053) (-1097.290) -- 0:00:11
818500 -- (-1095.606) [-1097.774] (-1097.302) (-1098.201) * (-1096.077) [-1095.889] (-1095.461) (-1101.403) -- 0:00:11
819000 -- (-1095.431) (-1098.059) (-1100.193) [-1095.423] * (-1096.140) (-1096.470) (-1097.337) [-1100.556] -- 0:00:11
819500 -- (-1095.736) (-1098.791) (-1096.971) [-1095.689] * [-1096.787] (-1096.567) (-1098.397) (-1097.865) -- 0:00:11
820000 -- (-1098.243) (-1096.374) [-1098.122] (-1095.755) * (-1095.998) (-1095.185) (-1097.621) [-1095.928] -- 0:00:11
Average standard deviation of split frequencies: 0.007927
820500 -- [-1098.820] (-1097.153) (-1098.711) (-1095.305) * (-1095.669) [-1095.133] (-1099.461) (-1097.144) -- 0:00:11
821000 -- (-1097.472) [-1096.573] (-1096.009) (-1095.551) * (-1096.259) [-1097.729] (-1097.847) (-1097.846) -- 0:00:11
821500 -- (-1094.750) [-1095.958] (-1094.849) (-1097.206) * (-1096.205) (-1096.932) (-1096.194) [-1098.074] -- 0:00:11
822000 -- [-1097.154] (-1094.567) (-1095.179) (-1096.686) * (-1095.307) (-1095.458) (-1100.092) [-1096.413] -- 0:00:11
822500 -- (-1099.145) [-1095.177] (-1095.812) (-1095.831) * [-1095.496] (-1096.457) (-1099.947) (-1097.160) -- 0:00:11
823000 -- (-1098.113) (-1094.676) (-1096.514) [-1096.438] * [-1098.921] (-1094.644) (-1100.279) (-1095.323) -- 0:00:11
823500 -- [-1094.868] (-1096.890) (-1099.376) (-1095.852) * (-1098.207) (-1095.192) (-1099.959) [-1099.151] -- 0:00:11
824000 -- (-1096.441) [-1095.905] (-1099.586) (-1097.674) * (-1097.060) (-1096.836) (-1097.984) [-1097.513] -- 0:00:11
824500 -- (-1099.757) [-1097.117] (-1098.509) (-1098.580) * (-1098.215) (-1095.604) (-1095.542) [-1098.332] -- 0:00:11
825000 -- (-1096.276) (-1095.082) (-1098.760) [-1095.269] * (-1095.876) [-1095.758] (-1098.825) (-1095.532) -- 0:00:11
Average standard deviation of split frequencies: 0.008066
825500 -- (-1095.873) (-1095.458) [-1098.168] (-1098.660) * (-1099.270) (-1097.907) (-1095.783) [-1095.837] -- 0:00:10
826000 -- [-1097.075] (-1095.596) (-1097.481) (-1095.706) * (-1100.130) [-1097.517] (-1097.510) (-1098.854) -- 0:00:10
826500 -- (-1095.614) [-1097.105] (-1095.799) (-1095.484) * (-1096.230) (-1094.980) [-1097.734] (-1096.676) -- 0:00:10
827000 -- [-1094.576] (-1098.299) (-1096.612) (-1098.218) * (-1096.793) (-1095.017) (-1097.367) [-1097.776] -- 0:00:10
827500 -- (-1094.741) (-1098.444) [-1096.612] (-1097.572) * (-1098.164) [-1094.809] (-1101.683) (-1096.492) -- 0:00:10
828000 -- [-1097.947] (-1100.907) (-1096.383) (-1101.545) * (-1098.696) [-1097.355] (-1096.691) (-1097.906) -- 0:00:10
828500 -- (-1096.275) (-1098.397) [-1096.123] (-1101.657) * (-1096.142) (-1096.431) [-1095.406] (-1098.364) -- 0:00:10
829000 -- (-1097.627) (-1096.305) (-1096.730) [-1099.815] * (-1099.735) [-1094.624] (-1095.234) (-1099.141) -- 0:00:10
829500 -- (-1096.328) (-1094.962) [-1096.438] (-1099.857) * (-1095.031) (-1094.785) [-1097.260] (-1098.069) -- 0:00:10
830000 -- [-1097.394] (-1096.059) (-1097.000) (-1096.076) * [-1095.528] (-1097.227) (-1095.037) (-1095.417) -- 0:00:10
Average standard deviation of split frequencies: 0.008967
830500 -- (-1097.450) [-1096.115] (-1095.574) (-1101.234) * (-1096.692) (-1094.828) [-1095.059] (-1095.890) -- 0:00:10
831000 -- [-1095.900] (-1094.740) (-1096.226) (-1100.100) * (-1097.502) (-1094.928) [-1095.241] (-1096.975) -- 0:00:10
831500 -- (-1094.792) [-1095.879] (-1098.728) (-1097.250) * (-1098.648) (-1096.326) [-1095.431] (-1097.061) -- 0:00:10
832000 -- [-1095.097] (-1096.992) (-1096.318) (-1101.331) * (-1095.942) (-1102.038) [-1097.094] (-1097.449) -- 0:00:10
832500 -- (-1096.209) (-1095.948) (-1100.546) [-1097.706] * [-1095.176] (-1099.480) (-1097.193) (-1095.389) -- 0:00:10
833000 -- (-1101.929) (-1097.876) (-1098.390) [-1096.506] * (-1095.130) (-1097.627) [-1097.109] (-1095.578) -- 0:00:10
833500 -- (-1106.981) (-1097.679) [-1099.201] (-1098.537) * [-1096.878] (-1095.887) (-1099.564) (-1094.643) -- 0:00:10
834000 -- (-1099.968) [-1097.535] (-1102.431) (-1097.038) * (-1096.580) (-1096.297) [-1096.319] (-1095.570) -- 0:00:10
834500 -- (-1096.647) (-1100.385) (-1102.948) [-1095.011] * [-1095.304] (-1098.199) (-1099.374) (-1098.762) -- 0:00:10
835000 -- (-1096.517) [-1097.625] (-1099.135) (-1095.388) * [-1096.294] (-1095.709) (-1096.713) (-1100.363) -- 0:00:10
Average standard deviation of split frequencies: 0.009285
835500 -- [-1096.485] (-1097.044) (-1099.166) (-1096.657) * [-1097.054] (-1096.077) (-1098.404) (-1098.051) -- 0:00:10
836000 -- [-1096.245] (-1096.104) (-1097.023) (-1098.730) * (-1097.018) (-1097.243) [-1099.591] (-1096.448) -- 0:00:10
836500 -- (-1098.743) (-1096.002) (-1099.064) [-1098.211] * [-1095.640] (-1095.649) (-1098.343) (-1100.391) -- 0:00:10
837000 -- [-1101.224] (-1095.873) (-1096.917) (-1100.454) * [-1097.769] (-1099.125) (-1098.257) (-1098.149) -- 0:00:10
837500 -- (-1096.997) [-1095.632] (-1100.824) (-1098.690) * (-1097.959) (-1097.961) (-1100.429) [-1097.613] -- 0:00:10
838000 -- (-1095.695) (-1095.850) (-1096.358) [-1094.904] * [-1096.005] (-1098.072) (-1097.832) (-1098.222) -- 0:00:10
838500 -- (-1095.167) [-1097.009] (-1097.631) (-1098.042) * [-1095.018] (-1095.826) (-1099.475) (-1096.605) -- 0:00:10
839000 -- (-1102.770) [-1095.822] (-1097.564) (-1096.298) * [-1098.722] (-1098.276) (-1098.544) (-1100.787) -- 0:00:10
839500 -- (-1100.825) (-1098.724) (-1096.128) [-1096.638] * (-1095.643) (-1098.289) (-1095.978) [-1095.392] -- 0:00:10
840000 -- (-1098.556) [-1096.036] (-1095.987) (-1098.697) * (-1097.028) (-1096.013) [-1095.652] (-1096.357) -- 0:00:10
Average standard deviation of split frequencies: 0.009608
840500 -- (-1095.187) [-1097.419] (-1096.641) (-1099.236) * (-1099.435) (-1095.087) (-1095.323) [-1096.060] -- 0:00:10
841000 -- (-1097.853) (-1096.111) (-1096.992) [-1095.166] * (-1100.748) (-1096.760) [-1095.117] (-1096.086) -- 0:00:10
841500 -- (-1099.953) [-1095.361] (-1104.257) (-1096.909) * (-1100.592) (-1095.524) (-1094.644) [-1096.192] -- 0:00:09
842000 -- (-1096.559) (-1097.156) (-1095.501) [-1095.986] * [-1099.526] (-1097.111) (-1094.522) (-1095.675) -- 0:00:09
842500 -- (-1095.254) (-1098.728) (-1096.633) [-1095.782] * [-1095.902] (-1095.800) (-1098.475) (-1094.899) -- 0:00:09
843000 -- [-1095.418] (-1097.110) (-1095.137) (-1095.347) * [-1097.070] (-1095.801) (-1096.099) (-1095.737) -- 0:00:09
843500 -- (-1095.546) (-1097.914) (-1098.984) [-1095.148] * (-1094.989) [-1098.836] (-1096.465) (-1096.455) -- 0:00:09
844000 -- (-1099.134) [-1095.364] (-1098.572) (-1096.125) * (-1094.872) (-1096.378) [-1095.276] (-1097.111) -- 0:00:09
844500 -- (-1099.032) (-1102.016) (-1098.599) [-1098.461] * (-1098.254) (-1096.992) (-1096.612) [-1095.566] -- 0:00:09
845000 -- [-1097.218] (-1103.491) (-1097.668) (-1098.938) * (-1097.535) (-1097.998) (-1097.433) [-1098.212] -- 0:00:09
Average standard deviation of split frequencies: 0.009584
845500 -- (-1101.223) (-1100.981) (-1097.177) [-1098.662] * [-1098.697] (-1097.932) (-1101.798) (-1098.139) -- 0:00:09
846000 -- (-1098.861) [-1098.770] (-1096.833) (-1095.100) * (-1095.273) (-1103.150) (-1097.162) [-1096.922] -- 0:00:09
846500 -- (-1095.605) (-1098.257) [-1095.682] (-1095.697) * [-1095.598] (-1100.744) (-1095.871) (-1097.548) -- 0:00:09
847000 -- (-1095.699) [-1095.860] (-1098.255) (-1097.764) * (-1096.330) [-1097.131] (-1095.295) (-1097.652) -- 0:00:09
847500 -- (-1095.981) (-1098.329) (-1095.775) [-1096.214] * (-1095.743) (-1094.786) [-1096.262] (-1094.668) -- 0:00:09
848000 -- [-1095.522] (-1098.134) (-1096.581) (-1102.181) * (-1095.475) (-1094.484) [-1095.975] (-1095.957) -- 0:00:09
848500 -- (-1097.182) [-1096.572] (-1097.729) (-1098.198) * [-1097.660] (-1099.689) (-1097.214) (-1097.680) -- 0:00:09
849000 -- [-1096.336] (-1096.336) (-1097.919) (-1094.903) * [-1099.082] (-1095.510) (-1096.352) (-1097.983) -- 0:00:09
849500 -- (-1096.108) [-1098.012] (-1098.777) (-1094.849) * [-1094.693] (-1099.045) (-1096.705) (-1098.368) -- 0:00:09
850000 -- (-1099.481) (-1098.175) [-1095.363] (-1095.190) * (-1095.902) (-1095.578) [-1095.819] (-1097.807) -- 0:00:09
Average standard deviation of split frequencies: 0.009753
850500 -- (-1096.348) [-1095.627] (-1100.031) (-1095.198) * (-1095.693) [-1096.860] (-1094.971) (-1095.854) -- 0:00:09
851000 -- [-1095.772] (-1099.723) (-1097.050) (-1096.611) * (-1097.891) (-1096.179) [-1094.932] (-1096.939) -- 0:00:09
851500 -- (-1097.039) (-1096.659) (-1097.861) [-1095.461] * (-1096.469) [-1096.102] (-1094.755) (-1096.259) -- 0:00:09
852000 -- [-1095.426] (-1095.392) (-1097.343) (-1096.942) * (-1096.783) [-1095.826] (-1095.281) (-1096.760) -- 0:00:09
852500 -- (-1097.861) [-1095.652] (-1095.388) (-1097.986) * (-1098.394) (-1094.638) [-1095.075] (-1101.074) -- 0:00:09
853000 -- (-1095.969) (-1096.670) [-1095.069] (-1101.112) * (-1097.643) [-1098.876] (-1095.530) (-1099.931) -- 0:00:09
853500 -- [-1094.988] (-1097.801) (-1096.730) (-1098.530) * [-1096.594] (-1098.034) (-1096.102) (-1100.141) -- 0:00:09
854000 -- [-1095.560] (-1101.783) (-1095.859) (-1096.347) * (-1096.325) (-1095.064) [-1097.600] (-1098.158) -- 0:00:09
854500 -- (-1095.622) (-1096.562) [-1098.805] (-1101.648) * [-1099.817] (-1098.826) (-1095.829) (-1096.139) -- 0:00:09
855000 -- (-1099.780) (-1097.502) (-1099.796) [-1095.579] * (-1097.781) (-1099.780) [-1098.159] (-1095.895) -- 0:00:09
Average standard deviation of split frequencies: 0.009362
855500 -- (-1095.169) (-1097.263) [-1098.039] (-1097.318) * (-1097.756) (-1099.263) (-1099.596) [-1096.470] -- 0:00:09
856000 -- (-1095.707) [-1095.312] (-1097.738) (-1098.200) * (-1095.808) (-1096.153) (-1100.219) [-1098.839] -- 0:00:09
856500 -- (-1095.188) [-1095.252] (-1096.354) (-1097.446) * (-1097.879) (-1095.765) [-1094.759] (-1097.704) -- 0:00:09
857000 -- [-1097.255] (-1098.345) (-1096.345) (-1098.638) * (-1097.457) [-1097.485] (-1096.441) (-1099.763) -- 0:00:09
857500 -- (-1099.968) (-1099.373) (-1096.634) [-1095.849] * (-1097.508) [-1095.853] (-1097.823) (-1097.062) -- 0:00:08
858000 -- [-1096.336] (-1097.249) (-1094.711) (-1095.853) * (-1095.837) (-1096.079) (-1098.467) [-1096.127] -- 0:00:08
858500 -- (-1097.277) [-1096.445] (-1095.524) (-1096.220) * (-1096.055) [-1094.644] (-1096.024) (-1095.922) -- 0:00:08
859000 -- [-1096.325] (-1096.806) (-1094.492) (-1095.724) * (-1095.928) [-1099.019] (-1096.197) (-1098.824) -- 0:00:08
859500 -- (-1095.898) (-1098.985) (-1096.481) [-1096.303] * [-1096.560] (-1096.820) (-1096.209) (-1097.073) -- 0:00:08
860000 -- [-1095.920] (-1095.707) (-1096.405) (-1097.423) * (-1096.367) (-1099.893) (-1098.373) [-1097.297] -- 0:00:08
Average standard deviation of split frequencies: 0.009019
860500 -- (-1097.262) (-1095.878) (-1095.641) [-1097.495] * (-1097.672) (-1104.755) (-1096.822) [-1095.986] -- 0:00:08
861000 -- (-1096.311) [-1096.063] (-1096.905) (-1098.156) * [-1095.525] (-1099.561) (-1098.818) (-1099.389) -- 0:00:08
861500 -- [-1095.449] (-1100.032) (-1097.704) (-1097.625) * (-1095.447) [-1097.071] (-1098.634) (-1095.471) -- 0:00:08
862000 -- (-1094.483) (-1096.012) [-1098.730] (-1099.051) * (-1095.803) (-1096.680) (-1098.220) [-1096.919] -- 0:00:08
862500 -- (-1098.742) (-1098.795) [-1095.375] (-1098.022) * (-1096.224) (-1097.017) (-1102.099) [-1098.340] -- 0:00:08
863000 -- (-1095.360) (-1099.980) (-1096.888) [-1095.643] * (-1100.633) [-1096.280] (-1098.334) (-1094.723) -- 0:00:08
863500 -- (-1098.262) (-1097.375) (-1096.451) [-1095.697] * (-1099.244) [-1099.961] (-1098.093) (-1095.123) -- 0:00:08
864000 -- (-1098.869) [-1101.793] (-1096.021) (-1096.257) * (-1096.026) (-1098.348) (-1097.654) [-1095.748] -- 0:00:08
864500 -- (-1101.693) (-1097.143) (-1096.469) [-1094.965] * [-1096.697] (-1101.015) (-1100.709) (-1097.127) -- 0:00:08
865000 -- (-1098.616) (-1099.694) [-1095.574] (-1098.778) * (-1096.007) (-1096.745) [-1097.955] (-1099.401) -- 0:00:08
Average standard deviation of split frequencies: 0.009109
865500 -- (-1098.737) (-1098.902) (-1096.101) [-1097.231] * (-1094.896) [-1100.052] (-1095.291) (-1097.084) -- 0:00:08
866000 -- (-1098.019) (-1097.234) [-1096.581] (-1095.549) * (-1095.600) (-1095.512) [-1095.677] (-1097.327) -- 0:00:08
866500 -- (-1096.531) (-1098.024) (-1099.502) [-1094.615] * [-1094.344] (-1096.701) (-1098.427) (-1099.100) -- 0:00:08
867000 -- (-1096.009) (-1096.173) (-1095.860) [-1094.564] * (-1099.030) (-1095.174) (-1095.627) [-1096.818] -- 0:00:08
867500 -- (-1095.504) (-1098.180) [-1095.940] (-1095.798) * (-1096.659) (-1094.780) (-1096.086) [-1097.020] -- 0:00:08
868000 -- (-1097.459) (-1098.159) [-1096.414] (-1095.154) * [-1096.638] (-1099.501) (-1096.489) (-1096.966) -- 0:00:08
868500 -- [-1099.856] (-1095.438) (-1098.974) (-1099.592) * [-1096.106] (-1098.369) (-1099.127) (-1097.045) -- 0:00:08
869000 -- (-1099.585) [-1098.212] (-1098.669) (-1097.801) * [-1095.729] (-1096.928) (-1100.210) (-1099.810) -- 0:00:08
869500 -- (-1100.088) [-1095.838] (-1103.406) (-1096.219) * (-1097.486) [-1095.233] (-1099.795) (-1098.214) -- 0:00:08
870000 -- (-1099.297) (-1095.488) [-1095.594] (-1099.531) * (-1095.821) [-1097.508] (-1095.542) (-1096.098) -- 0:00:08
Average standard deviation of split frequencies: 0.008555
870500 -- (-1098.145) (-1095.590) (-1098.145) [-1096.041] * (-1096.698) (-1098.198) (-1099.104) [-1095.533] -- 0:00:08
871000 -- (-1097.218) [-1095.338] (-1097.971) (-1095.237) * [-1097.278] (-1094.860) (-1094.678) (-1095.651) -- 0:00:08
871500 -- [-1096.876] (-1095.344) (-1095.250) (-1097.560) * (-1097.659) (-1098.008) [-1095.567] (-1099.628) -- 0:00:08
872000 -- (-1095.256) (-1095.514) (-1094.515) [-1098.059] * (-1097.163) [-1095.647] (-1098.760) (-1098.676) -- 0:00:08
872500 -- [-1096.239] (-1096.177) (-1096.867) (-1098.205) * [-1096.512] (-1095.554) (-1096.627) (-1098.321) -- 0:00:08
873000 -- (-1097.955) (-1097.832) [-1094.847] (-1095.688) * (-1098.114) (-1097.401) [-1097.127] (-1100.204) -- 0:00:08
873500 -- (-1101.440) (-1103.233) (-1097.912) [-1096.456] * [-1095.255] (-1096.913) (-1095.110) (-1096.384) -- 0:00:07
874000 -- (-1101.589) [-1101.500] (-1095.336) (-1097.442) * [-1096.593] (-1096.940) (-1099.309) (-1096.886) -- 0:00:07
874500 -- (-1100.234) [-1097.626] (-1095.291) (-1095.432) * (-1097.332) [-1095.977] (-1101.530) (-1095.254) -- 0:00:07
875000 -- (-1097.008) [-1098.331] (-1097.563) (-1094.602) * (-1096.603) (-1096.294) (-1096.851) [-1095.588] -- 0:00:07
Average standard deviation of split frequencies: 0.008861
875500 -- (-1096.049) (-1097.553) [-1099.648] (-1096.474) * (-1096.276) (-1097.491) [-1096.423] (-1097.960) -- 0:00:07
876000 -- (-1098.646) [-1098.652] (-1094.831) (-1098.284) * (-1097.383) (-1098.671) [-1094.852] (-1097.645) -- 0:00:07
876500 -- [-1097.052] (-1097.263) (-1095.358) (-1096.870) * (-1095.474) [-1097.709] (-1102.297) (-1104.271) -- 0:00:07
877000 -- (-1096.235) (-1097.439) (-1095.561) [-1097.505] * (-1103.572) (-1095.795) [-1097.104] (-1100.933) -- 0:00:07
877500 -- [-1096.836] (-1096.055) (-1094.922) (-1095.777) * (-1096.536) [-1098.427] (-1096.417) (-1098.265) -- 0:00:07
878000 -- (-1097.607) (-1095.296) [-1097.644] (-1096.075) * [-1095.295] (-1098.047) (-1097.591) (-1096.903) -- 0:00:07
878500 -- [-1095.766] (-1097.134) (-1098.776) (-1095.306) * [-1095.839] (-1095.121) (-1095.929) (-1097.157) -- 0:00:07
879000 -- (-1095.422) (-1097.779) (-1096.626) [-1098.908] * (-1097.763) [-1096.715] (-1101.631) (-1095.430) -- 0:00:07
879500 -- (-1096.635) [-1095.319] (-1095.200) (-1095.765) * (-1096.666) (-1095.353) [-1099.457] (-1095.848) -- 0:00:07
880000 -- (-1096.778) (-1096.314) (-1095.334) [-1098.152] * [-1095.774] (-1095.709) (-1099.365) (-1097.334) -- 0:00:07
Average standard deviation of split frequencies: 0.009100
880500 -- [-1097.086] (-1095.385) (-1094.655) (-1099.713) * (-1096.072) [-1097.637] (-1099.668) (-1096.398) -- 0:00:07
881000 -- (-1099.141) (-1096.243) [-1095.595] (-1095.718) * (-1097.620) (-1096.843) (-1099.577) [-1096.102] -- 0:00:07
881500 -- (-1099.875) (-1096.843) (-1097.422) [-1096.789] * (-1102.272) (-1095.599) [-1095.210] (-1096.399) -- 0:00:07
882000 -- (-1100.932) [-1096.158] (-1098.053) (-1097.763) * (-1100.289) [-1097.879] (-1096.060) (-1096.060) -- 0:00:07
882500 -- [-1097.310] (-1101.224) (-1094.945) (-1099.029) * (-1098.031) [-1099.180] (-1097.783) (-1096.146) -- 0:00:07
883000 -- (-1096.480) [-1095.891] (-1096.849) (-1096.781) * (-1095.322) (-1096.648) (-1096.879) [-1095.086] -- 0:00:07
883500 -- (-1096.571) (-1097.654) (-1096.269) [-1095.812] * (-1097.988) (-1097.354) [-1096.263] (-1095.646) -- 0:00:07
884000 -- (-1096.957) (-1098.210) (-1100.624) [-1095.844] * (-1099.160) (-1096.301) (-1095.474) [-1099.774] -- 0:00:07
884500 -- (-1096.458) (-1097.238) (-1096.319) [-1096.796] * (-1094.675) (-1099.070) [-1095.798] (-1101.410) -- 0:00:07
885000 -- (-1097.311) (-1095.787) (-1096.074) [-1096.718] * [-1095.392] (-1096.451) (-1101.722) (-1096.955) -- 0:00:07
Average standard deviation of split frequencies: 0.009544
885500 -- [-1095.848] (-1095.350) (-1098.843) (-1098.827) * (-1094.793) (-1096.974) [-1101.320] (-1095.716) -- 0:00:07
886000 -- (-1096.901) (-1095.617) [-1099.523] (-1101.301) * (-1094.596) (-1097.921) (-1099.684) [-1096.575] -- 0:00:07
886500 -- (-1096.571) (-1096.802) [-1094.832] (-1097.020) * (-1096.366) (-1098.218) (-1097.908) [-1099.576] -- 0:00:07
887000 -- [-1095.591] (-1095.161) (-1098.367) (-1096.743) * [-1095.483] (-1101.160) (-1096.637) (-1099.267) -- 0:00:07
887500 -- (-1097.745) (-1096.682) (-1097.868) [-1095.613] * (-1095.815) (-1095.696) (-1098.984) [-1095.167] -- 0:00:07
888000 -- [-1097.733] (-1096.555) (-1097.702) (-1097.414) * (-1097.460) (-1097.424) [-1095.743] (-1100.622) -- 0:00:07
888500 -- (-1097.583) (-1096.580) (-1098.961) [-1097.800] * (-1095.366) (-1098.793) [-1095.312] (-1095.450) -- 0:00:07
889000 -- [-1096.357] (-1096.124) (-1099.732) (-1098.687) * (-1095.554) (-1096.492) (-1095.179) [-1095.843] -- 0:00:06
889500 -- (-1096.032) (-1098.078) (-1095.651) [-1096.983] * (-1097.949) (-1100.009) [-1096.115] (-1094.562) -- 0:00:06
890000 -- [-1095.325] (-1095.402) (-1097.943) (-1096.301) * [-1095.249] (-1101.349) (-1100.486) (-1095.378) -- 0:00:06
Average standard deviation of split frequencies: 0.008609
890500 -- (-1095.671) (-1096.172) (-1097.793) [-1096.903] * [-1096.549] (-1098.121) (-1102.136) (-1096.104) -- 0:00:06
891000 -- (-1097.001) (-1094.904) (-1096.003) [-1097.212] * [-1097.139] (-1103.046) (-1098.068) (-1096.442) -- 0:00:06
891500 -- (-1096.459) [-1097.735] (-1097.380) (-1096.421) * (-1098.711) (-1099.328) [-1095.719] (-1100.378) -- 0:00:06
892000 -- [-1095.178] (-1095.849) (-1098.560) (-1095.334) * (-1094.774) (-1101.405) [-1098.761] (-1098.964) -- 0:00:06
892500 -- [-1098.221] (-1096.189) (-1098.618) (-1096.145) * (-1094.768) (-1096.724) [-1096.845] (-1096.220) -- 0:00:06
893000 -- (-1096.152) [-1094.526] (-1100.869) (-1097.315) * (-1096.819) (-1097.175) [-1098.180] (-1096.880) -- 0:00:06
893500 -- (-1103.931) (-1097.604) [-1097.147] (-1097.849) * [-1096.651] (-1097.481) (-1094.703) (-1096.695) -- 0:00:06
894000 -- (-1096.870) (-1100.564) [-1096.867] (-1100.652) * [-1096.387] (-1101.218) (-1097.115) (-1095.349) -- 0:00:06
894500 -- [-1096.311] (-1096.893) (-1100.828) (-1095.578) * (-1096.219) (-1095.448) [-1098.056] (-1094.640) -- 0:00:06
895000 -- [-1096.403] (-1097.167) (-1099.948) (-1096.287) * (-1101.687) (-1096.911) (-1097.674) [-1097.415] -- 0:00:06
Average standard deviation of split frequencies: 0.008558
895500 -- (-1099.499) (-1098.361) [-1098.816] (-1095.933) * (-1104.423) (-1096.968) (-1098.294) [-1094.722] -- 0:00:06
896000 -- (-1098.078) [-1099.615] (-1094.971) (-1099.565) * (-1099.849) (-1096.917) (-1096.536) [-1103.001] -- 0:00:06
896500 -- (-1097.365) (-1096.723) [-1097.211] (-1100.031) * [-1096.154] (-1095.460) (-1098.090) (-1098.238) -- 0:00:06
897000 -- [-1097.165] (-1097.050) (-1098.359) (-1096.340) * [-1095.627] (-1096.008) (-1098.734) (-1096.225) -- 0:00:06
897500 -- (-1102.317) [-1095.876] (-1097.126) (-1098.620) * (-1094.933) [-1095.582] (-1095.622) (-1097.228) -- 0:00:06
898000 -- (-1101.657) (-1096.615) (-1097.014) [-1095.932] * (-1096.482) [-1096.095] (-1096.000) (-1095.541) -- 0:00:06
898500 -- (-1099.844) (-1100.230) [-1095.842] (-1095.536) * [-1094.940] (-1098.442) (-1095.301) (-1095.992) -- 0:00:06
899000 -- (-1098.742) (-1095.135) [-1095.081] (-1096.376) * (-1095.581) (-1096.251) (-1097.889) [-1098.316] -- 0:00:06
899500 -- (-1096.645) (-1097.456) [-1096.387] (-1098.816) * (-1098.816) [-1094.930] (-1097.347) (-1096.359) -- 0:00:06
900000 -- (-1096.656) (-1097.634) [-1098.472] (-1098.197) * (-1096.344) (-1096.896) [-1095.129] (-1096.350) -- 0:00:06
Average standard deviation of split frequencies: 0.008653
900500 -- (-1098.901) (-1095.998) [-1096.386] (-1095.384) * [-1096.984] (-1096.346) (-1095.839) (-1095.660) -- 0:00:06
901000 -- (-1100.715) (-1097.144) [-1096.267] (-1095.009) * (-1100.167) (-1098.468) (-1095.778) [-1096.403] -- 0:00:06
901500 -- (-1096.760) [-1094.921] (-1095.046) (-1097.606) * [-1097.272] (-1095.815) (-1095.035) (-1095.467) -- 0:00:06
902000 -- (-1097.162) (-1095.155) [-1096.652] (-1097.777) * (-1095.135) (-1097.427) (-1098.031) [-1095.988] -- 0:00:06
902500 -- (-1096.162) [-1096.850] (-1098.342) (-1098.869) * (-1095.978) [-1095.407] (-1098.383) (-1096.164) -- 0:00:06
903000 -- [-1100.393] (-1095.429) (-1097.255) (-1095.904) * [-1094.710] (-1095.842) (-1099.684) (-1097.061) -- 0:00:06
903500 -- (-1096.994) (-1095.075) [-1096.304] (-1095.850) * (-1095.631) (-1098.147) (-1097.277) [-1097.733] -- 0:00:06
904000 -- (-1095.320) (-1098.567) [-1097.005] (-1094.418) * (-1095.640) [-1098.525] (-1096.771) (-1097.001) -- 0:00:06
904500 -- (-1096.833) (-1097.714) (-1096.313) [-1094.578] * (-1099.892) (-1096.938) (-1098.326) [-1096.485] -- 0:00:06
905000 -- (-1098.047) (-1096.847) [-1095.771] (-1095.532) * [-1095.714] (-1099.986) (-1098.361) (-1097.313) -- 0:00:05
Average standard deviation of split frequencies: 0.008741
905500 -- (-1101.047) (-1097.494) (-1098.322) [-1096.668] * (-1096.484) (-1096.270) (-1100.396) [-1098.695] -- 0:00:05
906000 -- (-1097.461) [-1097.558] (-1096.582) (-1095.879) * (-1097.995) [-1095.529] (-1102.184) (-1096.892) -- 0:00:05
906500 -- (-1096.454) (-1098.037) [-1095.421] (-1094.990) * (-1096.386) (-1102.234) (-1099.240) [-1097.288] -- 0:00:05
907000 -- (-1099.423) [-1098.964] (-1094.472) (-1095.570) * (-1097.447) [-1102.182] (-1097.871) (-1095.523) -- 0:00:05
907500 -- (-1098.770) [-1096.476] (-1095.812) (-1095.461) * [-1097.665] (-1097.927) (-1095.071) (-1097.112) -- 0:00:05
908000 -- (-1099.946) (-1095.529) (-1094.922) [-1095.689] * (-1101.073) (-1096.765) (-1095.278) [-1095.651] -- 0:00:05
908500 -- (-1094.776) [-1097.285] (-1098.860) (-1097.794) * (-1099.747) (-1096.449) (-1095.792) [-1095.975] -- 0:00:05
909000 -- (-1097.046) (-1098.704) (-1097.409) [-1096.339] * (-1095.071) (-1096.459) [-1095.305] (-1097.403) -- 0:00:05
909500 -- (-1096.357) [-1097.799] (-1098.372) (-1096.338) * [-1099.437] (-1095.771) (-1097.846) (-1098.553) -- 0:00:05
910000 -- (-1097.225) [-1096.959] (-1095.018) (-1095.720) * (-1099.959) [-1096.244] (-1096.631) (-1095.068) -- 0:00:05
Average standard deviation of split frequencies: 0.008662
910500 -- (-1096.435) (-1099.140) [-1095.192] (-1100.864) * (-1095.417) [-1095.769] (-1096.741) (-1095.111) -- 0:00:05
911000 -- (-1096.473) (-1097.197) [-1095.051] (-1097.360) * (-1096.672) (-1098.923) [-1096.903] (-1095.339) -- 0:00:05
911500 -- (-1099.975) (-1096.030) [-1095.109] (-1096.431) * [-1095.341] (-1098.481) (-1096.070) (-1094.398) -- 0:00:05
912000 -- (-1096.673) [-1097.194] (-1098.746) (-1094.632) * (-1100.516) (-1098.115) [-1096.076] (-1099.757) -- 0:00:05
912500 -- (-1094.716) (-1097.719) [-1097.463] (-1096.618) * (-1096.465) [-1097.136] (-1098.454) (-1101.142) -- 0:00:05
913000 -- (-1095.098) (-1097.795) (-1094.703) [-1095.316] * (-1097.089) (-1099.601) [-1097.841] (-1096.259) -- 0:00:05
913500 -- (-1095.704) (-1098.688) (-1097.077) [-1095.353] * (-1095.523) (-1096.920) (-1095.952) [-1098.068] -- 0:00:05
914000 -- (-1095.482) (-1097.402) [-1094.998] (-1095.824) * (-1098.230) (-1097.025) [-1096.365] (-1097.914) -- 0:00:05
914500 -- (-1098.263) [-1097.130] (-1097.851) (-1096.207) * (-1095.790) [-1096.950] (-1098.496) (-1096.237) -- 0:00:05
915000 -- [-1095.988] (-1097.518) (-1100.181) (-1096.743) * (-1095.285) (-1100.270) (-1100.170) [-1098.566] -- 0:00:05
Average standard deviation of split frequencies: 0.008234
915500 -- [-1099.346] (-1099.730) (-1098.251) (-1097.664) * [-1098.470] (-1098.120) (-1098.602) (-1099.801) -- 0:00:05
916000 -- (-1104.104) (-1096.570) [-1095.122] (-1098.593) * (-1095.811) [-1096.933] (-1095.245) (-1101.307) -- 0:00:05
916500 -- (-1095.672) (-1097.729) [-1097.550] (-1095.905) * [-1100.902] (-1098.569) (-1098.348) (-1099.177) -- 0:00:05
917000 -- (-1095.477) [-1097.078] (-1097.223) (-1096.497) * (-1096.953) [-1096.124] (-1097.835) (-1096.542) -- 0:00:05
917500 -- (-1096.949) (-1098.365) (-1098.406) [-1100.068] * (-1095.736) (-1102.088) (-1095.400) [-1096.742] -- 0:00:05
918000 -- (-1097.656) [-1100.753] (-1097.888) (-1099.792) * [-1095.225] (-1098.141) (-1095.400) (-1098.250) -- 0:00:05
918500 -- (-1097.270) (-1098.996) (-1097.947) [-1094.723] * (-1097.979) (-1096.888) (-1094.754) [-1097.155] -- 0:00:05
919000 -- (-1097.330) (-1095.695) [-1096.775] (-1096.105) * (-1097.796) (-1097.754) [-1095.681] (-1100.746) -- 0:00:05
919500 -- (-1096.826) (-1096.565) (-1103.808) [-1094.464] * (-1106.600) (-1095.650) (-1098.845) [-1099.964] -- 0:00:05
920000 -- [-1095.515] (-1101.238) (-1098.916) (-1094.793) * (-1096.624) (-1095.650) [-1098.256] (-1095.680) -- 0:00:05
Average standard deviation of split frequencies: 0.008363
920500 -- [-1097.270] (-1103.204) (-1095.984) (-1095.889) * (-1096.382) (-1097.781) [-1098.220] (-1095.732) -- 0:00:05
921000 -- (-1095.541) (-1096.424) [-1096.609] (-1097.782) * [-1095.107] (-1098.628) (-1097.795) (-1097.238) -- 0:00:04
921500 -- (-1096.973) (-1095.326) [-1097.042] (-1097.737) * (-1095.721) [-1098.336] (-1095.358) (-1096.722) -- 0:00:04
922000 -- (-1099.041) [-1103.162] (-1095.202) (-1095.877) * (-1096.527) (-1098.489) (-1095.559) [-1095.214] -- 0:00:04
922500 -- (-1096.884) (-1096.052) [-1095.679] (-1096.641) * (-1098.166) [-1096.887] (-1098.843) (-1095.708) -- 0:00:04
923000 -- (-1097.375) (-1095.156) [-1101.089] (-1096.907) * (-1096.179) (-1096.181) [-1094.558] (-1095.359) -- 0:00:04
923500 -- (-1095.662) (-1095.355) (-1095.118) [-1095.269] * (-1095.810) (-1097.412) (-1096.758) [-1095.680] -- 0:00:04
924000 -- (-1098.081) (-1098.185) (-1095.398) [-1099.700] * (-1101.573) [-1094.951] (-1098.014) (-1098.414) -- 0:00:04
924500 -- (-1097.054) (-1096.498) [-1098.583] (-1096.716) * (-1098.002) (-1097.119) [-1097.941] (-1099.080) -- 0:00:04
925000 -- (-1094.568) (-1096.186) (-1101.810) [-1098.500] * (-1097.656) (-1098.417) [-1097.746] (-1095.971) -- 0:00:04
Average standard deviation of split frequencies: 0.008451
925500 -- (-1095.813) (-1096.320) (-1098.528) [-1100.083] * (-1096.393) [-1097.939] (-1095.680) (-1095.297) -- 0:00:04
926000 -- (-1095.692) (-1096.929) (-1097.349) [-1100.413] * (-1101.940) (-1097.323) [-1096.978] (-1097.529) -- 0:00:04
926500 -- (-1099.469) (-1095.383) (-1099.810) [-1095.946] * (-1095.845) (-1096.361) (-1098.097) [-1097.105] -- 0:00:04
927000 -- [-1098.966] (-1095.348) (-1101.552) (-1102.316) * (-1096.030) (-1097.808) [-1098.947] (-1096.095) -- 0:00:04
927500 -- [-1097.481] (-1097.348) (-1095.731) (-1097.536) * (-1095.351) (-1095.492) [-1098.139] (-1099.278) -- 0:00:04
928000 -- (-1096.167) (-1097.867) [-1095.123] (-1096.534) * (-1096.093) (-1099.106) [-1096.014] (-1096.459) -- 0:00:04
928500 -- [-1095.138] (-1096.405) (-1094.987) (-1099.917) * (-1098.521) (-1095.151) [-1096.278] (-1098.676) -- 0:00:04
929000 -- (-1096.109) (-1095.186) [-1097.721] (-1098.618) * (-1097.444) [-1097.439] (-1099.999) (-1098.047) -- 0:00:04
929500 -- (-1095.653) (-1098.728) [-1101.960] (-1097.444) * [-1098.476] (-1096.396) (-1096.810) (-1097.251) -- 0:00:04
930000 -- [-1096.272] (-1095.594) (-1098.840) (-1099.710) * [-1096.537] (-1095.779) (-1095.847) (-1100.018) -- 0:00:04
Average standard deviation of split frequencies: 0.008239
930500 -- [-1096.741] (-1095.828) (-1097.115) (-1096.036) * (-1099.247) [-1097.393] (-1098.307) (-1097.141) -- 0:00:04
931000 -- (-1098.182) (-1097.136) (-1095.804) [-1096.166] * [-1096.101] (-1096.805) (-1099.337) (-1099.624) -- 0:00:04
931500 -- (-1098.191) (-1095.530) (-1096.357) [-1095.767] * (-1098.416) (-1098.151) (-1100.578) [-1099.000] -- 0:00:04
932000 -- (-1096.617) (-1097.154) [-1096.890] (-1095.838) * [-1097.146] (-1096.413) (-1095.618) (-1099.229) -- 0:00:04
932500 -- (-1096.380) (-1097.725) (-1098.370) [-1096.153] * (-1099.593) [-1098.983] (-1095.808) (-1099.630) -- 0:00:04
933000 -- (-1103.865) [-1095.855] (-1096.638) (-1095.228) * (-1097.949) (-1098.766) [-1098.317] (-1105.008) -- 0:00:04
933500 -- [-1100.492] (-1094.948) (-1097.659) (-1096.391) * [-1095.899] (-1096.358) (-1097.340) (-1097.585) -- 0:00:04
934000 -- (-1096.993) [-1097.842] (-1096.538) (-1096.551) * (-1094.905) (-1096.497) (-1098.860) [-1097.585] -- 0:00:04
934500 -- (-1096.792) [-1095.939] (-1097.246) (-1098.382) * [-1095.246] (-1099.709) (-1098.203) (-1097.685) -- 0:00:04
935000 -- (-1094.982) (-1101.400) [-1096.791] (-1097.685) * (-1094.779) (-1097.513) [-1098.880] (-1097.883) -- 0:00:04
Average standard deviation of split frequencies: 0.009065
935500 -- (-1095.598) (-1095.471) [-1096.622] (-1096.833) * (-1094.962) (-1096.093) [-1100.803] (-1097.875) -- 0:00:04
936000 -- (-1098.176) (-1095.947) [-1096.097] (-1096.172) * (-1097.502) (-1098.780) (-1097.512) [-1095.415] -- 0:00:04
936500 -- (-1097.095) (-1096.813) [-1095.121] (-1096.308) * (-1095.547) (-1096.937) (-1097.066) [-1094.830] -- 0:00:04
937000 -- (-1095.949) [-1096.397] (-1098.404) (-1095.898) * (-1095.546) (-1095.536) (-1096.232) [-1096.274] -- 0:00:03
937500 -- (-1097.602) [-1099.104] (-1095.611) (-1100.134) * (-1099.955) (-1094.760) (-1109.708) [-1098.703] -- 0:00:03
938000 -- (-1099.650) (-1098.295) (-1098.120) [-1096.611] * [-1096.238] (-1095.077) (-1105.863) (-1095.214) -- 0:00:03
938500 -- [-1097.249] (-1096.917) (-1096.542) (-1098.663) * (-1096.120) [-1096.847] (-1096.469) (-1095.285) -- 0:00:03
939000 -- (-1095.905) [-1096.737] (-1096.763) (-1101.248) * [-1095.902] (-1097.494) (-1097.790) (-1095.840) -- 0:00:03
939500 -- (-1097.227) (-1097.202) [-1095.299] (-1095.105) * (-1096.281) (-1098.550) [-1098.370] (-1097.172) -- 0:00:03
940000 -- [-1097.465] (-1097.895) (-1096.271) (-1094.584) * [-1095.920] (-1101.792) (-1099.998) (-1100.666) -- 0:00:03
Average standard deviation of split frequencies: 0.008085
940500 -- [-1095.109] (-1104.612) (-1097.158) (-1094.967) * (-1098.896) (-1100.697) (-1095.756) [-1094.881] -- 0:00:03
941000 -- (-1096.401) (-1097.410) (-1098.049) [-1095.315] * (-1099.510) (-1095.771) [-1097.656] (-1094.825) -- 0:00:03
941500 -- (-1095.667) (-1098.305) (-1098.036) [-1095.880] * (-1095.132) [-1096.362] (-1096.175) (-1095.562) -- 0:00:03
942000 -- (-1095.869) (-1097.061) [-1097.342] (-1094.435) * [-1097.072] (-1096.892) (-1098.914) (-1096.917) -- 0:00:03
942500 -- [-1097.062] (-1096.093) (-1097.842) (-1094.522) * (-1096.258) [-1097.162] (-1097.319) (-1099.421) -- 0:00:03
943000 -- [-1097.003] (-1097.377) (-1103.213) (-1097.687) * (-1098.779) [-1095.913] (-1095.298) (-1096.312) -- 0:00:03
943500 -- [-1096.571] (-1095.880) (-1097.059) (-1097.672) * (-1103.071) (-1097.614) [-1096.191] (-1095.838) -- 0:00:03
944000 -- [-1096.127] (-1095.851) (-1097.044) (-1095.773) * (-1097.168) (-1096.153) [-1099.615] (-1095.923) -- 0:00:03
944500 -- (-1098.183) (-1097.333) [-1097.644] (-1095.989) * (-1101.112) (-1095.258) [-1096.433] (-1095.829) -- 0:00:03
945000 -- [-1100.922] (-1096.895) (-1095.917) (-1096.020) * (-1096.098) (-1096.686) (-1095.739) [-1097.064] -- 0:00:03
Average standard deviation of split frequencies: 0.008938
945500 -- (-1097.379) (-1095.896) [-1097.329] (-1097.008) * [-1099.242] (-1096.440) (-1096.173) (-1097.064) -- 0:00:03
946000 -- (-1096.426) (-1095.097) [-1095.254] (-1097.191) * (-1097.728) (-1096.723) [-1095.877] (-1095.718) -- 0:00:03
946500 -- (-1095.382) [-1095.691] (-1094.712) (-1097.533) * [-1094.735] (-1097.106) (-1098.201) (-1096.794) -- 0:00:03
947000 -- (-1097.094) [-1098.316] (-1096.767) (-1096.301) * (-1097.644) [-1096.279] (-1099.402) (-1097.141) -- 0:00:03
947500 -- (-1099.160) [-1097.745] (-1099.230) (-1095.244) * (-1099.450) (-1099.960) (-1099.089) [-1094.684] -- 0:00:03
948000 -- (-1096.010) (-1096.015) [-1094.753] (-1094.920) * (-1098.430) [-1099.626] (-1100.786) (-1094.862) -- 0:00:03
948500 -- (-1099.957) [-1096.809] (-1094.766) (-1094.950) * (-1096.789) (-1096.156) (-1098.843) [-1095.732] -- 0:00:03
949000 -- (-1100.783) (-1095.120) [-1097.156] (-1099.834) * [-1096.622] (-1095.433) (-1096.821) (-1095.739) -- 0:00:03
949500 -- (-1098.354) (-1095.499) [-1095.611] (-1096.384) * (-1097.974) (-1095.199) [-1097.014] (-1094.632) -- 0:00:03
950000 -- [-1095.878] (-1094.535) (-1095.185) (-1096.868) * (-1097.800) [-1095.645] (-1095.868) (-1098.015) -- 0:00:03
Average standard deviation of split frequencies: 0.008988
950500 -- [-1095.302] (-1099.899) (-1098.153) (-1097.040) * [-1096.990] (-1096.829) (-1097.201) (-1097.470) -- 0:00:03
951000 -- [-1095.423] (-1097.446) (-1100.711) (-1096.931) * (-1099.055) (-1096.126) (-1095.353) [-1097.057] -- 0:00:03
951500 -- (-1101.220) [-1100.085] (-1100.128) (-1095.784) * (-1094.965) (-1095.149) [-1095.357] (-1098.588) -- 0:00:03
952000 -- [-1098.135] (-1101.562) (-1096.700) (-1102.644) * (-1098.724) [-1095.530] (-1100.425) (-1095.748) -- 0:00:03
952500 -- (-1098.619) (-1101.232) [-1097.779] (-1095.952) * (-1099.058) (-1097.385) [-1097.937] (-1095.773) -- 0:00:02
953000 -- (-1097.905) (-1099.315) (-1099.429) [-1098.771] * [-1098.702] (-1099.138) (-1098.065) (-1094.735) -- 0:00:02
953500 -- [-1095.838] (-1095.175) (-1103.413) (-1094.921) * (-1097.108) (-1100.113) [-1097.670] (-1096.673) -- 0:00:02
954000 -- (-1096.139) (-1095.787) (-1097.611) [-1094.861] * (-1097.625) (-1098.814) [-1098.926] (-1096.262) -- 0:00:02
954500 -- (-1097.669) (-1102.779) (-1095.758) [-1098.959] * [-1095.938] (-1096.973) (-1095.426) (-1095.563) -- 0:00:02
955000 -- [-1096.474] (-1096.440) (-1095.420) (-1095.009) * (-1096.265) (-1095.497) [-1095.000] (-1096.807) -- 0:00:02
Average standard deviation of split frequencies: 0.008021
955500 -- (-1096.613) (-1096.752) (-1098.905) [-1095.383] * (-1095.960) [-1095.828] (-1096.226) (-1096.583) -- 0:00:02
956000 -- (-1095.306) (-1099.918) [-1094.971] (-1095.161) * (-1095.923) (-1095.660) [-1098.492] (-1098.057) -- 0:00:02
956500 -- (-1096.836) (-1096.608) (-1094.917) [-1095.490] * (-1098.168) (-1096.792) [-1095.038] (-1100.445) -- 0:00:02
957000 -- (-1099.744) (-1097.692) (-1095.881) [-1096.307] * (-1099.420) (-1100.880) [-1095.967] (-1098.464) -- 0:00:02
957500 -- (-1095.117) [-1098.314] (-1099.336) (-1096.629) * (-1097.265) (-1096.504) [-1097.268] (-1097.060) -- 0:00:02
958000 -- (-1097.338) (-1099.328) (-1099.558) [-1095.116] * [-1096.976] (-1099.331) (-1096.279) (-1102.032) -- 0:00:02
958500 -- (-1097.354) (-1106.355) (-1098.347) [-1095.408] * (-1099.152) [-1098.968] (-1100.286) (-1096.971) -- 0:00:02
959000 -- (-1098.430) (-1097.285) [-1097.390] (-1094.554) * (-1095.351) (-1097.322) (-1102.001) [-1098.528] -- 0:00:02
959500 -- (-1098.557) (-1099.895) (-1098.650) [-1098.342] * (-1096.599) [-1095.806] (-1104.609) (-1099.043) -- 0:00:02
960000 -- (-1100.462) (-1099.755) [-1094.952] (-1096.302) * (-1095.901) (-1096.838) (-1098.584) [-1096.440] -- 0:00:02
Average standard deviation of split frequencies: 0.007917
960500 -- [-1096.337] (-1095.164) (-1095.824) (-1095.980) * (-1095.554) (-1097.868) (-1100.188) [-1098.045] -- 0:00:02
961000 -- (-1096.201) [-1098.583] (-1099.270) (-1097.622) * [-1096.275] (-1095.016) (-1103.726) (-1095.474) -- 0:00:02
961500 -- (-1105.637) [-1096.103] (-1100.636) (-1096.957) * (-1096.317) (-1099.565) [-1098.249] (-1095.341) -- 0:00:02
962000 -- (-1095.204) [-1095.783] (-1096.723) (-1096.769) * (-1095.757) (-1102.116) [-1097.631] (-1096.195) -- 0:00:02
962500 -- [-1095.029] (-1094.793) (-1105.261) (-1095.708) * [-1099.498] (-1100.005) (-1095.649) (-1095.305) -- 0:00:02
963000 -- (-1095.291) [-1096.817] (-1098.575) (-1094.939) * (-1096.859) (-1100.643) (-1096.633) [-1096.402] -- 0:00:02
963500 -- [-1095.179] (-1098.887) (-1097.396) (-1097.365) * [-1097.525] (-1101.145) (-1097.598) (-1096.994) -- 0:00:02
964000 -- [-1095.607] (-1101.871) (-1094.835) (-1098.522) * (-1101.937) [-1098.479] (-1096.337) (-1101.339) -- 0:00:02
964500 -- (-1095.935) (-1098.160) [-1095.956] (-1095.859) * (-1099.320) [-1097.680] (-1099.574) (-1096.773) -- 0:00:02
965000 -- (-1096.295) (-1099.115) (-1095.551) [-1095.374] * (-1096.710) [-1097.177] (-1095.664) (-1096.062) -- 0:00:02
Average standard deviation of split frequencies: 0.007418
965500 -- [-1094.824] (-1096.477) (-1097.109) (-1094.839) * (-1100.424) (-1094.904) [-1097.441] (-1095.739) -- 0:00:02
966000 -- (-1096.445) (-1097.353) [-1095.793] (-1094.764) * (-1098.604) (-1094.867) [-1095.795] (-1095.657) -- 0:00:02
966500 -- [-1095.387] (-1100.593) (-1096.310) (-1094.804) * (-1097.715) (-1094.950) [-1099.498] (-1096.370) -- 0:00:02
967000 -- (-1096.170) (-1099.199) (-1096.172) [-1094.809] * (-1094.953) (-1095.817) [-1099.461] (-1097.023) -- 0:00:02
967500 -- [-1097.796] (-1099.620) (-1095.600) (-1095.652) * (-1095.578) [-1096.091] (-1097.962) (-1099.471) -- 0:00:02
968000 -- (-1096.487) (-1096.433) [-1096.455] (-1097.736) * [-1097.941] (-1097.780) (-1095.645) (-1095.520) -- 0:00:02
968500 -- (-1096.048) [-1103.952] (-1096.437) (-1095.824) * [-1098.840] (-1099.406) (-1095.922) (-1098.999) -- 0:00:01
969000 -- (-1098.894) (-1098.201) [-1096.975] (-1096.488) * (-1095.796) (-1096.911) (-1096.030) [-1101.977] -- 0:00:01
969500 -- [-1096.015] (-1096.635) (-1097.392) (-1095.759) * [-1095.031] (-1094.811) (-1094.658) (-1098.430) -- 0:00:01
970000 -- (-1095.885) (-1097.877) [-1096.410] (-1095.278) * (-1095.901) (-1094.820) (-1094.658) [-1097.105] -- 0:00:01
Average standard deviation of split frequencies: 0.007317
970500 -- [-1095.296] (-1096.891) (-1095.246) (-1097.459) * (-1095.972) (-1095.052) (-1097.780) [-1095.007] -- 0:00:01
971000 -- (-1096.038) (-1096.764) (-1095.216) [-1095.339] * (-1097.243) [-1096.543] (-1098.904) (-1096.708) -- 0:00:01
971500 -- (-1096.284) (-1102.204) [-1096.800] (-1095.911) * (-1097.111) (-1095.908) [-1096.111] (-1094.802) -- 0:00:01
972000 -- (-1098.057) (-1095.929) [-1098.191] (-1096.342) * [-1096.711] (-1097.360) (-1095.075) (-1095.894) -- 0:00:01
972500 -- (-1095.175) (-1097.467) (-1095.631) [-1098.861] * (-1095.701) (-1097.758) [-1095.015] (-1097.158) -- 0:00:01
973000 -- (-1095.900) (-1099.355) [-1096.365] (-1098.488) * (-1097.614) (-1099.324) (-1096.117) [-1096.592] -- 0:00:01
973500 -- (-1098.995) (-1098.748) [-1096.388] (-1097.214) * (-1101.476) (-1094.636) [-1096.110] (-1095.041) -- 0:00:01
974000 -- [-1098.092] (-1096.870) (-1097.180) (-1098.104) * (-1098.792) (-1096.289) (-1098.483) [-1096.458] -- 0:00:01
974500 -- [-1099.301] (-1099.065) (-1102.516) (-1099.512) * (-1100.411) [-1097.370] (-1097.052) (-1096.408) -- 0:00:01
975000 -- (-1095.654) (-1097.426) [-1096.959] (-1098.082) * (-1099.707) (-1095.223) (-1095.616) [-1098.924] -- 0:00:01
Average standard deviation of split frequencies: 0.006955
975500 -- [-1096.763] (-1097.633) (-1098.996) (-1096.453) * [-1096.587] (-1096.160) (-1097.860) (-1100.521) -- 0:00:01
976000 -- (-1100.728) (-1097.469) [-1096.104] (-1097.812) * (-1096.884) (-1096.077) [-1097.743] (-1096.191) -- 0:00:01
976500 -- (-1096.526) (-1096.680) (-1095.475) [-1100.956] * (-1098.339) (-1097.277) [-1097.552] (-1095.010) -- 0:00:01
977000 -- (-1096.852) (-1096.190) (-1097.170) [-1100.895] * (-1100.488) [-1097.016] (-1100.040) (-1098.745) -- 0:00:01
977500 -- (-1097.147) (-1098.362) [-1102.246] (-1098.450) * (-1098.940) (-1097.187) [-1098.757] (-1096.243) -- 0:00:01
978000 -- (-1099.215) (-1097.297) (-1096.174) [-1095.476] * [-1096.365] (-1095.174) (-1098.079) (-1096.090) -- 0:00:01
978500 -- (-1099.272) (-1098.521) (-1098.645) [-1096.763] * (-1096.482) [-1095.643] (-1098.858) (-1095.207) -- 0:00:01
979000 -- (-1096.554) (-1096.029) [-1096.079] (-1100.364) * (-1096.368) (-1096.006) (-1096.570) [-1098.538] -- 0:00:01
979500 -- (-1095.744) (-1094.970) (-1096.562) [-1095.309] * (-1096.162) [-1095.604] (-1098.971) (-1095.363) -- 0:00:01
980000 -- (-1097.053) (-1094.573) [-1099.647] (-1098.536) * (-1096.456) (-1096.006) (-1096.749) [-1099.235] -- 0:00:01
Average standard deviation of split frequencies: 0.007114
980500 -- [-1096.380] (-1100.330) (-1096.740) (-1095.392) * (-1097.243) [-1096.914] (-1099.785) (-1097.119) -- 0:00:01
981000 -- [-1100.936] (-1098.493) (-1096.893) (-1098.112) * (-1097.189) (-1102.325) (-1096.742) [-1095.509] -- 0:00:01
981500 -- (-1095.126) (-1095.577) (-1096.655) [-1096.157] * [-1097.994] (-1101.251) (-1097.857) (-1100.298) -- 0:00:01
982000 -- (-1097.180) (-1096.069) (-1104.111) [-1097.540] * [-1098.168] (-1097.725) (-1095.903) (-1098.566) -- 0:00:01
982500 -- (-1096.213) (-1100.677) [-1096.666] (-1094.762) * [-1097.825] (-1098.540) (-1096.255) (-1100.095) -- 0:00:01
983000 -- (-1096.723) [-1097.274] (-1100.035) (-1097.103) * [-1096.204] (-1098.752) (-1096.422) (-1097.158) -- 0:00:01
983500 -- (-1096.393) (-1097.123) (-1096.346) [-1095.385] * (-1098.853) [-1100.017] (-1097.441) (-1096.601) -- 0:00:01
984000 -- (-1096.062) (-1097.432) (-1096.159) [-1096.426] * (-1099.132) (-1098.679) [-1095.943] (-1095.598) -- 0:00:01
984500 -- (-1095.550) (-1101.751) [-1098.000] (-1096.439) * (-1096.492) [-1097.308] (-1095.481) (-1095.048) -- 0:00:00
985000 -- (-1095.439) (-1097.332) (-1095.980) [-1095.843] * [-1096.106] (-1097.476) (-1095.815) (-1095.952) -- 0:00:00
Average standard deviation of split frequencies: 0.006948
985500 -- (-1099.360) (-1097.628) [-1096.690] (-1096.444) * (-1095.060) (-1096.847) (-1097.372) [-1096.650] -- 0:00:00
986000 -- (-1096.319) (-1095.452) [-1096.433] (-1099.549) * (-1095.502) [-1096.774] (-1095.494) (-1095.599) -- 0:00:00
986500 -- [-1095.853] (-1095.453) (-1095.553) (-1097.169) * (-1100.970) (-1095.617) (-1100.204) [-1094.923] -- 0:00:00
987000 -- (-1095.182) (-1099.788) (-1099.467) [-1098.598] * (-1097.417) (-1094.771) [-1098.449] (-1096.287) -- 0:00:00
987500 -- (-1094.907) (-1098.580) [-1101.216] (-1098.524) * [-1099.176] (-1096.797) (-1097.022) (-1100.728) -- 0:00:00
988000 -- (-1099.802) [-1096.989] (-1095.406) (-1096.770) * (-1097.450) (-1097.376) (-1097.181) [-1096.484] -- 0:00:00
988500 -- (-1097.736) (-1100.587) [-1100.819] (-1098.761) * (-1096.902) (-1103.716) (-1101.889) [-1096.210] -- 0:00:00
989000 -- (-1096.300) (-1097.718) (-1095.031) [-1095.493] * [-1096.061] (-1102.360) (-1094.653) (-1100.228) -- 0:00:00
989500 -- (-1096.530) (-1097.789) [-1096.816] (-1096.483) * (-1096.556) [-1098.203] (-1096.648) (-1095.786) -- 0:00:00
990000 -- (-1097.109) (-1096.016) [-1097.239] (-1098.519) * [-1104.591] (-1098.533) (-1095.215) (-1096.509) -- 0:00:00
Average standard deviation of split frequencies: 0.007391
990500 -- (-1096.139) (-1095.931) (-1094.978) [-1100.149] * (-1097.582) (-1097.040) (-1100.935) [-1094.897] -- 0:00:00
991000 -- (-1097.747) (-1096.304) [-1096.204] (-1096.403) * (-1098.358) [-1094.592] (-1101.211) (-1095.888) -- 0:00:00
991500 -- (-1097.069) (-1095.771) (-1098.105) [-1094.991] * (-1094.882) [-1096.101] (-1095.950) (-1096.470) -- 0:00:00
992000 -- (-1097.196) [-1095.052] (-1103.048) (-1100.464) * (-1095.338) (-1096.357) (-1095.126) [-1095.245] -- 0:00:00
992500 -- [-1098.390] (-1096.111) (-1100.717) (-1095.950) * (-1099.615) [-1097.822] (-1096.361) (-1096.946) -- 0:00:00
993000 -- (-1095.611) (-1098.431) (-1099.241) [-1096.057] * [-1095.986] (-1098.301) (-1100.666) (-1094.926) -- 0:00:00
993500 -- [-1098.552] (-1098.130) (-1096.467) (-1094.545) * (-1098.564) (-1097.469) [-1095.442] (-1097.635) -- 0:00:00
994000 -- (-1099.332) [-1100.458] (-1097.530) (-1097.344) * (-1099.100) [-1096.101] (-1094.617) (-1096.469) -- 0:00:00
994500 -- [-1097.229] (-1095.625) (-1095.861) (-1096.608) * (-1097.457) (-1096.178) [-1096.965] (-1096.268) -- 0:00:00
995000 -- (-1095.793) [-1098.588] (-1099.765) (-1095.273) * (-1096.790) (-1095.140) [-1097.442] (-1096.687) -- 0:00:00
Average standard deviation of split frequencies: 0.007163
995500 -- (-1096.518) (-1096.150) (-1097.110) [-1095.459] * (-1099.745) (-1095.804) [-1097.828] (-1096.425) -- 0:00:00
996000 -- [-1097.291] (-1098.834) (-1096.021) (-1094.969) * (-1100.249) (-1095.347) [-1097.689] (-1095.211) -- 0:00:00
996500 -- (-1096.683) (-1096.554) [-1094.585] (-1095.752) * (-1096.372) (-1094.662) (-1096.527) [-1096.864] -- 0:00:00
997000 -- (-1095.659) [-1096.000] (-1096.420) (-1095.634) * (-1097.336) (-1097.256) (-1096.058) [-1096.446] -- 0:00:00
997500 -- (-1098.949) (-1096.067) [-1098.441] (-1096.932) * (-1103.379) [-1096.484] (-1097.821) (-1099.765) -- 0:00:00
998000 -- (-1097.571) (-1096.148) (-1098.226) [-1095.452] * (-1096.885) (-1096.947) [-1097.394] (-1097.410) -- 0:00:00
998500 -- (-1101.166) [-1097.406] (-1094.458) (-1098.182) * (-1095.662) (-1095.739) (-1100.364) [-1095.489] -- 0:00:00
999000 -- (-1096.974) [-1096.304] (-1094.551) (-1098.814) * (-1097.047) (-1099.426) (-1097.443) [-1096.236] -- 0:00:00
999500 -- (-1095.846) [-1096.050] (-1096.667) (-1095.567) * (-1095.787) (-1096.947) [-1096.312] (-1095.008) -- 0:00:00
1000000 -- (-1097.518) [-1095.028] (-1096.557) (-1099.447) * (-1099.025) (-1097.182) [-1097.437] (-1095.567) -- 0:00:00
Average standard deviation of split frequencies: 0.007286
Analysis completed in 1 mins 3 seconds
Analysis used 61.40 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1094.31
Likelihood of best state for "cold" chain of run 2 was -1094.35
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.9 % ( 70 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
26.5 % ( 23 %) Dirichlet(Pi{all})
28.7 % ( 23 %) Slider(Pi{all})
78.4 % ( 54 %) Multiplier(Alpha{1,2})
77.9 % ( 52 %) Multiplier(Alpha{3})
19.5 % ( 31 %) Slider(Pinvar{all})
98.6 % ( 96 %) ExtSPR(Tau{all},V{all})
70.2 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 92 %) ParsSPR(Tau{all},V{all})
28.1 % ( 23 %) Multiplier(V{all})
97.3 % ( 97 %) Nodeslider(V{all})
30.3 % ( 16 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.5 % ( 70 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
27.1 % ( 29 %) Dirichlet(Pi{all})
28.3 % ( 31 %) Slider(Pi{all})
78.8 % ( 50 %) Multiplier(Alpha{1,2})
77.5 % ( 42 %) Multiplier(Alpha{3})
19.4 % ( 21 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 82 %) ParsSPR(Tau{all},V{all})
28.1 % ( 22 %) Multiplier(V{all})
97.4 % (100 %) Nodeslider(V{all})
30.7 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166892 0.82 0.67
3 | 166605 166831 0.84
4 | 166116 166514 167042
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167064 0.82 0.67
3 | 166657 166971 0.84
4 | 166021 166482 166805
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1096.13
| 1 2 1 |
|21 |
| 1 2 2 2 2 21 |
| 1 2 2 1 2 |
| 21 1 2 2 1 1 2 21 1 |
| 1 1 2 2 11 2 111 2 2 2 221 12 1 |
| 1 1 2 11 2 222 12 * * |
| 2 2 2 2 2 1 2|
| 1 2 1 2 1 211 * 1 21 2 2 |
|12 1 1 * 21 2 1|
| 2 1 1 1 1 21 1 1 2 |
| 2 2 1 2 12 2 |
| 12 1 1 1 1 |
| 1 |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1097.69
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1096.11 -1100.36
2 -1096.07 -1101.75
--------------------------------------
TOTAL -1096.09 -1101.28
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895919 0.090572 0.370528 1.499677 0.866754 1341.68 1421.34 1.000
r(A<->C){all} 0.155872 0.017660 0.000055 0.423919 0.119764 216.36 220.52 1.000
r(A<->G){all} 0.158788 0.019036 0.000088 0.435159 0.121255 339.11 392.62 1.000
r(A<->T){all} 0.181352 0.021358 0.000049 0.458533 0.146293 190.97 230.07 1.000
r(C<->G){all} 0.167827 0.021211 0.000143 0.463416 0.125849 131.30 192.93 1.000
r(C<->T){all} 0.160326 0.020854 0.000121 0.461030 0.116046 165.18 201.62 1.001
r(G<->T){all} 0.175834 0.019486 0.000450 0.447827 0.144290 194.60 237.59 1.000
pi(A){all} 0.164395 0.000174 0.139552 0.191166 0.164146 1332.96 1336.67 1.000
pi(C){all} 0.251962 0.000241 0.222652 0.281920 0.251949 1265.19 1281.57 1.000
pi(G){all} 0.350024 0.000292 0.316453 0.382788 0.349887 1103.00 1259.72 1.000
pi(T){all} 0.233619 0.000230 0.204293 0.263257 0.233458 1287.43 1342.97 1.000
alpha{1,2} 0.417264 0.223197 0.000275 1.393815 0.248911 1314.76 1321.66 1.000
alpha{3} 0.449686 0.234018 0.000106 1.385424 0.291788 1192.83 1279.32 1.000
pinvar{all} 0.998129 0.000005 0.994025 0.999998 0.998851 1171.82 1336.05 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...**.
8 -- ...*.*
9 -- .*..*.
10 -- .**...
11 -- ..*.*.
12 -- .***.*
13 -- .**.**
14 -- .*.***
15 -- ..**..
16 -- .*.*..
17 -- .****.
18 -- ....**
19 -- .*...*
20 -- ..****
21 -- ..*..*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 441 0.146902 0.023083 0.130580 0.163225 2
8 436 0.145237 0.005653 0.141239 0.149234 2
9 436 0.145237 0.000942 0.144570 0.145903 2
10 435 0.144903 0.003298 0.142572 0.147235 2
11 434 0.144570 0.000942 0.143904 0.145237 2
12 433 0.144237 0.012719 0.135243 0.153231 2
13 432 0.143904 0.010364 0.136576 0.151233 2
14 428 0.142572 0.010364 0.135243 0.149900 2
15 427 0.142239 0.001413 0.141239 0.143238 2
16 426 0.141905 0.009422 0.135243 0.148568 2
17 425 0.141572 0.016488 0.129913 0.153231 2
18 424 0.141239 0.006595 0.136576 0.145903 2
19 413 0.137575 0.000471 0.137242 0.137908 2
20 411 0.136909 0.001413 0.135909 0.137908 2
21 403 0.134244 0.006124 0.129913 0.138574 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.103416 0.009826 0.000024 0.302981 0.073340 1.000 2
length{all}[2] 0.096491 0.009554 0.000018 0.288072 0.067591 1.000 2
length{all}[3] 0.098011 0.009693 0.000039 0.290316 0.068016 1.000 2
length{all}[4] 0.100289 0.009673 0.000086 0.293954 0.069724 1.000 2
length{all}[5] 0.097979 0.009535 0.000033 0.289867 0.067913 1.000 2
length{all}[6] 0.098830 0.009897 0.000113 0.291992 0.067708 1.000 2
length{all}[7] 0.098910 0.008895 0.000684 0.298389 0.072286 0.999 2
length{all}[8] 0.101552 0.009379 0.000202 0.306831 0.073586 1.005 2
length{all}[9] 0.095378 0.008852 0.000108 0.279707 0.064638 0.999 2
length{all}[10] 0.102503 0.011769 0.000309 0.336190 0.069588 0.998 2
length{all}[11] 0.100760 0.009850 0.000038 0.279560 0.071865 0.998 2
length{all}[12] 0.096321 0.009314 0.000100 0.289575 0.064168 0.999 2
length{all}[13] 0.104456 0.011242 0.000033 0.300444 0.068196 0.998 2
length{all}[14] 0.103575 0.008728 0.000482 0.291917 0.075581 0.998 2
length{all}[15] 0.101728 0.009597 0.000164 0.304046 0.070862 0.998 2
length{all}[16] 0.095727 0.009418 0.000851 0.285781 0.068268 0.998 2
length{all}[17] 0.103718 0.011744 0.000037 0.322244 0.061289 0.998 2
length{all}[18] 0.096296 0.008828 0.000585 0.287224 0.066723 0.998 2
length{all}[19] 0.108369 0.011323 0.000328 0.330757 0.078433 1.003 2
length{all}[20] 0.097244 0.009852 0.000009 0.295743 0.062069 1.000 2
length{all}[21] 0.096102 0.008474 0.000468 0.285694 0.067900 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007286
Maximum standard deviation of split frequencies = 0.023083
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------ C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 47 trees
90 % credible set contains 92 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 810
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 56 patterns at 270 / 270 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 56 patterns at 270 / 270 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
54656 bytes for conP
4928 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.019161 0.037105 0.049845 0.089220 0.037875 0.090448 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1151.936074
Iterating by ming2
Initial: fx= 1151.936074
x= 0.01916 0.03711 0.04985 0.08922 0.03787 0.09045 0.30000 1.30000
1 h-m-p 0.0000 0.0001 647.2982 ++ 1121.704892 m 0.0001 13 | 1/8
2 h-m-p 0.0005 0.0054 79.9437 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 592.2380 ++ 1097.922710 m 0.0001 44 | 2/8
4 h-m-p 0.0006 0.0079 61.8267 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 530.8962 ++ 1097.104506 m 0.0000 75 | 3/8
6 h-m-p 0.0000 0.0105 48.4516 ---------.. | 3/8
7 h-m-p 0.0000 0.0000 459.0020 ++ 1087.557431 m 0.0000 104 | 4/8
8 h-m-p 0.0005 0.0131 37.1510 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 374.6718 ++ 1066.423128 m 0.0001 135 | 5/8
10 h-m-p 0.0017 0.0255 23.1585 ------------.. | 5/8
11 h-m-p 0.0000 0.0000 266.8635 ++ 1066.089800 m 0.0000 167 | 6/8
12 h-m-p 0.0160 8.0000 0.0000 N 1066.089800 0 0.0160 178 | 6/8
13 h-m-p 1.2434 8.0000 0.0000 C 1066.089800 0 0.2500 191
Out..
lnL = -1066.089800
192 lfun, 192 eigenQcodon, 1152 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.063509 0.106354 0.076380 0.100692 0.091309 0.040300 0.299928 0.547725 0.459294
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.283132
np = 9
lnL0 = -1190.009839
Iterating by ming2
Initial: fx= 1190.009839
x= 0.06351 0.10635 0.07638 0.10069 0.09131 0.04030 0.29993 0.54772 0.45929
1 h-m-p 0.0000 0.0002 620.3016 ++ 1128.590007 m 0.0002 14 | 1/9
2 h-m-p 0.0001 0.0003 387.8930 ++ 1098.168336 m 0.0003 26 | 2/9
3 h-m-p 0.0000 0.0000 642405.1444 ++ 1084.607685 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0001 1388.0843 ++ 1072.362565 m 0.0001 50 | 4/9
5 h-m-p 0.0000 0.0000 31992.4630 ++ 1067.495831 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 60364.0505 ++ 1066.089726 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0002 ++ 1066.089726 m 8.0000 86 | 6/9
8 h-m-p 0.0021 0.1960 0.6212 ++++ 1066.089705 m 0.1960 103 | 7/9
9 h-m-p 0.3085 5.4801 0.1269 ---------------.. | 7/9
10 h-m-p 0.0160 8.0000 0.0002 +++++ 1066.089704 m 8.0000 148 | 7/9
11 h-m-p 0.0046 1.6899 0.3917 ------------.. | 7/9
12 h-m-p 0.0160 8.0000 0.0002 +++++ 1066.089704 m 8.0000 189 | 7/9
13 h-m-p 0.0046 1.6962 0.3913 -----------Y 1066.089704 0 0.0000 214 | 7/9
14 h-m-p 0.0160 8.0000 0.0006 +++++ 1066.089703 m 8.0000 231 | 7/9
15 h-m-p 0.0116 1.5450 0.4295 ------------Y 1066.089703 0 0.0000 257 | 7/9
16 h-m-p 0.0160 8.0000 0.0000 +++++ 1066.089703 m 8.0000 274 | 7/9
17 h-m-p 0.0035 1.7672 0.3730 -----------Y 1066.089703 0 0.0000 299 | 7/9
18 h-m-p 0.0160 8.0000 0.0003 -------------.. | 7/9
19 h-m-p 0.0160 8.0000 0.0002 +++++ 1066.089703 m 8.0000 341 | 7/9
20 h-m-p 0.0047 1.7220 0.3893 ----------Y 1066.089703 0 0.0000 365 | 7/9
21 h-m-p 0.0100 5.0244 0.0688 +++++ 1066.089558 m 5.0244 382 | 8/9
22 h-m-p 0.5788 8.0000 0.0816 -----------C 1066.089558 0 0.0000 407 | 8/9
23 h-m-p 0.0160 8.0000 0.0002 +++++ 1066.089558 m 8.0000 423 | 8/9
24 h-m-p 0.0160 8.0000 0.9592 ----------Y 1066.089558 0 0.0000 446 | 8/9
25 h-m-p 0.0160 8.0000 0.0001 +++++ 1066.089558 m 8.0000 462 | 8/9
26 h-m-p 0.0160 8.0000 0.9031 ------------Y 1066.089558 0 0.0000 487 | 8/9
27 h-m-p 0.0160 8.0000 0.0000 ---C 1066.089558 0 0.0001 503 | 8/9
28 h-m-p 0.0160 8.0000 0.0000 ----------Y 1066.089558 0 0.0000 526
Out..
lnL = -1066.089558
527 lfun, 1581 eigenQcodon, 6324 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.021552 0.106258 0.058763 0.052973 0.087666 0.108275 0.198243 1.178462 0.105984 0.325056 1.543104
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.814657
np = 11
lnL0 = -1175.377042
Iterating by ming2
Initial: fx= 1175.377042
x= 0.02155 0.10626 0.05876 0.05297 0.08767 0.10827 0.19824 1.17846 0.10598 0.32506 1.54310
1 h-m-p 0.0000 0.0001 585.2829 ++ 1144.432317 m 0.0001 16 | 1/11
2 h-m-p 0.0001 0.0005 333.7806 ++ 1104.219893 m 0.0005 30 | 2/11
3 h-m-p 0.0000 0.0000 4287.1525 ++ 1098.609360 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0002 1043.2772 ++ 1076.052241 m 0.0002 58 | 4/11
5 h-m-p 0.0000 0.0000 129058.0400 ++ 1075.647790 m 0.0000 72 | 5/11
6 h-m-p 0.0002 0.0278 10.1613 ----------.. | 5/11
7 h-m-p 0.0000 0.0001 362.9974 ++ 1066.611610 m 0.0001 108 | 6/11
8 h-m-p 0.0028 0.0474 6.2813 ------------.. | 6/11
9 h-m-p 0.0000 0.0000 263.4985 ++ 1066.089730 m 0.0000 146 | 7/11
10 h-m-p 0.0160 8.0000 0.0000 +++++ 1066.089730 m 8.0000 163 | 7/11
11 h-m-p 0.0459 8.0000 0.0006 ++++ 1066.089730 m 8.0000 183 | 7/11
12 h-m-p 0.0141 1.3288 0.3573 -------------.. | 7/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 1066.089730 m 8.0000 233 | 7/11
14 h-m-p 0.0160 8.0000 1.5836 ----------C 1066.089730 0 0.0000 261 | 7/11
15 h-m-p 0.0160 8.0000 0.0002 +++++ 1066.089730 m 8.0000 278 | 7/11
16 h-m-p 0.0160 8.0000 2.1137 ----------Y 1066.089730 0 0.0000 306 | 7/11
17 h-m-p 0.0160 8.0000 0.0001 ---------C 1066.089730 0 0.0000 329 | 7/11
18 h-m-p 0.0160 8.0000 0.0003 -----C 1066.089730 0 0.0000 352
Out..
lnL = -1066.089730
353 lfun, 1412 eigenQcodon, 6354 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1066.103624 S = -1066.086568 -0.006536
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:03
did 20 / 56 patterns 0:03
did 30 / 56 patterns 0:03
did 40 / 56 patterns 0:03
did 50 / 56 patterns 0:04
did 56 / 56 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.100681 0.058781 0.080974 0.022873 0.039330 0.082256 0.169186 1.017136 1.731964
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 13.999826
np = 9
lnL0 = -1164.092712
Iterating by ming2
Initial: fx= 1164.092712
x= 0.10068 0.05878 0.08097 0.02287 0.03933 0.08226 0.16919 1.01714 1.73196
1 h-m-p 0.0000 0.0001 606.0434 ++ 1130.216890 m 0.0001 14 | 1/9
2 h-m-p 0.0007 0.0041 67.7862 ++ 1117.178055 m 0.0041 26 | 2/9
3 h-m-p 0.0000 0.0000 7457.8358 ++ 1115.125021 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 12355.4069 ++ 1103.280218 m 0.0000 50 | 4/9
5 h-m-p 0.0002 0.0009 191.1047 ++ 1095.348249 m 0.0009 62 | 5/9
6 h-m-p 0.0000 0.0002 551.5126 ++ 1088.428397 m 0.0002 74 | 6/9
7 h-m-p 0.0028 1.4154 71.4755 ------------.. | 6/9
8 h-m-p 0.0000 0.0004 243.9471 +++ 1066.089625 m 0.0004 109 | 7/9
9 h-m-p 1.6000 8.0000 0.0000 ++ 1066.089625 m 8.0000 121 | 7/9
10 h-m-p 0.0160 8.0000 0.0071 +++++ 1066.089625 m 8.0000 138 | 7/9
11 h-m-p 0.0579 8.0000 0.9832 ++++ 1066.089607 m 8.0000 154 | 7/9
12 h-m-p 1.6000 8.0000 0.3068 ++ 1066.089606 m 8.0000 168 | 7/9
13 h-m-p 0.5958 8.0000 4.1189 ++ 1066.089604 m 8.0000 182 | 7/9
14 h-m-p 1.6000 8.0000 3.5055 ++ 1066.089604 m 8.0000 194 | 7/9
15 h-m-p 1.3036 6.5178 11.2273 -----------N 1066.089604 0 0.0000 217 | 7/9
16 h-m-p 1.6000 8.0000 0.0000 -N 1066.089604 0 0.1000 230 | 7/9
17 h-m-p 0.0368 8.0000 0.0000 Y 1066.089604 0 0.0092 244
Out..
lnL = -1066.089604
245 lfun, 2695 eigenQcodon, 14700 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.109860 0.057309 0.024102 0.103175 0.091399 0.027782 0.000100 0.900000 0.786978 1.977154 1.299900
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 14.939420
np = 11
lnL0 = -1168.082746
Iterating by ming2
Initial: fx= 1168.082746
x= 0.10986 0.05731 0.02410 0.10317 0.09140 0.02778 0.00011 0.90000 0.78698 1.97715 1.29990
1 h-m-p 0.0000 0.0000 572.5396 ++ 1167.602670 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0005 284.1633 +++ 1133.412374 m 0.0005 31 | 2/11
3 h-m-p 0.0000 0.0000 426.0334 ++ 1128.626530 m 0.0000 45 | 3/11
4 h-m-p 0.0001 0.0024 121.1665 +++ 1106.238433 m 0.0024 60 | 4/11
5 h-m-p 0.0000 0.0002 1235.3659 ++ 1079.007708 m 0.0002 74 | 5/11
6 h-m-p 0.0003 0.0013 363.4406 ++ 1068.608632 m 0.0013 88 | 6/11
7 h-m-p 0.0000 0.0001 1708.9253 +
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
+ 1068.308880 m 0.0001 102
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201884e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
| 7/11
8 h-m-p 0.0021 0.0383 30.1530
QuantileBeta(0.15, 0.00500, 2.17414) = 1.212041e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18506) = 1.204408e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.18779) = 1.202515e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.18847) = 1.202042e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.18864) = 1.201924e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.18868) = 1.201895e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.18869) = 1.201887e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201884e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
| 7/11
9 h-m-p 0.0000 0.0000 262.6622
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
+ 1066.089763 m 0.0000 140
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201884e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
| 8/11
10 h-m-p 0.1931 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201885e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201884e-160 2000 rounds
+ 1066.089763 m 8.0000 155
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201884e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201884e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201884e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201884e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201884e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201884e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201884e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201884e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201884e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18882) = 1.201800e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18858) = 1.201968e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201884e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201884e-160 2000 rounds
| 8/11
11 h-m-p 0.0160 8.0000 0.0294
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201881e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18871) = 1.201872e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.18877) = 1.201837e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.18897) = 1.201697e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.18978) = 1.201136e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
+ 1066.089758 m 8.0000 175
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.242331e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19093) = 1.200341e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19069) = 1.200509e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
| 8/11
12 h-m-p 0.2941 4.7650 0.8000
QuantileBeta(0.15, 0.00500, 2.18870) = 1.201884e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19028) = 1.200789e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19068) = 1.200516e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19078) = 1.200448e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19080) = 1.200430e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200426e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
C 1066.089758 0 0.0000 204
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.242331e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19093) = 1.200341e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19069) = 1.200509e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
| 8/11
13 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
C 1066.089758 0 0.0000 228
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.242331e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19093) = 1.200341e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19069) = 1.200509e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
| 8/11
14 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
N 1066.089758 0 0.0000 249
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
Out..
lnL = -1066.089758
250 lfun, 3000 eigenQcodon, 16500 P(t)
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1066.103213 S = -1066.085821 -0.007643
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:12
did 20 / 56 patterns 0:12
did 30 / 56 patterns 0:12
did 40 / 56 patterns 0:12
did 50 / 56 patterns 0:13
did 56 / 56 patterns 0:13
QuantileBeta(0.15, 0.00500, 2.19081) = 1.200425e-160 2000 rounds
Time used: 0:13
CodeML output code: -1
CODONML (in paml version 4.9h, March 2018) /data/12res/trpA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 270
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 3 3 3 3 3 3
TTC 2 2 2 2 2 2 | TCC 3 3 3 3 3 3 | TAC 4 4 4 4 4 4 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 4 4 4 4 4 4 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 8 8 8 8 8 8 | TCG 6 6 6 6 6 6 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 4 4 4 4 4 4 | Pro CCT 5 5 5 5 5 5 | His CAT 1 1 1 1 1 1 | Arg CGT 5 5 5 5 5 5
CTC 2 2 2 2 2 2 | CCC 4 4 4 4 4 4 | CAC 2 2 2 2 2 2 | CGC 7 7 7 7 7 7
CTA 2 2 2 2 2 2 | CCA 3 3 3 3 3 3 | Gln CAA 3 3 3 3 3 3 | CGA 4 4 4 4 4 4
CTG 6 6 6 6 6 6 | CCG 2 2 2 2 2 2 | CAG 4 4 4 4 4 4 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 6 6 6 6 6 6 | Thr ACT 3 3 3 3 3 3 | Asn AAT 2 2 2 2 2 2 | Ser AGT 1 1 1 1 1 1
ATC 5 5 5 5 5 5 | ACC 5 5 5 5 5 5 | AAC 0 0 0 0 0 0 | AGC 2 2 2 2 2 2
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 7 7 7 7 7 7 | ACG 4 4 4 4 4 4 | AAG 2 2 2 2 2 2 | AGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 9 9 9 9 9 9 | Ala GCT 4 4 4 4 4 4 | Asp GAT 6 6 6 6 6 6 | Gly GGT 10 10 10 10 10 10
GTC 8 8 8 8 8 8 | GCC 9 9 9 9 9 9 | GAC 10 10 10 10 10 10 | GGC 7 7 7 7 7 7
GTA 2 2 2 2 2 2 | GCA 5 5 5 5 5 5 | Glu GAA 8 8 8 8 8 8 | GGA 6 6 6 6 6 6
GTG 17 17 17 17 17 17 | GCG 17 17 17 17 17 17 | GAG 6 6 6 6 6 6 | GGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908239_1_1340_MLBR_RS06295
position 1: T:0.14815 C:0.21111 A:0.15926 G:0.48148
position 2: T:0.30370 C:0.28519 A:0.18889 G:0.22222
position 3: T:0.24815 C:0.25926 A:0.14444 G:0.34815
Average T:0.23333 C:0.25185 A:0.16420 G:0.35062
#2: NC_002677_1_NP_301918_1_790_trpA
position 1: T:0.14815 C:0.21111 A:0.15926 G:0.48148
position 2: T:0.30370 C:0.28519 A:0.18889 G:0.22222
position 3: T:0.24815 C:0.25926 A:0.14444 G:0.34815
Average T:0.23333 C:0.25185 A:0.16420 G:0.35062
#3: NZ_LVXE01000031_1_WP_010908239_1_1441_A3216_RS09065
position 1: T:0.14815 C:0.21111 A:0.15926 G:0.48148
position 2: T:0.30370 C:0.28519 A:0.18889 G:0.22222
position 3: T:0.24815 C:0.25926 A:0.14444 G:0.34815
Average T:0.23333 C:0.25185 A:0.16420 G:0.35062
#4: NZ_LYPH01000034_1_WP_010908239_1_1407_A8144_RS06730
position 1: T:0.14815 C:0.21111 A:0.15926 G:0.48148
position 2: T:0.30370 C:0.28519 A:0.18889 G:0.22222
position 3: T:0.24815 C:0.25926 A:0.14444 G:0.34815
Average T:0.23333 C:0.25185 A:0.16420 G:0.35062
#5: NZ_CP029543_1_WP_010908239_1_1362_DIJ64_RS06915
position 1: T:0.14815 C:0.21111 A:0.15926 G:0.48148
position 2: T:0.30370 C:0.28519 A:0.18889 G:0.22222
position 3: T:0.24815 C:0.25926 A:0.14444 G:0.34815
Average T:0.23333 C:0.25185 A:0.16420 G:0.35062
#6: NZ_AP014567_1_WP_010908239_1_1393_JK2ML_RS07070
position 1: T:0.14815 C:0.21111 A:0.15926 G:0.48148
position 2: T:0.30370 C:0.28519 A:0.18889 G:0.22222
position 3: T:0.24815 C:0.25926 A:0.14444 G:0.34815
Average T:0.23333 C:0.25185 A:0.16420 G:0.35062
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 12 | Tyr Y TAT 18 | Cys C TGT 18
TTC 12 | TCC 18 | TAC 24 | TGC 0
Leu L TTA 0 | TCA 24 | *** * TAA 0 | *** * TGA 0
TTG 48 | TCG 36 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 24 | Pro P CCT 30 | His H CAT 6 | Arg R CGT 30
CTC 12 | CCC 24 | CAC 12 | CGC 42
CTA 12 | CCA 18 | Gln Q CAA 18 | CGA 24
CTG 36 | CCG 12 | CAG 24 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 36 | Thr T ACT 18 | Asn N AAT 12 | Ser S AGT 6
ATC 30 | ACC 30 | AAC 0 | AGC 12
ATA 6 | ACA 6 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 42 | ACG 24 | AAG 12 | AGG 24
------------------------------------------------------------------------------
Val V GTT 54 | Ala A GCT 24 | Asp D GAT 36 | Gly G GGT 60
GTC 48 | GCC 54 | GAC 60 | GGC 42
GTA 12 | GCA 30 | Glu E GAA 48 | GGA 36
GTG 102 | GCG 102 | GAG 36 | GGG 36
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14815 C:0.21111 A:0.15926 G:0.48148
position 2: T:0.30370 C:0.28519 A:0.18889 G:0.22222
position 3: T:0.24815 C:0.25926 A:0.14444 G:0.34815
Average T:0.23333 C:0.25185 A:0.16420 G:0.35062
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -1066.089800 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299928 1.299900
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908239_1_1340_MLBR_RS06295: 0.000004, NC_002677_1_NP_301918_1_790_trpA: 0.000004, NZ_LVXE01000031_1_WP_010908239_1_1441_A3216_RS09065: 0.000004, NZ_LYPH01000034_1_WP_010908239_1_1407_A8144_RS06730: 0.000004, NZ_CP029543_1_WP_010908239_1_1362_DIJ64_RS06915: 0.000004, NZ_AP014567_1_WP_010908239_1_1393_JK2ML_RS07070: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29993
omega (dN/dS) = 1.29990
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 566.0 244.0 1.2999 0.0000 0.0000 0.0 0.0
7..2 0.000 566.0 244.0 1.2999 0.0000 0.0000 0.0 0.0
7..3 0.000 566.0 244.0 1.2999 0.0000 0.0000 0.0 0.0
7..4 0.000 566.0 244.0 1.2999 0.0000 0.0000 0.0 0.0
7..5 0.000 566.0 244.0 1.2999 0.0000 0.0000 0.0 0.0
7..6 0.000 566.0 244.0 1.2999 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1066.089558 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.198243 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908239_1_1340_MLBR_RS06295: 0.000004, NC_002677_1_NP_301918_1_790_trpA: 0.000004, NZ_LVXE01000031_1_WP_010908239_1_1441_A3216_RS09065: 0.000004, NZ_LYPH01000034_1_WP_010908239_1_1407_A8144_RS06730: 0.000004, NZ_CP029543_1_WP_010908239_1_1362_DIJ64_RS06915: 0.000004, NZ_AP014567_1_WP_010908239_1_1393_JK2ML_RS07070: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.19824
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 567.8 242.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 567.8 242.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 567.8 242.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 567.8 242.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 567.8 242.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 567.8 242.2 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1066.089730 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.169186 0.612834 0.201534 0.000001 1.619857
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908239_1_1340_MLBR_RS06295: 0.000004, NC_002677_1_NP_301918_1_790_trpA: 0.000004, NZ_LVXE01000031_1_WP_010908239_1_1441_A3216_RS09065: 0.000004, NZ_LYPH01000034_1_WP_010908239_1_1407_A8144_RS06730: 0.000004, NZ_CP029543_1_WP_010908239_1_1362_DIJ64_RS06915: 0.000004, NZ_AP014567_1_WP_010908239_1_1393_JK2ML_RS07070: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.16919
MLEs of dN/dS (w) for site classes (K=3)
p: 0.61283 0.20153 0.18563
w: 0.00000 1.00000 1.61986
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 568.3 241.7 0.5022 0.0000 0.0000 0.0 0.0
7..2 0.000 568.3 241.7 0.5022 0.0000 0.0000 0.0 0.0
7..3 0.000 568.3 241.7 0.5022 0.0000 0.0000 0.0 0.0
7..4 0.000 568.3 241.7 0.5022 0.0000 0.0000 0.0 0.0
7..5 0.000 568.3 241.7 0.5022 0.0000 0.0000 0.0 0.0
7..6 0.000 568.3 241.7 0.5022 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908239_1_1340_MLBR_RS06295)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908239_1_1340_MLBR_RS06295)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1066.089604 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 8.571732 72.692160
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908239_1_1340_MLBR_RS06295: 0.000004, NC_002677_1_NP_301918_1_790_trpA: 0.000004, NZ_LVXE01000031_1_WP_010908239_1_1441_A3216_RS09065: 0.000004, NZ_LYPH01000034_1_WP_010908239_1_1407_A8144_RS06730: 0.000004, NZ_CP029543_1_WP_010908239_1_1362_DIJ64_RS06915: 0.000004, NZ_AP014567_1_WP_010908239_1_1393_JK2ML_RS07070: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 8.57173 q = 72.69216
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.05579 0.07092 0.08106 0.08977 0.09807 0.10652 0.11569 0.12641 0.14058 0.16623
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 571.7 238.3 0.1051 0.0000 0.0000 0.0 0.0
7..2 0.000 571.7 238.3 0.1051 0.0000 0.0000 0.0 0.0
7..3 0.000 571.7 238.3 0.1051 0.0000 0.0000 0.0 0.0
7..4 0.000 571.7 238.3 0.1051 0.0000 0.0000 0.0 0.0
7..5 0.000 571.7 238.3 0.1051 0.0000 0.0000 0.0 0.0
7..6 0.000 571.7 238.3 0.1051 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1066.089758 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.580253 0.005000 2.190809 1.837352
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908239_1_1340_MLBR_RS06295: 0.000004, NC_002677_1_NP_301918_1_790_trpA: 0.000004, NZ_LVXE01000031_1_WP_010908239_1_1441_A3216_RS09065: 0.000004, NZ_LYPH01000034_1_WP_010908239_1_1407_A8144_RS06730: 0.000004, NZ_CP029543_1_WP_010908239_1_1362_DIJ64_RS06915: 0.000004, NZ_AP014567_1_WP_010908239_1_1393_JK2ML_RS07070: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.58025 p = 0.00500 q = 2.19081
(p1 = 0.41975) w = 1.83735
MLEs of dN/dS (w) for site classes (K=11)
p: 0.05803 0.05803 0.05803 0.05803 0.05803 0.05803 0.05803 0.05803 0.05803 0.05803 0.41975
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.83735
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 571.7 238.3 0.7712 0.0000 0.0000 0.0 0.0
7..2 0.000 571.7 238.3 0.7712 0.0000 0.0000 0.0 0.0
7..3 0.000 571.7 238.3 0.7712 0.0000 0.0000 0.0 0.0
7..4 0.000 571.7 238.3 0.7712 0.0000 0.0000 0.0 0.0
7..5 0.000 571.7 238.3 0.7712 0.0000 0.0000 0.0 0.0
7..6 0.000 571.7 238.3 0.7712 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908239_1_1340_MLBR_RS06295)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908239_1_1340_MLBR_RS06295)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.099 0.100 0.100 0.100 0.100 0.101 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Time used: 0:13