--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:39:33 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/trpA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1096.11         -1100.36
2      -1096.07         -1101.75
--------------------------------------
TOTAL    -1096.09         -1101.28
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.895919    0.090572    0.370528    1.499677    0.866754   1341.68   1421.34    1.000
r(A<->C){all}   0.155872    0.017660    0.000055    0.423919    0.119764    216.36    220.52    1.000
r(A<->G){all}   0.158788    0.019036    0.000088    0.435159    0.121255    339.11    392.62    1.000
r(A<->T){all}   0.181352    0.021358    0.000049    0.458533    0.146293    190.97    230.07    1.000
r(C<->G){all}   0.167827    0.021211    0.000143    0.463416    0.125849    131.30    192.93    1.000
r(C<->T){all}   0.160326    0.020854    0.000121    0.461030    0.116046    165.18    201.62    1.001
r(G<->T){all}   0.175834    0.019486    0.000450    0.447827    0.144290    194.60    237.59    1.000
pi(A){all}      0.164395    0.000174    0.139552    0.191166    0.164146   1332.96   1336.67    1.000
pi(C){all}      0.251962    0.000241    0.222652    0.281920    0.251949   1265.19   1281.57    1.000
pi(G){all}      0.350024    0.000292    0.316453    0.382788    0.349887   1103.00   1259.72    1.000
pi(T){all}      0.233619    0.000230    0.204293    0.263257    0.233458   1287.43   1342.97    1.000
alpha{1,2}      0.417264    0.223197    0.000275    1.393815    0.248911   1314.76   1321.66    1.000
alpha{3}        0.449686    0.234018    0.000106    1.385424    0.291788   1192.83   1279.32    1.000
pinvar{all}     0.998129    0.000005    0.994025    0.999998    0.998851   1171.82   1336.05    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1066.089558
Model 2: PositiveSelection	-1066.08973
Model 0: one-ratio	-1066.0898
Model 7: beta	-1066.089604
Model 8: beta&w>1	-1066.089758


Model 0 vs 1	4.840000001422595E-4

Model 2 vs 1	3.440000000409782E-4

Model 8 vs 7	3.0800000013186946E-4
>C1
MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
PRLRALAEELAAGVRQRTFM
>C2
MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
PRLRALAEELAAGVRQRTFM
>C3
MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
PRLRALAEELAAGVRQRTFM
>C4
MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
PRLRALAEELAAGVRQRTFM
>C5
MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
PRLRALAEELAAGVRQRTFM
>C6
MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
PRLRALAEELAAGVRQRTFM
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=270 

C1              MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
C2              MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
C3              MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
C4              MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
C5              MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
C6              MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
                **************************************************

C1              SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
C2              SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
C3              SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
C4              SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
C5              SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
C6              SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
                **************************************************

C1              GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
C2              GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
C3              GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
C4              GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
C5              GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
C6              GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
                **************************************************

C1              KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
C2              KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
C3              KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
C4              KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
C5              KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
C6              KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
                **************************************************

C1              ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
C2              ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
C3              ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
C4              ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
C5              ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
C6              ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
                **************************************************

C1              PRLRALAEELAAGVRQRTFM
C2              PRLRALAEELAAGVRQRTFM
C3              PRLRALAEELAAGVRQRTFM
C4              PRLRALAEELAAGVRQRTFM
C5              PRLRALAEELAAGVRQRTFM
C6              PRLRALAEELAAGVRQRTFM
                ********************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [8100]--->[8100]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.489 Mb, Max= 30.816 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
C2              MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
C3              MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
C4              MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
C5              MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
C6              MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
                **************************************************

C1              SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
C2              SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
C3              SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
C4              SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
C5              SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
C6              SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
                **************************************************

C1              GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
C2              GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
C3              GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
C4              GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
C5              GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
C6              GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
                **************************************************

C1              KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
C2              KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
C3              KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
C4              KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
C5              KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
C6              KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
                **************************************************

C1              ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
C2              ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
C3              ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
C4              ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
C5              ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
C6              ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
                **************************************************

C1              PRLRALAEELAAGVRQRTFM
C2              PRLRALAEELAAGVRQRTFM
C3              PRLRALAEELAAGVRQRTFM
C4              PRLRALAEELAAGVRQRTFM
C5              PRLRALAEELAAGVRQRTFM
C6              PRLRALAEELAAGVRQRTFM
                ********************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGATGGTTCTGGAACAGAGCGAAACAAGTAGGCTTGGGCCGGTTTTCGA
C2              ATGATGGTTCTGGAACAGAGCGAAACAAGTAGGCTTGGGCCGGTTTTCGA
C3              ATGATGGTTCTGGAACAGAGCGAAACAAGTAGGCTTGGGCCGGTTTTCGA
C4              ATGATGGTTCTGGAACAGAGCGAAACAAGTAGGCTTGGGCCGGTTTTCGA
C5              ATGATGGTTCTGGAACAGAGCGAAACAAGTAGGCTTGGGCCGGTTTTCGA
C6              ATGATGGTTCTGGAACAGAGCGAAACAAGTAGGCTTGGGCCGGTTTTCGA
                **************************************************

C1              TTCGTGTCGTGCGGACAATCGCGCGGCATTGATTGGTTACTTGCCCACCG
C2              TTCGTGTCGTGCGGACAATCGCGCGGCATTGATTGGTTACTTGCCCACCG
C3              TTCGTGTCGTGCGGACAATCGCGCGGCATTGATTGGTTACTTGCCCACCG
C4              TTCGTGTCGTGCGGACAATCGCGCGGCATTGATTGGTTACTTGCCCACCG
C5              TTCGTGTCGTGCGGACAATCGCGCGGCATTGATTGGTTACTTGCCCACCG
C6              TTCGTGTCGTGCGGACAATCGCGCGGCATTGATTGGTTACTTGCCCACCG
                **************************************************

C1              GTTACCCTGATGTGCCTACTTCGGTGGACGCGATGATAGAACTCGTCGAA
C2              GTTACCCTGATGTGCCTACTTCGGTGGACGCGATGATAGAACTCGTCGAA
C3              GTTACCCTGATGTGCCTACTTCGGTGGACGCGATGATAGAACTCGTCGAA
C4              GTTACCCTGATGTGCCTACTTCGGTGGACGCGATGATAGAACTCGTCGAA
C5              GTTACCCTGATGTGCCTACTTCGGTGGACGCGATGATAGAACTCGTCGAA
C6              GTTACCCTGATGTGCCTACTTCGGTGGACGCGATGATAGAACTCGTCGAA
                **************************************************

C1              TCCGGCTGTGACATCATTGAAGTTGGCGTTCCTTATTCGGATCCCGGTAT
C2              TCCGGCTGTGACATCATTGAAGTTGGCGTTCCTTATTCGGATCCCGGTAT
C3              TCCGGCTGTGACATCATTGAAGTTGGCGTTCCTTATTCGGATCCCGGTAT
C4              TCCGGCTGTGACATCATTGAAGTTGGCGTTCCTTATTCGGATCCCGGTAT
C5              TCCGGCTGTGACATCATTGAAGTTGGCGTTCCTTATTCGGATCCCGGTAT
C6              TCCGGCTGTGACATCATTGAAGTTGGCGTTCCTTATTCGGATCCCGGTAT
                **************************************************

C1              GGACGGTCCAACCATCGCGAGGGCCACCGAGGTTGCGCTTCGTGGAGGAG
C2              GGACGGTCCAACCATCGCGAGGGCCACCGAGGTTGCGCTTCGTGGAGGAG
C3              GGACGGTCCAACCATCGCGAGGGCCACCGAGGTTGCGCTTCGTGGAGGAG
C4              GGACGGTCCAACCATCGCGAGGGCCACCGAGGTTGCGCTTCGTGGAGGAG
C5              GGACGGTCCAACCATCGCGAGGGCCACCGAGGTTGCGCTTCGTGGAGGAG
C6              GGACGGTCCAACCATCGCGAGGGCCACCGAGGTTGCGCTTCGTGGAGGAG
                **************************************************

C1              TACGAGTCCGCGATACTCTAGCCGCGGTCGAGGCGATCAGCCAAGCTGGC
C2              TACGAGTCCGCGATACTCTAGCCGCGGTCGAGGCGATCAGCCAAGCTGGC
C3              TACGAGTCCGCGATACTCTAGCCGCGGTCGAGGCGATCAGCCAAGCTGGC
C4              TACGAGTCCGCGATACTCTAGCCGCGGTCGAGGCGATCAGCCAAGCTGGC
C5              TACGAGTCCGCGATACTCTAGCCGCGGTCGAGGCGATCAGCCAAGCTGGC
C6              TACGAGTCCGCGATACTCTAGCCGCGGTCGAGGCGATCAGCCAAGCTGGC
                **************************************************

C1              GGACGCGCCGTGGTGATGACGTACTGGAATCCTGTGTTGCGCTATGGGGT
C2              GGACGCGCCGTGGTGATGACGTACTGGAATCCTGTGTTGCGCTATGGGGT
C3              GGACGCGCCGTGGTGATGACGTACTGGAATCCTGTGTTGCGCTATGGGGT
C4              GGACGCGCCGTGGTGATGACGTACTGGAATCCTGTGTTGCGCTATGGGGT
C5              GGACGCGCCGTGGTGATGACGTACTGGAATCCTGTGTTGCGCTATGGGGT
C6              GGACGCGCCGTGGTGATGACGTACTGGAATCCTGTGTTGCGCTATGGGGT
                **************************************************

C1              TTGTGCGTTTGCGCGGGATCTGGAGTCAGCTGGAGGACACGGTCTGGTCA
C2              TTGTGCGTTTGCGCGGGATCTGGAGTCAGCTGGAGGACACGGTCTGGTCA
C3              TTGTGCGTTTGCGCGGGATCTGGAGTCAGCTGGAGGACACGGTCTGGTCA
C4              TTGTGCGTTTGCGCGGGATCTGGAGTCAGCTGGAGGACACGGTCTGGTCA
C5              TTGTGCGTTTGCGCGGGATCTGGAGTCAGCTGGAGGACACGGTCTGGTCA
C6              TTGTGCGTTTGCGCGGGATCTGGAGTCAGCTGGAGGACACGGTCTGGTCA
                **************************************************

C1              CTCCCGACCTTATTCCCGACGAAGCACGCCAATGGATCGCGGCATCCGAG
C2              CTCCCGACCTTATTCCCGACGAAGCACGCCAATGGATCGCGGCATCCGAG
C3              CTCCCGACCTTATTCCCGACGAAGCACGCCAATGGATCGCGGCATCCGAG
C4              CTCCCGACCTTATTCCCGACGAAGCACGCCAATGGATCGCGGCATCCGAG
C5              CTCCCGACCTTATTCCCGACGAAGCACGCCAATGGATCGCGGCATCCGAG
C6              CTCCCGACCTTATTCCCGACGAAGCACGCCAATGGATCGCGGCATCCGAG
                **************************************************

C1              AAGCATCGGTTGGATCGCATTTTTCTAGTGGCTCCATCATCGACGCCGCA
C2              AAGCATCGGTTGGATCGCATTTTTCTAGTGGCTCCATCATCGACGCCGCA
C3              AAGCATCGGTTGGATCGCATTTTTCTAGTGGCTCCATCATCGACGCCGCA
C4              AAGCATCGGTTGGATCGCATTTTTCTAGTGGCTCCATCATCGACGCCGCA
C5              AAGCATCGGTTGGATCGCATTTTTCTAGTGGCTCCATCATCGACGCCGCA
C6              AAGCATCGGTTGGATCGCATTTTTCTAGTGGCTCCATCATCGACGCCGCA
                **************************************************

C1              CCGGTTGGTGACCACGGTCGGGGCATCACGTGGATTTGTTTATGCGGTGT
C2              CCGGTTGGTGACCACGGTCGGGGCATCACGTGGATTTGTTTATGCGGTGT
C3              CCGGTTGGTGACCACGGTCGGGGCATCACGTGGATTTGTTTATGCGGTGT
C4              CCGGTTGGTGACCACGGTCGGGGCATCACGTGGATTTGTTTATGCGGTGT
C5              CCGGTTGGTGACCACGGTCGGGGCATCACGTGGATTTGTTTATGCGGTGT
C6              CCGGTTGGTGACCACGGTCGGGGCATCACGTGGATTTGTTTATGCGGTGT
                **************************************************

C1              CTGTGATGGGTGTGACCGGGGCGCGTGACGCGGTGTCGCAGGTTGTGCCA
C2              CTGTGATGGGTGTGACCGGGGCGCGTGACGCGGTGTCGCAGGTTGTGCCA
C3              CTGTGATGGGTGTGACCGGGGCGCGTGACGCGGTGTCGCAGGTTGTGCCA
C4              CTGTGATGGGTGTGACCGGGGCGCGTGACGCGGTGTCGCAGGTTGTGCCA
C5              CTGTGATGGGTGTGACCGGGGCGCGTGACGCGGTGTCGCAGGTTGTGCCA
C6              CTGTGATGGGTGTGACCGGGGCGCGTGACGCGGTGTCGCAGGTTGTGCCA
                **************************************************

C1              GAACTGGTGGCCAGGGTGAAGGCAGTATCTGACATTGCGGTCGGGGTCGG
C2              GAACTGGTGGCCAGGGTGAAGGCAGTATCTGACATTGCGGTCGGGGTCGG
C3              GAACTGGTGGCCAGGGTGAAGGCAGTATCTGACATTGCGGTCGGGGTCGG
C4              GAACTGGTGGCCAGGGTGAAGGCAGTATCTGACATTGCGGTCGGGGTCGG
C5              GAACTGGTGGCCAGGGTGAAGGCAGTATCTGACATTGCGGTCGGGGTCGG
C6              GAACTGGTGGCCAGGGTGAAGGCAGTATCTGACATTGCGGTCGGGGTCGG
                **************************************************

C1              CCTGGGGGTGCGATCACGAGAGCAGGCCGCGCAGATCGGCGGCTACGCCG
C2              CCTGGGGGTGCGATCACGAGAGCAGGCCGCGCAGATCGGCGGCTACGCCG
C3              CCTGGGGGTGCGATCACGAGAGCAGGCCGCGCAGATCGGCGGCTACGCCG
C4              CCTGGGGGTGCGATCACGAGAGCAGGCCGCGCAGATCGGCGGCTACGCCG
C5              CCTGGGGGTGCGATCACGAGAGCAGGCCGCGCAGATCGGCGGCTACGCCG
C6              CCTGGGGGTGCGATCACGAGAGCAGGCCGCGCAGATCGGCGGCTACGCCG
                **************************************************

C1              ACGGTGTCATTGTTGGTTCCGCGTTGGTGTCGGCGCTGGGTGACGGTTTG
C2              ACGGTGTCATTGTTGGTTCCGCGTTGGTGTCGGCGCTGGGTGACGGTTTG
C3              ACGGTGTCATTGTTGGTTCCGCGTTGGTGTCGGCGCTGGGTGACGGTTTG
C4              ACGGTGTCATTGTTGGTTCCGCGTTGGTGTCGGCGCTGGGTGACGGTTTG
C5              ACGGTGTCATTGTTGGTTCCGCGTTGGTGTCGGCGCTGGGTGACGGTTTG
C6              ACGGTGTCATTGTTGGTTCCGCGTTGGTGTCGGCGCTGGGTGACGGTTTG
                **************************************************

C1              CCTCGATTGCGTGCTCTTGCCGAGGAACTCGCCGCCGGCGTGCGCCAAAG
C2              CCTCGATTGCGTGCTCTTGCCGAGGAACTCGCCGCCGGCGTGCGCCAAAG
C3              CCTCGATTGCGTGCTCTTGCCGAGGAACTCGCCGCCGGCGTGCGCCAAAG
C4              CCTCGATTGCGTGCTCTTGCCGAGGAACTCGCCGCCGGCGTGCGCCAAAG
C5              CCTCGATTGCGTGCTCTTGCCGAGGAACTCGCCGCCGGCGTGCGCCAAAG
C6              CCTCGATTGCGTGCTCTTGCCGAGGAACTCGCCGCCGGCGTGCGCCAAAG
                **************************************************

C1              GACGTTCATG
C2              GACGTTCATG
C3              GACGTTCATG
C4              GACGTTCATG
C5              GACGTTCATG
C6              GACGTTCATG
                **********



>C1
ATGATGGTTCTGGAACAGAGCGAAACAAGTAGGCTTGGGCCGGTTTTCGA
TTCGTGTCGTGCGGACAATCGCGCGGCATTGATTGGTTACTTGCCCACCG
GTTACCCTGATGTGCCTACTTCGGTGGACGCGATGATAGAACTCGTCGAA
TCCGGCTGTGACATCATTGAAGTTGGCGTTCCTTATTCGGATCCCGGTAT
GGACGGTCCAACCATCGCGAGGGCCACCGAGGTTGCGCTTCGTGGAGGAG
TACGAGTCCGCGATACTCTAGCCGCGGTCGAGGCGATCAGCCAAGCTGGC
GGACGCGCCGTGGTGATGACGTACTGGAATCCTGTGTTGCGCTATGGGGT
TTGTGCGTTTGCGCGGGATCTGGAGTCAGCTGGAGGACACGGTCTGGTCA
CTCCCGACCTTATTCCCGACGAAGCACGCCAATGGATCGCGGCATCCGAG
AAGCATCGGTTGGATCGCATTTTTCTAGTGGCTCCATCATCGACGCCGCA
CCGGTTGGTGACCACGGTCGGGGCATCACGTGGATTTGTTTATGCGGTGT
CTGTGATGGGTGTGACCGGGGCGCGTGACGCGGTGTCGCAGGTTGTGCCA
GAACTGGTGGCCAGGGTGAAGGCAGTATCTGACATTGCGGTCGGGGTCGG
CCTGGGGGTGCGATCACGAGAGCAGGCCGCGCAGATCGGCGGCTACGCCG
ACGGTGTCATTGTTGGTTCCGCGTTGGTGTCGGCGCTGGGTGACGGTTTG
CCTCGATTGCGTGCTCTTGCCGAGGAACTCGCCGCCGGCGTGCGCCAAAG
GACGTTCATG
>C2
ATGATGGTTCTGGAACAGAGCGAAACAAGTAGGCTTGGGCCGGTTTTCGA
TTCGTGTCGTGCGGACAATCGCGCGGCATTGATTGGTTACTTGCCCACCG
GTTACCCTGATGTGCCTACTTCGGTGGACGCGATGATAGAACTCGTCGAA
TCCGGCTGTGACATCATTGAAGTTGGCGTTCCTTATTCGGATCCCGGTAT
GGACGGTCCAACCATCGCGAGGGCCACCGAGGTTGCGCTTCGTGGAGGAG
TACGAGTCCGCGATACTCTAGCCGCGGTCGAGGCGATCAGCCAAGCTGGC
GGACGCGCCGTGGTGATGACGTACTGGAATCCTGTGTTGCGCTATGGGGT
TTGTGCGTTTGCGCGGGATCTGGAGTCAGCTGGAGGACACGGTCTGGTCA
CTCCCGACCTTATTCCCGACGAAGCACGCCAATGGATCGCGGCATCCGAG
AAGCATCGGTTGGATCGCATTTTTCTAGTGGCTCCATCATCGACGCCGCA
CCGGTTGGTGACCACGGTCGGGGCATCACGTGGATTTGTTTATGCGGTGT
CTGTGATGGGTGTGACCGGGGCGCGTGACGCGGTGTCGCAGGTTGTGCCA
GAACTGGTGGCCAGGGTGAAGGCAGTATCTGACATTGCGGTCGGGGTCGG
CCTGGGGGTGCGATCACGAGAGCAGGCCGCGCAGATCGGCGGCTACGCCG
ACGGTGTCATTGTTGGTTCCGCGTTGGTGTCGGCGCTGGGTGACGGTTTG
CCTCGATTGCGTGCTCTTGCCGAGGAACTCGCCGCCGGCGTGCGCCAAAG
GACGTTCATG
>C3
ATGATGGTTCTGGAACAGAGCGAAACAAGTAGGCTTGGGCCGGTTTTCGA
TTCGTGTCGTGCGGACAATCGCGCGGCATTGATTGGTTACTTGCCCACCG
GTTACCCTGATGTGCCTACTTCGGTGGACGCGATGATAGAACTCGTCGAA
TCCGGCTGTGACATCATTGAAGTTGGCGTTCCTTATTCGGATCCCGGTAT
GGACGGTCCAACCATCGCGAGGGCCACCGAGGTTGCGCTTCGTGGAGGAG
TACGAGTCCGCGATACTCTAGCCGCGGTCGAGGCGATCAGCCAAGCTGGC
GGACGCGCCGTGGTGATGACGTACTGGAATCCTGTGTTGCGCTATGGGGT
TTGTGCGTTTGCGCGGGATCTGGAGTCAGCTGGAGGACACGGTCTGGTCA
CTCCCGACCTTATTCCCGACGAAGCACGCCAATGGATCGCGGCATCCGAG
AAGCATCGGTTGGATCGCATTTTTCTAGTGGCTCCATCATCGACGCCGCA
CCGGTTGGTGACCACGGTCGGGGCATCACGTGGATTTGTTTATGCGGTGT
CTGTGATGGGTGTGACCGGGGCGCGTGACGCGGTGTCGCAGGTTGTGCCA
GAACTGGTGGCCAGGGTGAAGGCAGTATCTGACATTGCGGTCGGGGTCGG
CCTGGGGGTGCGATCACGAGAGCAGGCCGCGCAGATCGGCGGCTACGCCG
ACGGTGTCATTGTTGGTTCCGCGTTGGTGTCGGCGCTGGGTGACGGTTTG
CCTCGATTGCGTGCTCTTGCCGAGGAACTCGCCGCCGGCGTGCGCCAAAG
GACGTTCATG
>C4
ATGATGGTTCTGGAACAGAGCGAAACAAGTAGGCTTGGGCCGGTTTTCGA
TTCGTGTCGTGCGGACAATCGCGCGGCATTGATTGGTTACTTGCCCACCG
GTTACCCTGATGTGCCTACTTCGGTGGACGCGATGATAGAACTCGTCGAA
TCCGGCTGTGACATCATTGAAGTTGGCGTTCCTTATTCGGATCCCGGTAT
GGACGGTCCAACCATCGCGAGGGCCACCGAGGTTGCGCTTCGTGGAGGAG
TACGAGTCCGCGATACTCTAGCCGCGGTCGAGGCGATCAGCCAAGCTGGC
GGACGCGCCGTGGTGATGACGTACTGGAATCCTGTGTTGCGCTATGGGGT
TTGTGCGTTTGCGCGGGATCTGGAGTCAGCTGGAGGACACGGTCTGGTCA
CTCCCGACCTTATTCCCGACGAAGCACGCCAATGGATCGCGGCATCCGAG
AAGCATCGGTTGGATCGCATTTTTCTAGTGGCTCCATCATCGACGCCGCA
CCGGTTGGTGACCACGGTCGGGGCATCACGTGGATTTGTTTATGCGGTGT
CTGTGATGGGTGTGACCGGGGCGCGTGACGCGGTGTCGCAGGTTGTGCCA
GAACTGGTGGCCAGGGTGAAGGCAGTATCTGACATTGCGGTCGGGGTCGG
CCTGGGGGTGCGATCACGAGAGCAGGCCGCGCAGATCGGCGGCTACGCCG
ACGGTGTCATTGTTGGTTCCGCGTTGGTGTCGGCGCTGGGTGACGGTTTG
CCTCGATTGCGTGCTCTTGCCGAGGAACTCGCCGCCGGCGTGCGCCAAAG
GACGTTCATG
>C5
ATGATGGTTCTGGAACAGAGCGAAACAAGTAGGCTTGGGCCGGTTTTCGA
TTCGTGTCGTGCGGACAATCGCGCGGCATTGATTGGTTACTTGCCCACCG
GTTACCCTGATGTGCCTACTTCGGTGGACGCGATGATAGAACTCGTCGAA
TCCGGCTGTGACATCATTGAAGTTGGCGTTCCTTATTCGGATCCCGGTAT
GGACGGTCCAACCATCGCGAGGGCCACCGAGGTTGCGCTTCGTGGAGGAG
TACGAGTCCGCGATACTCTAGCCGCGGTCGAGGCGATCAGCCAAGCTGGC
GGACGCGCCGTGGTGATGACGTACTGGAATCCTGTGTTGCGCTATGGGGT
TTGTGCGTTTGCGCGGGATCTGGAGTCAGCTGGAGGACACGGTCTGGTCA
CTCCCGACCTTATTCCCGACGAAGCACGCCAATGGATCGCGGCATCCGAG
AAGCATCGGTTGGATCGCATTTTTCTAGTGGCTCCATCATCGACGCCGCA
CCGGTTGGTGACCACGGTCGGGGCATCACGTGGATTTGTTTATGCGGTGT
CTGTGATGGGTGTGACCGGGGCGCGTGACGCGGTGTCGCAGGTTGTGCCA
GAACTGGTGGCCAGGGTGAAGGCAGTATCTGACATTGCGGTCGGGGTCGG
CCTGGGGGTGCGATCACGAGAGCAGGCCGCGCAGATCGGCGGCTACGCCG
ACGGTGTCATTGTTGGTTCCGCGTTGGTGTCGGCGCTGGGTGACGGTTTG
CCTCGATTGCGTGCTCTTGCCGAGGAACTCGCCGCCGGCGTGCGCCAAAG
GACGTTCATG
>C6
ATGATGGTTCTGGAACAGAGCGAAACAAGTAGGCTTGGGCCGGTTTTCGA
TTCGTGTCGTGCGGACAATCGCGCGGCATTGATTGGTTACTTGCCCACCG
GTTACCCTGATGTGCCTACTTCGGTGGACGCGATGATAGAACTCGTCGAA
TCCGGCTGTGACATCATTGAAGTTGGCGTTCCTTATTCGGATCCCGGTAT
GGACGGTCCAACCATCGCGAGGGCCACCGAGGTTGCGCTTCGTGGAGGAG
TACGAGTCCGCGATACTCTAGCCGCGGTCGAGGCGATCAGCCAAGCTGGC
GGACGCGCCGTGGTGATGACGTACTGGAATCCTGTGTTGCGCTATGGGGT
TTGTGCGTTTGCGCGGGATCTGGAGTCAGCTGGAGGACACGGTCTGGTCA
CTCCCGACCTTATTCCCGACGAAGCACGCCAATGGATCGCGGCATCCGAG
AAGCATCGGTTGGATCGCATTTTTCTAGTGGCTCCATCATCGACGCCGCA
CCGGTTGGTGACCACGGTCGGGGCATCACGTGGATTTGTTTATGCGGTGT
CTGTGATGGGTGTGACCGGGGCGCGTGACGCGGTGTCGCAGGTTGTGCCA
GAACTGGTGGCCAGGGTGAAGGCAGTATCTGACATTGCGGTCGGGGTCGG
CCTGGGGGTGCGATCACGAGAGCAGGCCGCGCAGATCGGCGGCTACGCCG
ACGGTGTCATTGTTGGTTCCGCGTTGGTGTCGGCGCTGGGTGACGGTTTG
CCTCGATTGCGTGCTCTTGCCGAGGAACTCGCCGCCGGCGTGCGCCAAAG
GACGTTCATG
>C1
MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
PRLRALAEELAAGVRQRTFM
>C2
MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
PRLRALAEELAAGVRQRTFM
>C3
MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
PRLRALAEELAAGVRQRTFM
>C4
MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
PRLRALAEELAAGVRQRTFM
>C5
MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
PRLRALAEELAAGVRQRTFM
>C6
MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVE
SGCDIIEVGVPYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAG
GRAVVMTYWNPVLRYGVCAFARDLESAGGHGLVTPDLIPDEARQWIAASE
KHRLDRIFLVAPSSTPHRLVTTVGASRGFVYAVSVMGVTGARDAVSQVVP
ELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGSALVSALGDGL
PRLRALAEELAAGVRQRTFM


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 810 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579790295
      Setting output file names to "/data/12res/trpA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1041169347
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0182151338
      Seed = 882410644
      Swapseed = 1579790295
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1812.818718 -- -24.965149
         Chain 2 -- -1812.818549 -- -24.965149
         Chain 3 -- -1812.818824 -- -24.965149
         Chain 4 -- -1812.818718 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1812.818824 -- -24.965149
         Chain 2 -- -1812.818824 -- -24.965149
         Chain 3 -- -1812.818824 -- -24.965149
         Chain 4 -- -1812.818824 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1812.819] (-1812.819) (-1812.819) (-1812.819) * [-1812.819] (-1812.819) (-1812.819) (-1812.819) 
        500 -- (-1132.393) (-1110.538) (-1126.267) [-1111.238] * (-1109.056) [-1109.275] (-1119.097) (-1121.153) -- 0:00:00
       1000 -- (-1108.507) (-1101.116) (-1117.647) [-1105.236] * [-1105.593] (-1110.157) (-1115.476) (-1106.985) -- 0:00:00
       1500 -- [-1107.451] (-1105.573) (-1109.815) (-1110.775) * [-1108.303] (-1101.074) (-1118.159) (-1109.126) -- 0:00:00
       2000 -- (-1107.112) (-1114.261) (-1111.349) [-1101.316] * [-1109.190] (-1105.517) (-1104.376) (-1107.431) -- 0:00:00
       2500 -- (-1107.759) (-1114.588) (-1103.391) [-1106.036] * (-1115.227) (-1111.693) (-1109.718) [-1106.317] -- 0:00:00
       3000 -- (-1109.912) (-1113.400) (-1107.445) [-1102.737] * (-1113.281) (-1102.592) [-1106.397] (-1107.667) -- 0:00:00
       3500 -- [-1102.820] (-1110.560) (-1101.657) (-1104.480) * (-1115.885) [-1106.278] (-1101.593) (-1102.116) -- 0:00:00
       4000 -- (-1102.049) [-1104.698] (-1107.803) (-1100.289) * [-1103.615] (-1106.151) (-1112.777) (-1110.798) -- 0:00:00
       4500 -- (-1109.637) (-1110.362) (-1105.038) [-1103.125] * [-1109.917] (-1113.049) (-1118.729) (-1104.607) -- 0:00:00
       5000 -- [-1109.576] (-1102.638) (-1100.382) (-1104.023) * [-1107.573] (-1109.732) (-1099.308) (-1107.552) -- 0:00:00

      Average standard deviation of split frequencies: 0.047824

       5500 -- (-1104.786) [-1113.253] (-1103.725) (-1108.648) * [-1104.333] (-1109.265) (-1109.554) (-1107.974) -- 0:03:00
       6000 -- (-1104.642) (-1110.434) (-1107.336) [-1111.870] * (-1107.251) (-1100.788) [-1110.149] (-1103.563) -- 0:02:45
       6500 -- [-1103.319] (-1104.703) (-1110.189) (-1104.477) * (-1100.822) (-1107.773) [-1100.337] (-1107.149) -- 0:02:32
       7000 -- (-1110.960) (-1102.334) [-1107.592] (-1101.681) * (-1103.149) [-1105.036] (-1102.573) (-1109.080) -- 0:02:21
       7500 -- (-1108.546) [-1103.905] (-1107.632) (-1107.015) * (-1109.311) (-1108.104) (-1104.242) [-1100.832] -- 0:02:12
       8000 -- [-1097.482] (-1110.245) (-1107.368) (-1114.625) * (-1105.592) (-1102.008) (-1105.503) [-1104.288] -- 0:02:04
       8500 -- (-1095.487) (-1111.402) [-1104.264] (-1110.058) * [-1100.774] (-1101.513) (-1103.077) (-1108.515) -- 0:01:56
       9000 -- (-1096.316) (-1102.587) [-1106.092] (-1106.646) * [-1104.564] (-1108.680) (-1112.375) (-1107.410) -- 0:01:50
       9500 -- [-1096.418] (-1109.486) (-1103.924) (-1114.192) * (-1102.411) (-1119.325) [-1105.077] (-1102.675) -- 0:01:44
      10000 -- (-1095.256) (-1106.861) (-1111.681) [-1103.030] * (-1102.672) (-1108.418) [-1107.900] (-1101.280) -- 0:01:39

      Average standard deviation of split frequencies: 0.064082

      10500 -- [-1094.896] (-1099.152) (-1120.109) (-1110.555) * (-1103.022) (-1107.148) (-1109.919) [-1105.250] -- 0:01:34
      11000 -- (-1096.033) (-1115.601) [-1103.100] (-1113.132) * [-1108.827] (-1109.866) (-1107.941) (-1104.063) -- 0:01:29
      11500 -- (-1096.169) (-1103.788) (-1101.366) [-1106.327] * (-1109.562) (-1108.220) (-1104.422) [-1100.486] -- 0:01:25
      12000 -- (-1099.892) [-1108.581] (-1107.135) (-1107.397) * (-1103.747) [-1102.874] (-1107.036) (-1102.389) -- 0:01:22
      12500 -- [-1097.764] (-1108.213) (-1102.583) (-1115.938) * (-1107.019) (-1107.376) (-1102.280) [-1106.463] -- 0:01:19
      13000 -- (-1096.850) (-1104.570) (-1107.418) [-1106.763] * (-1108.965) [-1106.870] (-1113.456) (-1108.757) -- 0:01:15
      13500 -- (-1096.277) [-1111.658] (-1110.198) (-1110.043) * (-1120.919) (-1109.461) (-1104.362) [-1104.507] -- 0:01:13
      14000 -- (-1095.032) [-1105.638] (-1105.451) (-1102.452) * (-1104.927) [-1106.612] (-1101.430) (-1095.434) -- 0:01:10
      14500 -- (-1096.817) (-1103.015) (-1111.239) [-1107.170] * (-1114.815) (-1105.568) (-1097.026) [-1095.423] -- 0:01:07
      15000 -- (-1097.394) (-1103.916) [-1095.549] (-1107.109) * [-1103.196] (-1105.548) (-1097.787) (-1095.659) -- 0:01:05

      Average standard deviation of split frequencies: 0.070711

      15500 -- (-1101.316) (-1106.612) [-1097.524] (-1101.149) * (-1109.574) [-1108.734] (-1098.016) (-1097.373) -- 0:01:03
      16000 -- [-1096.879] (-1114.451) (-1100.202) (-1107.220) * (-1106.038) (-1104.642) [-1095.468] (-1097.478) -- 0:01:01
      16500 -- (-1102.479) [-1103.339] (-1102.083) (-1110.552) * [-1102.072] (-1111.342) (-1096.225) (-1097.576) -- 0:00:59
      17000 -- (-1099.362) (-1103.263) [-1098.756] (-1103.033) * [-1106.203] (-1103.725) (-1094.846) (-1099.762) -- 0:00:57
      17500 -- (-1104.026) (-1109.342) (-1098.156) [-1105.524] * (-1104.745) [-1105.498] (-1095.322) (-1098.332) -- 0:00:56
      18000 -- (-1100.794) [-1101.091] (-1098.300) (-1106.188) * (-1108.255) [-1104.091] (-1096.268) (-1098.562) -- 0:00:54
      18500 -- (-1103.502) (-1116.612) (-1098.220) [-1104.343] * [-1107.156] (-1107.376) (-1099.523) (-1096.902) -- 0:00:53
      19000 -- (-1101.579) (-1103.164) [-1101.455] (-1104.180) * [-1107.453] (-1109.212) (-1095.531) (-1097.481) -- 0:01:43
      19500 -- (-1101.736) [-1104.903] (-1101.914) (-1113.953) * [-1105.110] (-1109.790) (-1094.505) (-1097.104) -- 0:01:40
      20000 -- (-1102.798) (-1102.772) (-1096.927) [-1107.874] * (-1108.219) [-1100.787] (-1094.835) (-1097.710) -- 0:01:38

      Average standard deviation of split frequencies: 0.072774

      20500 -- (-1100.548) [-1102.532] (-1097.178) (-1104.307) * (-1101.553) [-1104.532] (-1094.539) (-1096.648) -- 0:01:35
      21000 -- (-1097.120) (-1106.577) [-1095.446] (-1111.384) * (-1109.603) [-1109.702] (-1094.930) (-1095.128) -- 0:01:33
      21500 -- (-1096.253) [-1107.619] (-1096.007) (-1114.379) * [-1106.948] (-1102.411) (-1096.352) (-1095.307) -- 0:01:31
      22000 -- (-1099.194) (-1107.496) [-1096.450] (-1111.044) * (-1105.858) (-1105.565) (-1096.890) [-1098.861] -- 0:01:28
      22500 -- (-1099.788) [-1111.542] (-1096.042) (-1109.014) * (-1108.867) (-1101.034) [-1097.608] (-1095.872) -- 0:01:26
      23000 -- (-1099.413) [-1105.584] (-1095.695) (-1109.691) * [-1104.469] (-1096.860) (-1096.181) (-1098.234) -- 0:01:24
      23500 -- [-1097.617] (-1107.836) (-1098.685) (-1109.830) * [-1101.613] (-1099.801) (-1097.047) (-1096.691) -- 0:01:23
      24000 -- [-1096.627] (-1095.094) (-1099.848) (-1104.049) * (-1102.500) (-1100.043) (-1095.339) [-1100.915] -- 0:01:21
      24500 -- (-1096.322) [-1095.833] (-1096.563) (-1106.041) * [-1109.464] (-1097.080) (-1095.339) (-1097.868) -- 0:01:19
      25000 -- (-1096.714) (-1095.933) [-1096.105] (-1103.216) * (-1102.202) (-1097.726) (-1097.936) [-1096.206] -- 0:01:18

      Average standard deviation of split frequencies: 0.054393

      25500 -- (-1095.285) (-1096.680) [-1096.197] (-1105.085) * (-1108.555) (-1098.533) (-1095.806) [-1094.676] -- 0:01:16
      26000 -- (-1096.171) [-1095.074] (-1094.990) (-1111.652) * (-1105.089) (-1097.335) [-1097.339] (-1095.198) -- 0:01:14
      26500 -- (-1097.081) [-1095.222] (-1095.677) (-1106.004) * (-1106.888) (-1101.232) (-1095.897) [-1095.615] -- 0:01:13
      27000 -- [-1095.808] (-1095.886) (-1095.002) (-1105.715) * (-1102.938) (-1098.740) [-1097.438] (-1094.790) -- 0:01:12
      27500 -- (-1094.791) (-1095.340) [-1097.014] (-1105.349) * (-1097.063) [-1100.458] (-1096.288) (-1097.622) -- 0:01:10
      28000 -- (-1096.788) (-1094.547) (-1098.453) [-1104.458] * (-1097.384) (-1095.886) [-1098.085] (-1095.759) -- 0:01:09
      28500 -- (-1099.176) [-1094.594] (-1099.278) (-1110.168) * (-1098.100) (-1099.089) [-1096.706] (-1096.968) -- 0:01:08
      29000 -- (-1097.977) [-1094.582] (-1098.053) (-1109.564) * (-1096.454) (-1096.809) (-1100.320) [-1096.322] -- 0:01:06
      29500 -- [-1099.772] (-1095.289) (-1095.966) (-1102.095) * (-1097.636) (-1095.217) (-1098.620) [-1096.434] -- 0:01:05
      30000 -- (-1103.201) (-1095.551) [-1098.958] (-1110.156) * (-1096.101) (-1097.031) (-1097.372) [-1096.861] -- 0:01:04

      Average standard deviation of split frequencies: 0.039967

      30500 -- (-1095.898) (-1096.321) [-1095.243] (-1106.283) * (-1098.120) (-1097.140) (-1095.056) [-1097.906] -- 0:01:03
      31000 -- (-1099.628) (-1095.838) (-1096.017) [-1112.093] * [-1096.824] (-1096.600) (-1096.594) (-1096.717) -- 0:01:02
      31500 -- (-1104.030) (-1095.320) [-1098.399] (-1108.525) * (-1096.354) [-1095.325] (-1097.554) (-1101.338) -- 0:01:01
      32000 -- (-1102.245) [-1098.051] (-1095.398) (-1105.251) * (-1097.137) (-1096.995) [-1095.575] (-1102.547) -- 0:01:00
      32500 -- (-1101.661) [-1094.518] (-1097.400) (-1111.367) * [-1097.378] (-1095.999) (-1095.779) (-1095.240) -- 0:00:59
      33000 -- (-1097.020) [-1095.655] (-1097.376) (-1112.209) * (-1097.951) [-1095.082] (-1096.958) (-1096.189) -- 0:00:58
      33500 -- (-1097.001) (-1095.501) [-1096.009] (-1102.766) * (-1097.675) (-1095.474) [-1098.163] (-1098.155) -- 0:00:57
      34000 -- (-1097.023) (-1095.835) (-1098.063) [-1101.306] * (-1097.560) [-1095.899] (-1095.428) (-1096.176) -- 0:00:56
      34500 -- [-1096.718] (-1098.891) (-1100.712) (-1103.330) * (-1100.992) [-1095.589] (-1094.783) (-1096.591) -- 0:01:23
      35000 -- (-1102.179) (-1097.333) (-1098.672) [-1104.352] * (-1098.393) [-1096.384] (-1097.961) (-1096.024) -- 0:01:22

      Average standard deviation of split frequencies: 0.046865

      35500 -- [-1098.583] (-1095.811) (-1098.928) (-1109.094) * (-1097.248) (-1096.094) (-1098.397) [-1095.464] -- 0:01:21
      36000 -- (-1099.843) (-1096.086) [-1095.860] (-1105.980) * [-1095.151] (-1098.459) (-1096.861) (-1096.174) -- 0:01:20
      36500 -- (-1096.132) (-1096.151) [-1095.095] (-1107.293) * (-1096.831) (-1095.704) (-1098.247) [-1095.733] -- 0:01:19
      37000 -- (-1094.916) (-1096.120) [-1096.191] (-1104.346) * (-1099.397) (-1096.716) (-1098.642) [-1096.112] -- 0:01:18
      37500 -- (-1096.508) (-1098.475) [-1095.889] (-1101.914) * (-1097.907) (-1095.513) (-1095.179) [-1096.953] -- 0:01:17
      38000 -- (-1097.388) [-1098.061] (-1096.602) (-1102.083) * [-1096.019] (-1095.571) (-1097.255) (-1095.658) -- 0:01:15
      38500 -- (-1098.312) [-1094.880] (-1096.557) (-1109.796) * (-1098.479) (-1095.673) [-1095.643] (-1096.008) -- 0:01:14
      39000 -- [-1096.345] (-1096.789) (-1096.899) (-1106.778) * (-1096.844) (-1096.204) (-1098.893) [-1094.902] -- 0:01:13
      39500 -- (-1100.209) [-1096.552] (-1095.018) (-1103.415) * (-1095.999) (-1095.447) (-1097.111) [-1095.007] -- 0:01:12
      40000 -- (-1096.234) [-1095.481] (-1099.253) (-1102.674) * (-1101.265) (-1097.780) (-1096.709) [-1096.509] -- 0:01:12

      Average standard deviation of split frequencies: 0.041487

      40500 -- (-1099.618) (-1094.768) (-1096.175) [-1104.411] * (-1100.317) (-1096.450) [-1098.448] (-1096.186) -- 0:01:11
      41000 -- (-1097.511) (-1096.483) [-1096.331] (-1108.255) * [-1096.786] (-1098.112) (-1098.433) (-1096.821) -- 0:01:10
      41500 -- (-1095.681) (-1100.074) (-1096.602) [-1106.497] * [-1099.850] (-1095.494) (-1097.655) (-1096.078) -- 0:01:09
      42000 -- (-1096.673) [-1099.239] (-1095.544) (-1113.338) * (-1097.390) (-1098.134) [-1097.148] (-1096.413) -- 0:01:08
      42500 -- (-1096.449) (-1099.397) (-1095.634) [-1106.142] * [-1096.317] (-1096.631) (-1098.888) (-1096.037) -- 0:01:07
      43000 -- (-1096.469) (-1095.448) (-1096.153) [-1101.268] * (-1097.155) [-1096.806] (-1101.023) (-1097.182) -- 0:01:06
      43500 -- (-1096.234) (-1100.789) [-1097.243] (-1105.281) * (-1096.971) (-1098.107) [-1096.440] (-1096.813) -- 0:01:05
      44000 -- (-1098.792) (-1094.528) [-1096.141] (-1107.538) * (-1097.231) (-1098.382) [-1095.691] (-1096.668) -- 0:01:05
      44500 -- (-1096.751) (-1095.935) [-1098.439] (-1106.050) * (-1098.289) (-1098.918) [-1098.903] (-1101.072) -- 0:01:04
      45000 -- (-1096.642) [-1096.470] (-1095.160) (-1106.227) * (-1095.445) (-1099.864) [-1096.587] (-1098.178) -- 0:01:03

      Average standard deviation of split frequencies: 0.029719

      45500 -- (-1097.015) (-1097.695) [-1094.520] (-1104.608) * [-1098.515] (-1097.198) (-1094.773) (-1097.562) -- 0:01:02
      46000 -- [-1098.827] (-1098.980) (-1099.950) (-1105.105) * [-1098.245] (-1098.106) (-1097.391) (-1096.104) -- 0:01:02
      46500 -- (-1100.518) [-1097.478] (-1096.373) (-1113.073) * (-1100.229) (-1096.447) [-1096.637] (-1096.389) -- 0:01:01
      47000 -- [-1095.730] (-1098.173) (-1097.122) (-1115.007) * [-1097.231] (-1102.237) (-1095.906) (-1099.865) -- 0:01:00
      47500 -- (-1097.009) (-1098.733) [-1099.933] (-1107.576) * (-1098.721) [-1095.319] (-1098.295) (-1097.473) -- 0:01:00
      48000 -- (-1095.854) [-1097.099] (-1095.628) (-1111.018) * (-1096.341) [-1095.740] (-1095.661) (-1097.885) -- 0:00:59
      48500 -- (-1096.027) (-1096.822) [-1095.813] (-1107.081) * (-1096.158) (-1094.926) [-1098.377] (-1098.558) -- 0:00:58
      49000 -- [-1096.824] (-1096.197) (-1096.130) (-1105.069) * (-1098.151) (-1098.168) [-1095.234] (-1103.555) -- 0:00:58
      49500 -- [-1095.712] (-1096.727) (-1096.366) (-1113.000) * (-1100.008) (-1097.517) [-1095.695] (-1102.004) -- 0:00:57
      50000 -- (-1100.273) (-1095.876) (-1095.015) [-1107.842] * (-1099.510) (-1096.239) [-1095.511] (-1100.031) -- 0:00:57

      Average standard deviation of split frequencies: 0.023505

      50500 -- (-1095.900) (-1098.292) (-1096.790) [-1101.778] * (-1098.597) (-1098.703) [-1095.230] (-1099.802) -- 0:01:15
      51000 -- (-1097.477) (-1097.752) [-1096.279] (-1108.902) * (-1098.495) (-1102.152) [-1096.450] (-1098.600) -- 0:01:14
      51500 -- (-1097.812) [-1096.190] (-1096.147) (-1103.069) * (-1099.027) [-1097.734] (-1097.852) (-1097.473) -- 0:01:13
      52000 -- (-1102.194) (-1096.193) [-1096.920] (-1116.242) * (-1098.043) (-1097.445) [-1100.104] (-1098.030) -- 0:01:12
      52500 -- (-1096.831) (-1096.190) [-1096.923] (-1107.053) * (-1097.294) (-1096.137) (-1098.410) [-1098.192] -- 0:01:12
      53000 -- [-1097.837] (-1098.293) (-1097.175) (-1121.053) * (-1096.367) [-1096.481] (-1095.590) (-1099.474) -- 0:01:11
      53500 -- [-1097.080] (-1099.841) (-1096.798) (-1105.409) * (-1098.177) [-1098.014] (-1095.902) (-1098.677) -- 0:01:10
      54000 -- (-1096.692) (-1094.823) (-1095.727) [-1102.565] * (-1098.128) [-1099.460] (-1096.096) (-1096.152) -- 0:01:10
      54500 -- (-1098.653) (-1095.605) (-1098.857) [-1112.442] * (-1097.262) [-1096.944] (-1095.141) (-1095.272) -- 0:01:09
      55000 -- (-1098.543) (-1096.294) [-1098.937] (-1108.211) * (-1097.581) (-1097.748) [-1095.737] (-1095.512) -- 0:01:08

      Average standard deviation of split frequencies: 0.022915

      55500 -- (-1097.650) (-1097.268) (-1096.965) [-1102.995] * (-1094.679) [-1095.942] (-1095.906) (-1096.671) -- 0:01:08
      56000 -- [-1097.401] (-1096.733) (-1099.111) (-1100.467) * [-1095.074] (-1095.149) (-1095.016) (-1095.449) -- 0:01:07
      56500 -- (-1096.883) (-1095.622) (-1098.170) [-1110.176] * (-1095.089) [-1096.593] (-1094.879) (-1096.112) -- 0:01:06
      57000 -- (-1097.154) (-1096.304) (-1096.279) [-1105.937] * (-1096.636) [-1095.601] (-1097.863) (-1094.847) -- 0:01:06
      57500 -- (-1095.372) [-1095.358] (-1096.292) (-1104.577) * (-1095.965) (-1097.126) [-1099.641] (-1094.872) -- 0:01:05
      58000 -- (-1095.281) [-1098.020] (-1096.611) (-1107.837) * (-1100.842) [-1095.575] (-1096.991) (-1095.124) -- 0:01:04
      58500 -- [-1094.806] (-1098.661) (-1098.593) (-1111.103) * (-1097.480) (-1097.138) (-1097.055) [-1095.437] -- 0:01:04
      59000 -- (-1095.642) [-1096.219] (-1095.455) (-1096.205) * (-1096.037) (-1096.364) (-1098.423) [-1095.557] -- 0:01:03
      59500 -- (-1095.282) (-1095.791) (-1095.852) [-1096.645] * [-1097.226] (-1096.644) (-1101.709) (-1098.332) -- 0:01:03
      60000 -- (-1095.341) (-1098.051) [-1096.182] (-1097.797) * (-1100.010) [-1098.240] (-1107.354) (-1094.929) -- 0:01:02

      Average standard deviation of split frequencies: 0.018994

      60500 -- [-1095.081] (-1098.007) (-1095.766) (-1095.370) * (-1102.533) (-1102.089) (-1096.369) [-1095.476] -- 0:01:02
      61000 -- [-1094.818] (-1099.134) (-1098.857) (-1094.815) * [-1098.402] (-1101.024) (-1101.073) (-1099.412) -- 0:01:01
      61500 -- (-1095.023) (-1098.175) (-1099.412) [-1098.123] * (-1100.697) (-1096.750) [-1095.691] (-1099.877) -- 0:01:01
      62000 -- (-1097.286) (-1097.349) (-1096.694) [-1097.884] * (-1101.749) (-1101.301) (-1095.700) [-1101.798] -- 0:01:00
      62500 -- (-1097.011) (-1098.472) (-1095.115) [-1096.296] * (-1103.014) [-1096.897] (-1098.590) (-1096.726) -- 0:01:00
      63000 -- (-1098.238) (-1101.225) [-1095.675] (-1096.138) * (-1097.813) (-1100.470) [-1096.122] (-1099.981) -- 0:00:59
      63500 -- (-1096.830) (-1099.455) [-1099.800] (-1097.066) * (-1097.657) (-1098.268) (-1095.565) [-1096.899] -- 0:00:58
      64000 -- (-1097.876) (-1098.898) (-1096.275) [-1095.921] * (-1095.456) (-1096.260) [-1097.571] (-1096.815) -- 0:00:58
      64500 -- (-1095.809) [-1100.128] (-1094.826) (-1098.267) * (-1095.097) (-1096.433) [-1095.265] (-1094.827) -- 0:00:58
      65000 -- (-1097.777) (-1097.705) [-1095.609] (-1096.834) * [-1095.612] (-1096.294) (-1096.234) (-1096.342) -- 0:00:57

      Average standard deviation of split frequencies: 0.021103

      65500 -- (-1097.281) (-1098.932) [-1096.262] (-1095.540) * (-1098.284) [-1098.256] (-1095.111) (-1096.652) -- 0:00:57
      66000 -- [-1096.659] (-1097.923) (-1099.740) (-1096.887) * (-1098.019) (-1095.719) [-1094.570] (-1097.895) -- 0:00:56
      66500 -- (-1095.143) (-1095.391) (-1102.821) [-1097.383] * (-1098.461) (-1095.778) [-1096.737] (-1099.737) -- 0:00:56
      67000 -- [-1094.966] (-1099.624) (-1098.422) (-1095.974) * (-1095.112) (-1095.605) (-1097.721) [-1098.583] -- 0:01:09
      67500 -- [-1100.982] (-1095.609) (-1095.461) (-1097.204) * (-1095.059) [-1099.950] (-1097.575) (-1096.203) -- 0:01:09
      68000 -- [-1102.310] (-1095.451) (-1098.149) (-1098.133) * (-1098.172) [-1097.967] (-1098.307) (-1096.572) -- 0:01:08
      68500 -- (-1097.607) (-1097.104) [-1096.664] (-1095.937) * (-1096.575) [-1094.876] (-1096.345) (-1103.939) -- 0:01:07
      69000 -- [-1095.842] (-1097.640) (-1098.922) (-1095.855) * (-1096.123) (-1095.537) (-1097.139) [-1097.032] -- 0:01:07
      69500 -- (-1094.772) (-1098.619) [-1097.392] (-1097.693) * (-1097.930) (-1096.666) [-1097.089] (-1100.525) -- 0:01:06
      70000 -- (-1095.843) (-1098.646) [-1095.499] (-1099.296) * (-1095.929) (-1096.731) (-1097.964) [-1097.259] -- 0:01:06

      Average standard deviation of split frequencies: 0.025016

      70500 -- (-1096.544) (-1099.823) (-1095.937) [-1097.715] * (-1100.133) [-1094.683] (-1095.471) (-1096.158) -- 0:01:05
      71000 -- (-1095.125) (-1098.348) (-1095.665) [-1099.091] * (-1095.657) [-1095.028] (-1095.515) (-1097.125) -- 0:01:05
      71500 -- (-1095.520) (-1096.502) [-1096.686] (-1096.782) * (-1095.861) [-1096.898] (-1094.735) (-1095.875) -- 0:01:04
      72000 -- (-1095.241) (-1095.780) [-1096.469] (-1097.299) * (-1096.977) (-1099.946) (-1095.950) [-1096.502] -- 0:01:04
      72500 -- (-1095.296) (-1098.738) [-1096.099] (-1096.620) * [-1095.559] (-1100.271) (-1096.655) (-1100.406) -- 0:01:03
      73000 -- (-1095.098) [-1094.547] (-1095.967) (-1095.285) * (-1098.426) [-1098.526] (-1094.937) (-1100.760) -- 0:01:03
      73500 -- [-1094.922] (-1096.571) (-1095.434) (-1098.079) * [-1095.651] (-1095.680) (-1096.078) (-1096.076) -- 0:01:03
      74000 -- (-1096.333) (-1097.482) [-1096.176] (-1097.019) * (-1101.827) (-1096.964) (-1098.062) [-1096.008] -- 0:01:02
      74500 -- (-1098.451) (-1098.327) [-1097.762] (-1095.152) * (-1095.776) (-1099.466) (-1098.795) [-1095.443] -- 0:01:02
      75000 -- (-1096.473) (-1098.722) (-1096.254) [-1099.706] * (-1095.177) (-1099.150) [-1096.565] (-1099.198) -- 0:01:01

      Average standard deviation of split frequencies: 0.021709

      75500 -- (-1095.858) (-1097.449) [-1098.555] (-1096.875) * [-1096.536] (-1098.635) (-1095.677) (-1096.489) -- 0:01:01
      76000 -- (-1094.898) (-1098.724) (-1094.821) [-1096.754] * (-1095.550) (-1097.363) [-1098.429] (-1095.571) -- 0:01:00
      76500 -- (-1095.377) (-1099.546) [-1095.010] (-1096.049) * (-1096.253) (-1097.347) (-1096.221) [-1095.229] -- 0:01:00
      77000 -- (-1097.868) (-1098.114) [-1096.348] (-1102.501) * (-1096.558) (-1098.887) (-1098.922) [-1098.936] -- 0:00:59
      77500 -- (-1097.622) [-1100.015] (-1095.060) (-1099.103) * (-1098.304) (-1104.110) (-1096.427) [-1101.065] -- 0:00:59
      78000 -- (-1095.248) (-1099.271) (-1096.135) [-1099.137] * (-1099.881) [-1100.733] (-1096.152) (-1099.882) -- 0:00:59
      78500 -- (-1095.779) [-1098.269] (-1098.705) (-1099.747) * (-1098.959) (-1095.231) [-1097.992] (-1099.668) -- 0:00:58
      79000 -- (-1095.244) (-1100.406) (-1095.255) [-1098.843] * (-1100.748) [-1096.733] (-1100.831) (-1097.751) -- 0:00:58
      79500 -- (-1095.170) (-1102.339) [-1095.966] (-1098.157) * (-1098.827) [-1097.895] (-1098.259) (-1096.707) -- 0:00:57
      80000 -- (-1097.502) (-1098.882) [-1095.493] (-1095.679) * (-1095.779) (-1098.914) [-1096.738] (-1102.204) -- 0:00:57

      Average standard deviation of split frequencies: 0.027596

      80500 -- [-1097.636] (-1099.481) (-1099.519) (-1096.566) * (-1096.201) (-1099.919) [-1096.052] (-1102.084) -- 0:00:57
      81000 -- (-1097.546) (-1097.965) (-1096.395) [-1095.305] * (-1098.100) (-1099.598) [-1097.076] (-1101.425) -- 0:00:56
      81500 -- (-1094.976) [-1097.652] (-1101.136) (-1096.434) * (-1101.960) [-1096.747] (-1096.234) (-1094.679) -- 0:00:56
      82000 -- (-1094.994) (-1096.946) [-1095.278] (-1096.987) * [-1101.517] (-1095.588) (-1095.892) (-1096.998) -- 0:00:55
      82500 -- (-1094.984) [-1097.180] (-1095.644) (-1096.380) * (-1100.269) (-1097.813) [-1096.611] (-1094.861) -- 0:00:55
      83000 -- (-1095.232) [-1097.143] (-1095.418) (-1097.442) * (-1101.336) [-1097.844] (-1098.648) (-1095.985) -- 0:00:55
      83500 -- (-1095.561) (-1095.021) (-1095.402) [-1097.643] * (-1097.449) (-1099.085) (-1096.843) [-1095.407] -- 0:01:05
      84000 -- (-1095.107) (-1098.498) [-1098.761] (-1097.170) * (-1098.272) (-1099.573) [-1094.877] (-1096.530) -- 0:01:05
      84500 -- [-1095.243] (-1098.551) (-1095.159) (-1095.918) * (-1095.868) (-1099.259) (-1095.903) [-1096.746] -- 0:01:05
      85000 -- (-1094.959) (-1097.061) (-1095.514) [-1098.675] * (-1095.300) (-1099.751) (-1095.731) [-1095.666] -- 0:01:04

      Average standard deviation of split frequencies: 0.026830

      85500 -- (-1096.204) (-1097.058) [-1095.183] (-1096.840) * (-1096.599) (-1097.109) [-1096.840] (-1095.108) -- 0:01:04
      86000 -- (-1096.132) (-1102.924) [-1097.627] (-1095.187) * (-1098.792) [-1096.091] (-1096.079) (-1095.154) -- 0:01:03
      86500 -- (-1094.679) (-1102.565) [-1098.406] (-1097.434) * (-1095.500) (-1095.777) (-1096.233) [-1096.092] -- 0:01:03
      87000 -- (-1096.239) [-1095.928] (-1097.898) (-1094.981) * [-1095.529] (-1094.680) (-1095.191) (-1095.801) -- 0:01:02
      87500 -- (-1096.760) (-1096.858) (-1096.479) [-1096.756] * [-1095.435] (-1096.971) (-1095.750) (-1097.002) -- 0:01:02
      88000 -- [-1094.958] (-1098.115) (-1098.471) (-1095.915) * (-1098.172) (-1096.207) (-1097.766) [-1095.463] -- 0:01:02
      88500 -- (-1095.601) (-1096.290) (-1095.808) [-1096.615] * [-1098.681] (-1100.731) (-1096.752) (-1094.786) -- 0:01:01
      89000 -- (-1098.892) [-1097.414] (-1095.652) (-1095.243) * (-1100.666) (-1100.920) (-1099.258) [-1094.830] -- 0:01:01
      89500 -- [-1094.994] (-1098.188) (-1097.548) (-1099.623) * (-1096.120) (-1100.290) (-1095.316) [-1095.891] -- 0:01:01
      90000 -- [-1095.972] (-1097.489) (-1098.910) (-1095.128) * [-1095.162] (-1096.113) (-1096.403) (-1095.443) -- 0:01:00

      Average standard deviation of split frequencies: 0.025217

      90500 -- (-1095.301) [-1098.533] (-1099.863) (-1094.623) * (-1097.767) (-1099.542) [-1098.593] (-1098.307) -- 0:01:00
      91000 -- [-1096.408] (-1100.016) (-1097.764) (-1094.703) * (-1098.444) [-1095.596] (-1096.334) (-1097.615) -- 0:00:59
      91500 -- (-1098.592) (-1096.623) [-1097.187] (-1095.948) * (-1096.978) [-1095.910] (-1100.237) (-1095.398) -- 0:00:59
      92000 -- (-1098.058) (-1097.075) (-1096.855) [-1098.220] * [-1096.688] (-1095.914) (-1104.066) (-1095.447) -- 0:00:59
      92500 -- [-1097.881] (-1097.337) (-1097.128) (-1097.365) * [-1095.417] (-1096.854) (-1099.866) (-1098.875) -- 0:00:58
      93000 -- (-1096.476) [-1095.119] (-1101.332) (-1097.493) * (-1095.777) (-1094.763) [-1098.167] (-1097.893) -- 0:00:58
      93500 -- [-1096.441] (-1095.260) (-1102.302) (-1097.172) * (-1097.379) (-1095.762) [-1096.532] (-1097.879) -- 0:00:58
      94000 -- (-1097.364) (-1100.012) [-1096.120] (-1095.815) * (-1100.753) [-1095.306] (-1095.849) (-1102.600) -- 0:00:57
      94500 -- (-1101.596) (-1101.776) (-1099.136) [-1096.771] * (-1096.364) [-1095.457] (-1096.290) (-1099.225) -- 0:00:57
      95000 -- (-1100.877) (-1098.477) (-1097.003) [-1099.036] * (-1097.095) [-1098.319] (-1098.064) (-1096.694) -- 0:00:57

      Average standard deviation of split frequencies: 0.027654

      95500 -- (-1101.213) [-1099.450] (-1095.403) (-1096.965) * (-1096.841) (-1096.827) (-1096.530) [-1095.834] -- 0:00:56
      96000 -- (-1097.783) [-1096.933] (-1101.179) (-1097.989) * (-1096.049) (-1096.160) (-1099.003) [-1095.191] -- 0:00:56
      96500 -- (-1097.894) (-1097.361) (-1097.334) [-1098.148] * (-1096.284) (-1097.253) (-1096.416) [-1094.925] -- 0:00:56
      97000 -- (-1096.995) (-1100.477) (-1097.224) [-1098.466] * (-1096.063) [-1098.891] (-1095.478) (-1095.147) -- 0:00:55
      97500 -- [-1098.244] (-1096.636) (-1100.486) (-1096.462) * (-1096.769) [-1100.597] (-1096.582) (-1095.685) -- 0:00:55
      98000 -- (-1095.293) (-1094.957) (-1107.849) [-1095.287] * (-1097.486) (-1100.842) [-1094.864] (-1095.790) -- 0:00:55
      98500 -- (-1096.632) (-1097.949) (-1100.056) [-1095.110] * (-1098.634) (-1099.811) [-1096.050] (-1095.840) -- 0:00:54
      99000 -- (-1094.819) [-1095.529] (-1097.522) (-1095.791) * (-1103.382) (-1098.627) [-1095.737] (-1099.567) -- 0:00:54
      99500 -- (-1097.005) [-1096.557] (-1095.010) (-1097.105) * (-1095.734) (-1097.706) [-1098.382] (-1096.746) -- 0:00:54
      100000 -- [-1096.844] (-1096.093) (-1096.499) (-1095.526) * (-1095.799) (-1097.311) (-1097.579) [-1100.142] -- 0:01:02

      Average standard deviation of split frequencies: 0.028343

      100500 -- (-1096.122) (-1095.610) [-1099.167] (-1097.696) * (-1097.518) (-1101.163) (-1096.430) [-1095.115] -- 0:01:02
      101000 -- (-1099.242) [-1099.993] (-1095.172) (-1096.701) * [-1096.230] (-1098.478) (-1099.175) (-1094.799) -- 0:01:02
      101500 -- (-1096.217) [-1095.436] (-1100.963) (-1096.447) * (-1096.030) (-1097.145) (-1098.010) [-1095.147] -- 0:01:01
      102000 -- [-1096.474] (-1095.052) (-1100.196) (-1097.361) * (-1096.608) (-1097.805) [-1096.832] (-1097.179) -- 0:01:01
      102500 -- [-1096.040] (-1095.188) (-1102.727) (-1096.635) * (-1096.947) (-1096.890) [-1094.884] (-1097.164) -- 0:01:01
      103000 -- (-1096.132) (-1095.245) (-1098.264) [-1096.620] * [-1095.575] (-1095.404) (-1095.232) (-1096.863) -- 0:01:00
      103500 -- (-1097.802) [-1095.730] (-1098.742) (-1095.468) * (-1095.543) (-1096.344) [-1099.618] (-1099.102) -- 0:01:00
      104000 -- (-1097.012) (-1101.336) [-1097.189] (-1097.360) * (-1097.136) (-1097.457) (-1097.704) [-1097.582] -- 0:01:00
      104500 -- (-1097.770) [-1101.336] (-1095.394) (-1096.248) * (-1096.224) (-1096.721) (-1095.640) [-1097.108] -- 0:00:59
      105000 -- (-1097.653) (-1099.010) [-1095.634] (-1097.805) * [-1098.429] (-1098.945) (-1095.403) (-1094.764) -- 0:00:59

      Average standard deviation of split frequencies: 0.027742

      105500 -- (-1095.238) (-1100.117) (-1098.187) [-1097.202] * (-1097.657) (-1097.845) [-1094.633] (-1095.380) -- 0:00:59
      106000 -- (-1096.013) (-1097.739) (-1097.917) [-1096.127] * (-1101.409) (-1097.482) [-1094.932] (-1095.612) -- 0:00:59
      106500 -- (-1098.923) (-1098.424) (-1098.007) [-1096.280] * (-1101.385) (-1094.709) [-1095.452] (-1097.616) -- 0:00:58
      107000 -- [-1095.258] (-1098.242) (-1097.165) (-1098.044) * (-1099.254) (-1095.508) (-1096.030) [-1101.457] -- 0:00:58
      107500 -- [-1102.782] (-1100.302) (-1096.418) (-1101.784) * (-1097.048) (-1096.391) [-1095.016] (-1102.331) -- 0:00:58
      108000 -- (-1096.586) (-1099.727) [-1096.828] (-1100.653) * (-1097.411) (-1099.147) [-1095.301] (-1097.368) -- 0:00:57
      108500 -- [-1100.831] (-1100.008) (-1095.037) (-1096.299) * [-1096.669] (-1096.053) (-1095.343) (-1095.160) -- 0:00:57
      109000 -- (-1098.050) (-1098.323) (-1095.781) [-1095.111] * (-1095.396) (-1096.389) (-1095.032) [-1094.907] -- 0:00:57
      109500 -- (-1095.524) (-1096.669) [-1095.749] (-1096.700) * (-1097.948) [-1095.365] (-1095.303) (-1095.275) -- 0:00:56
      110000 -- [-1099.497] (-1096.996) (-1097.326) (-1097.580) * (-1095.027) (-1095.160) [-1096.872] (-1095.164) -- 0:00:56

      Average standard deviation of split frequencies: 0.027901

      110500 -- [-1101.018] (-1097.773) (-1095.957) (-1097.420) * [-1098.639] (-1096.799) (-1096.444) (-1095.265) -- 0:00:56
      111000 -- (-1100.453) (-1100.823) (-1095.424) [-1103.327] * (-1096.396) (-1095.766) [-1096.487] (-1095.114) -- 0:00:56
      111500 -- [-1098.629] (-1100.362) (-1096.353) (-1098.432) * [-1095.256] (-1097.173) (-1094.923) (-1095.114) -- 0:00:55
      112000 -- [-1096.394] (-1104.368) (-1095.074) (-1096.172) * [-1095.256] (-1095.420) (-1094.609) (-1099.131) -- 0:00:55
      112500 -- [-1096.659] (-1103.861) (-1096.783) (-1095.976) * (-1096.388) (-1096.798) [-1095.539] (-1095.635) -- 0:00:55
      113000 -- [-1100.064] (-1102.838) (-1097.587) (-1099.930) * (-1098.239) [-1097.448] (-1094.961) (-1097.450) -- 0:00:54
      113500 -- [-1099.521] (-1097.595) (-1095.704) (-1097.031) * (-1101.567) (-1101.083) [-1097.506] (-1097.158) -- 0:00:54
      114000 -- (-1098.350) [-1100.857] (-1099.093) (-1094.898) * (-1100.245) (-1099.279) [-1095.432] (-1096.792) -- 0:00:54
      114500 -- (-1097.081) (-1095.374) [-1096.606] (-1095.974) * (-1101.798) (-1097.589) [-1096.218] (-1097.960) -- 0:00:54
      115000 -- [-1098.667] (-1094.928) (-1098.076) (-1095.433) * (-1098.257) [-1097.225] (-1095.187) (-1096.852) -- 0:00:53

      Average standard deviation of split frequencies: 0.025805

      115500 -- [-1096.119] (-1098.026) (-1099.534) (-1095.352) * (-1095.036) [-1097.198] (-1098.142) (-1098.007) -- 0:00:53
      116000 -- [-1095.772] (-1096.431) (-1097.359) (-1094.702) * [-1097.850] (-1100.240) (-1098.139) (-1095.723) -- 0:01:00
      116500 -- (-1096.534) (-1095.864) (-1098.944) [-1099.967] * (-1095.960) (-1100.422) [-1097.843] (-1094.814) -- 0:01:00
      117000 -- (-1096.177) (-1096.585) [-1095.980] (-1098.483) * (-1096.607) (-1105.052) (-1097.607) [-1094.844] -- 0:01:00
      117500 -- (-1095.926) [-1095.749] (-1095.743) (-1096.265) * (-1096.342) (-1096.717) [-1098.896] (-1096.719) -- 0:01:00
      118000 -- (-1096.534) (-1096.200) [-1096.424] (-1097.533) * [-1095.928] (-1094.639) (-1098.851) (-1099.313) -- 0:00:59
      118500 -- [-1096.932] (-1098.387) (-1100.666) (-1096.034) * [-1094.592] (-1097.075) (-1096.576) (-1101.987) -- 0:00:59
      119000 -- (-1098.348) [-1097.185] (-1096.873) (-1095.002) * (-1094.999) (-1095.888) (-1097.857) [-1096.066] -- 0:00:59
      119500 -- (-1095.758) (-1097.707) [-1096.600] (-1096.488) * (-1094.981) [-1097.351] (-1099.453) (-1095.843) -- 0:00:58
      120000 -- (-1097.710) [-1099.732] (-1098.982) (-1097.707) * (-1095.902) (-1098.293) (-1101.280) [-1094.779] -- 0:00:58

      Average standard deviation of split frequencies: 0.026370

      120500 -- [-1097.834] (-1095.454) (-1096.676) (-1096.775) * (-1096.752) [-1095.797] (-1097.328) (-1103.600) -- 0:00:58
      121000 -- (-1095.318) (-1096.202) (-1098.490) [-1095.422] * (-1096.965) (-1099.198) [-1094.840] (-1095.806) -- 0:00:58
      121500 -- (-1096.119) [-1095.433] (-1097.372) (-1098.818) * (-1095.336) [-1097.146] (-1097.007) (-1096.901) -- 0:00:57
      122000 -- (-1096.997) (-1096.611) (-1096.629) [-1095.711] * (-1098.090) [-1095.506] (-1102.718) (-1095.987) -- 0:00:57
      122500 -- [-1099.059] (-1098.424) (-1095.576) (-1096.635) * [-1094.734] (-1094.836) (-1096.923) (-1097.167) -- 0:00:57
      123000 -- (-1101.879) (-1099.725) [-1096.578] (-1095.966) * (-1094.636) (-1096.226) [-1098.575] (-1097.671) -- 0:00:57
      123500 -- (-1097.532) [-1098.170] (-1095.421) (-1095.712) * (-1094.905) (-1097.821) [-1098.260] (-1094.877) -- 0:00:56
      124000 -- (-1097.070) (-1096.844) [-1096.577] (-1098.200) * [-1096.454] (-1102.979) (-1099.976) (-1094.784) -- 0:00:56
      124500 -- (-1098.555) [-1097.930] (-1098.125) (-1095.070) * (-1098.670) (-1097.379) (-1097.145) [-1096.070] -- 0:00:56
      125000 -- (-1096.318) (-1095.293) (-1098.248) [-1096.017] * [-1098.335] (-1097.641) (-1095.597) (-1097.016) -- 0:00:56

      Average standard deviation of split frequencies: 0.028995

      125500 -- (-1097.066) (-1094.963) [-1096.084] (-1097.447) * (-1098.386) (-1095.294) [-1095.780] (-1095.280) -- 0:00:55
      126000 -- (-1097.766) (-1095.306) [-1097.618] (-1095.726) * (-1096.534) [-1096.166] (-1096.632) (-1099.888) -- 0:00:55
      126500 -- [-1098.748] (-1096.306) (-1098.726) (-1095.654) * (-1095.441) (-1095.854) [-1096.271] (-1098.401) -- 0:00:55
      127000 -- (-1098.408) (-1096.826) (-1098.208) [-1096.574] * (-1095.318) [-1095.167] (-1096.787) (-1097.578) -- 0:00:54
      127500 -- (-1098.419) (-1100.921) [-1101.915] (-1099.352) * (-1094.635) (-1096.257) [-1099.654] (-1096.633) -- 0:00:54
      128000 -- (-1095.967) (-1095.622) (-1099.309) [-1097.218] * (-1096.336) [-1094.916] (-1096.551) (-1095.954) -- 0:00:54
      128500 -- (-1094.726) (-1095.810) (-1095.296) [-1097.122] * (-1096.495) (-1099.527) (-1096.888) [-1095.128] -- 0:00:54
      129000 -- [-1094.716] (-1097.817) (-1095.619) (-1097.009) * (-1094.741) (-1097.551) (-1097.140) [-1094.931] -- 0:00:54
      129500 -- (-1097.631) (-1097.528) [-1095.134] (-1096.108) * (-1097.627) (-1096.540) (-1096.158) [-1094.928] -- 0:00:53
      130000 -- (-1100.279) (-1095.705) [-1096.685] (-1097.226) * (-1096.448) [-1096.645] (-1098.605) (-1095.528) -- 0:00:53

      Average standard deviation of split frequencies: 0.027779

      130500 -- (-1098.037) (-1096.348) (-1096.856) [-1096.385] * (-1099.892) [-1095.979] (-1097.069) (-1096.139) -- 0:00:53
      131000 -- (-1096.748) [-1095.739] (-1095.725) (-1095.496) * (-1096.369) [-1095.975] (-1102.157) (-1097.440) -- 0:00:53
      131500 -- (-1096.263) [-1097.181] (-1101.054) (-1096.600) * (-1097.784) [-1096.428] (-1096.987) (-1098.628) -- 0:00:52
      132000 -- (-1096.263) (-1100.025) [-1096.400] (-1094.786) * [-1095.830] (-1096.154) (-1100.002) (-1097.199) -- 0:00:59
      132500 -- (-1097.696) (-1096.995) [-1098.684] (-1094.494) * (-1096.564) (-1095.802) (-1095.585) [-1098.294] -- 0:00:58
      133000 -- [-1095.984] (-1096.270) (-1095.630) (-1096.791) * (-1095.555) (-1095.959) [-1094.881] (-1096.538) -- 0:00:58
      133500 -- (-1094.814) (-1099.265) (-1095.707) [-1095.787] * (-1095.669) (-1098.428) (-1097.576) [-1096.095] -- 0:00:58
      134000 -- (-1098.238) [-1096.293] (-1095.035) (-1097.098) * (-1096.472) [-1094.909] (-1094.795) (-1095.526) -- 0:00:58
      134500 -- (-1098.386) (-1096.025) (-1096.695) [-1097.519] * (-1095.746) [-1097.057] (-1098.557) (-1097.655) -- 0:00:57
      135000 -- (-1102.873) (-1096.910) [-1095.807] (-1096.740) * [-1096.457] (-1097.334) (-1095.617) (-1100.519) -- 0:00:57

      Average standard deviation of split frequencies: 0.024456

      135500 -- (-1095.549) (-1096.200) [-1101.203] (-1095.922) * (-1094.710) (-1098.667) (-1095.056) [-1095.483] -- 0:00:57
      136000 -- (-1096.131) (-1096.104) [-1097.988] (-1095.827) * (-1095.186) [-1095.560] (-1095.605) (-1097.170) -- 0:00:57
      136500 -- (-1095.402) [-1095.903] (-1095.830) (-1096.563) * (-1095.275) (-1094.889) (-1095.475) [-1095.658] -- 0:00:56
      137000 -- (-1095.366) (-1095.147) [-1097.771] (-1096.583) * (-1098.970) (-1096.808) [-1096.789] (-1097.444) -- 0:00:56
      137500 -- (-1095.331) (-1095.238) [-1098.856] (-1095.214) * (-1099.086) [-1095.148] (-1100.145) (-1097.385) -- 0:00:56
      138000 -- (-1100.194) [-1095.614] (-1099.263) (-1094.830) * [-1100.413] (-1101.063) (-1097.518) (-1097.801) -- 0:00:56
      138500 -- (-1097.425) [-1094.708] (-1098.822) (-1097.983) * [-1102.721] (-1100.212) (-1097.399) (-1096.613) -- 0:00:55
      139000 -- (-1096.236) (-1097.456) [-1096.585] (-1098.916) * (-1096.615) (-1101.745) (-1097.249) [-1096.044] -- 0:00:55
      139500 -- (-1096.203) [-1096.267] (-1097.956) (-1097.679) * [-1098.174] (-1097.600) (-1100.325) (-1095.613) -- 0:00:55
      140000 -- [-1096.082] (-1097.667) (-1098.008) (-1097.086) * [-1100.610] (-1095.851) (-1099.913) (-1097.914) -- 0:00:55

      Average standard deviation of split frequencies: 0.021597

      140500 -- (-1096.780) (-1098.444) (-1096.507) [-1096.250] * (-1095.957) [-1095.699] (-1098.772) (-1097.720) -- 0:00:55
      141000 -- (-1095.924) (-1099.394) (-1096.866) [-1096.741] * (-1096.406) [-1096.468] (-1098.787) (-1094.897) -- 0:00:54
      141500 -- (-1095.771) (-1095.996) (-1094.857) [-1097.697] * (-1101.472) [-1096.834] (-1099.374) (-1095.396) -- 0:00:54
      142000 -- [-1096.176] (-1095.355) (-1095.095) (-1096.718) * (-1098.453) [-1096.634] (-1099.782) (-1096.274) -- 0:00:54
      142500 -- [-1096.415] (-1097.617) (-1095.102) (-1096.997) * (-1096.843) (-1098.527) [-1099.095] (-1100.291) -- 0:00:54
      143000 -- (-1097.572) (-1099.465) [-1096.414] (-1095.933) * [-1098.334] (-1096.239) (-1095.303) (-1096.479) -- 0:00:53
      143500 -- (-1100.408) (-1098.876) [-1096.924] (-1095.837) * (-1099.453) [-1094.992] (-1096.638) (-1094.574) -- 0:00:53
      144000 -- (-1097.833) [-1096.503] (-1097.860) (-1106.937) * [-1101.764] (-1095.253) (-1096.580) (-1094.804) -- 0:00:53
      144500 -- (-1102.283) (-1095.198) [-1099.195] (-1098.255) * (-1096.610) (-1094.752) (-1099.796) [-1095.668] -- 0:00:53
      145000 -- [-1097.918] (-1095.616) (-1099.587) (-1100.086) * (-1098.964) [-1095.972] (-1095.586) (-1097.795) -- 0:00:53

      Average standard deviation of split frequencies: 0.021149

      145500 -- (-1100.291) (-1097.729) (-1099.154) [-1101.094] * [-1095.334] (-1095.645) (-1095.758) (-1097.822) -- 0:00:52
      146000 -- (-1097.167) [-1095.891] (-1096.671) (-1099.080) * (-1097.426) (-1097.221) [-1096.303] (-1098.284) -- 0:00:52
      146500 -- [-1100.349] (-1098.174) (-1096.923) (-1099.256) * (-1096.020) [-1095.801] (-1096.187) (-1097.500) -- 0:00:52
      147000 -- (-1100.835) (-1097.487) [-1097.302] (-1095.468) * [-1098.786] (-1095.634) (-1095.604) (-1097.729) -- 0:00:52
      147500 -- (-1096.441) [-1095.517] (-1098.499) (-1094.745) * (-1100.899) (-1095.502) [-1095.235] (-1095.117) -- 0:00:52
      148000 -- (-1097.902) [-1094.861] (-1099.828) (-1095.339) * (-1101.725) (-1097.012) [-1097.396] (-1096.266) -- 0:00:51
      148500 -- [-1095.690] (-1104.328) (-1099.127) (-1099.593) * [-1097.194] (-1098.572) (-1100.733) (-1095.736) -- 0:00:57
      149000 -- [-1095.745] (-1097.808) (-1099.614) (-1095.801) * [-1096.724] (-1099.070) (-1098.826) (-1095.124) -- 0:00:57
      149500 -- (-1097.164) (-1094.748) [-1096.300] (-1095.469) * [-1094.674] (-1097.365) (-1098.364) (-1094.867) -- 0:00:56
      150000 -- [-1097.770] (-1099.080) (-1096.163) (-1098.618) * (-1095.972) [-1095.855] (-1096.616) (-1098.418) -- 0:00:56

      Average standard deviation of split frequencies: 0.021589

      150500 -- (-1096.647) (-1099.080) (-1094.830) [-1096.606] * [-1097.609] (-1096.630) (-1095.918) (-1098.534) -- 0:00:56
      151000 -- (-1097.082) (-1101.268) [-1095.105] (-1096.215) * [-1096.281] (-1098.001) (-1095.649) (-1097.163) -- 0:00:56
      151500 -- (-1100.688) (-1099.753) [-1095.247] (-1096.108) * (-1098.324) [-1095.024] (-1097.300) (-1099.990) -- 0:00:56
      152000 -- [-1100.162] (-1096.849) (-1096.104) (-1099.994) * (-1095.802) [-1099.141] (-1098.900) (-1095.297) -- 0:00:55
      152500 -- (-1097.175) [-1097.751] (-1095.276) (-1100.566) * (-1098.326) (-1096.188) (-1097.635) [-1095.376] -- 0:00:55
      153000 -- (-1096.608) (-1099.858) [-1095.810] (-1100.187) * (-1094.845) (-1097.795) [-1096.055] (-1096.291) -- 0:00:55
      153500 -- (-1097.744) [-1098.604] (-1095.695) (-1100.325) * [-1096.425] (-1096.924) (-1097.881) (-1095.954) -- 0:00:55
      154000 -- (-1098.137) [-1098.544] (-1094.953) (-1097.219) * [-1098.136] (-1095.751) (-1101.891) (-1095.877) -- 0:00:54
      154500 -- (-1095.640) (-1096.414) (-1096.039) [-1097.901] * (-1096.379) (-1099.491) (-1098.709) [-1095.762] -- 0:00:54
      155000 -- (-1095.741) [-1096.098] (-1096.923) (-1097.306) * (-1098.522) [-1095.613] (-1098.178) (-1098.981) -- 0:00:54

      Average standard deviation of split frequencies: 0.023379

      155500 -- [-1094.633] (-1096.009) (-1097.470) (-1095.294) * [-1099.867] (-1095.887) (-1097.886) (-1096.973) -- 0:00:54
      156000 -- (-1096.640) (-1097.836) (-1097.514) [-1096.315] * (-1096.825) (-1098.466) (-1100.945) [-1097.252] -- 0:00:54
      156500 -- [-1095.252] (-1097.719) (-1098.282) (-1097.024) * (-1096.559) (-1098.557) (-1096.643) [-1098.145] -- 0:00:53
      157000 -- (-1098.516) [-1098.729] (-1097.503) (-1101.141) * (-1097.871) (-1096.930) (-1096.650) [-1098.862] -- 0:00:53
      157500 -- [-1096.885] (-1097.604) (-1098.935) (-1097.180) * (-1097.946) (-1096.355) (-1097.367) [-1097.750] -- 0:00:53
      158000 -- [-1096.881] (-1096.358) (-1095.298) (-1097.286) * (-1098.017) (-1095.634) (-1098.067) [-1098.277] -- 0:00:53
      158500 -- (-1097.170) [-1096.174] (-1098.177) (-1097.379) * (-1099.164) [-1095.696] (-1097.021) (-1097.723) -- 0:00:53
      159000 -- [-1098.581] (-1096.592) (-1096.251) (-1097.687) * (-1102.664) (-1095.115) (-1097.862) [-1097.384] -- 0:00:52
      159500 -- (-1099.948) [-1098.278] (-1099.329) (-1099.713) * (-1098.860) [-1098.837] (-1095.412) (-1100.418) -- 0:00:52
      160000 -- (-1097.947) (-1097.076) (-1097.792) [-1098.079] * (-1098.350) [-1096.842] (-1100.761) (-1098.582) -- 0:00:52

      Average standard deviation of split frequencies: 0.024708

      160500 -- (-1095.431) [-1095.528] (-1097.836) (-1099.926) * (-1096.119) [-1096.362] (-1098.675) (-1095.525) -- 0:00:52
      161000 -- (-1096.049) (-1097.438) (-1096.598) [-1098.611] * (-1096.246) (-1096.489) [-1099.382] (-1095.223) -- 0:00:52
      161500 -- (-1095.297) [-1097.714] (-1097.596) (-1097.873) * (-1096.599) (-1096.911) (-1097.966) [-1095.381] -- 0:00:51
      162000 -- [-1095.111] (-1098.735) (-1095.469) (-1097.702) * [-1100.306] (-1098.329) (-1096.142) (-1095.368) -- 0:00:51
      162500 -- (-1094.847) (-1095.254) (-1099.260) [-1096.374] * [-1097.854] (-1094.910) (-1097.151) (-1096.432) -- 0:00:51
      163000 -- (-1095.194) [-1094.956] (-1099.631) (-1106.252) * (-1098.265) (-1095.194) [-1095.605] (-1096.501) -- 0:00:56
      163500 -- (-1097.301) (-1096.038) [-1095.487] (-1098.450) * (-1100.318) [-1094.915] (-1095.497) (-1095.229) -- 0:00:56
      164000 -- (-1100.240) [-1098.241] (-1095.973) (-1098.514) * (-1099.134) (-1095.431) (-1095.237) [-1099.418] -- 0:00:56
      164500 -- (-1097.307) [-1097.217] (-1096.161) (-1097.737) * (-1097.097) (-1096.520) [-1096.505] (-1098.786) -- 0:00:55
      165000 -- (-1097.189) (-1095.426) (-1096.191) [-1098.687] * (-1096.405) (-1095.547) (-1096.755) [-1095.633] -- 0:00:55

      Average standard deviation of split frequencies: 0.022860

      165500 -- (-1096.412) [-1095.056] (-1096.652) (-1098.860) * (-1097.025) (-1094.778) (-1101.817) [-1097.397] -- 0:00:55
      166000 -- [-1095.222] (-1096.605) (-1098.857) (-1097.086) * (-1096.320) (-1095.338) (-1097.331) [-1096.518] -- 0:00:55
      166500 -- [-1094.842] (-1094.890) (-1099.737) (-1095.478) * (-1097.546) (-1095.401) (-1096.690) [-1095.971] -- 0:00:55
      167000 -- (-1095.068) (-1096.050) [-1098.263] (-1095.818) * (-1095.465) (-1099.963) [-1095.484] (-1095.317) -- 0:00:54
      167500 -- (-1095.555) [-1094.858] (-1099.111) (-1097.812) * (-1098.706) (-1098.117) [-1096.057] (-1097.142) -- 0:00:54
      168000 -- (-1096.148) (-1095.515) [-1095.763] (-1099.801) * [-1099.155] (-1100.471) (-1097.144) (-1099.015) -- 0:00:54
      168500 -- [-1096.551] (-1095.070) (-1097.348) (-1099.288) * (-1096.164) (-1097.395) (-1097.211) [-1096.636] -- 0:00:54
      169000 -- [-1101.991] (-1098.927) (-1099.083) (-1095.988) * (-1096.245) (-1100.013) [-1096.042] (-1096.372) -- 0:00:54
      169500 -- (-1099.887) (-1097.615) (-1098.147) [-1096.825] * [-1095.610] (-1096.537) (-1099.676) (-1096.659) -- 0:00:53
      170000 -- (-1096.955) [-1096.025] (-1094.924) (-1096.088) * (-1096.029) (-1097.195) [-1095.286] (-1096.664) -- 0:00:53

      Average standard deviation of split frequencies: 0.025550

      170500 -- (-1096.767) (-1096.194) (-1097.445) [-1094.942] * (-1098.909) (-1104.614) (-1098.778) [-1101.295] -- 0:00:53
      171000 -- (-1094.809) [-1096.406] (-1097.951) (-1094.878) * [-1098.005] (-1098.541) (-1101.160) (-1096.735) -- 0:00:53
      171500 -- (-1096.363) (-1096.695) (-1096.327) [-1096.142] * (-1098.828) (-1095.776) [-1098.566] (-1095.069) -- 0:00:53
      172000 -- (-1097.376) (-1097.263) (-1097.888) [-1097.917] * (-1097.048) (-1099.545) [-1098.419] (-1094.997) -- 0:00:52
      172500 -- [-1098.008] (-1098.740) (-1099.394) (-1096.598) * (-1095.556) (-1099.392) [-1098.172] (-1097.467) -- 0:00:52
      173000 -- (-1098.584) (-1099.370) (-1095.946) [-1096.848] * (-1098.886) [-1096.656] (-1095.933) (-1094.857) -- 0:00:52
      173500 -- (-1099.274) [-1096.376] (-1097.753) (-1096.868) * [-1095.570] (-1096.588) (-1095.738) (-1095.894) -- 0:00:52
      174000 -- (-1099.467) (-1094.518) [-1095.228] (-1096.319) * (-1096.888) (-1095.134) [-1096.118] (-1096.045) -- 0:00:52
      174500 -- (-1098.749) (-1095.811) (-1096.085) [-1095.080] * (-1095.595) (-1095.573) [-1095.990] (-1098.312) -- 0:00:52
      175000 -- (-1097.722) [-1095.610] (-1097.936) (-1096.284) * (-1098.656) [-1096.340] (-1097.449) (-1096.767) -- 0:00:51

      Average standard deviation of split frequencies: 0.024529

      175500 -- [-1096.707] (-1097.337) (-1103.455) (-1094.991) * (-1095.265) [-1095.100] (-1095.683) (-1096.459) -- 0:00:51
      176000 -- (-1098.010) (-1096.849) [-1095.655] (-1099.171) * (-1097.002) [-1094.460] (-1095.569) (-1095.885) -- 0:00:51
      176500 -- (-1098.323) (-1097.927) (-1095.191) [-1097.452] * [-1098.045] (-1098.462) (-1095.090) (-1096.510) -- 0:00:51
      177000 -- (-1096.780) (-1102.349) [-1095.300] (-1102.173) * (-1098.074) [-1097.715] (-1097.030) (-1095.184) -- 0:00:51
      177500 -- (-1097.586) (-1097.250) [-1096.296] (-1099.596) * [-1096.020] (-1095.372) (-1095.525) (-1099.365) -- 0:00:50
      178000 -- (-1097.173) (-1094.829) [-1096.832] (-1104.590) * (-1097.077) (-1095.217) (-1095.217) [-1096.814] -- 0:00:55
      178500 -- [-1096.528] (-1095.797) (-1096.913) (-1100.676) * (-1098.427) (-1095.686) (-1095.731) [-1096.059] -- 0:00:55
      179000 -- [-1096.143] (-1099.624) (-1095.838) (-1096.040) * (-1094.886) (-1100.092) [-1096.135] (-1095.478) -- 0:00:55
      179500 -- (-1096.283) [-1097.697] (-1095.522) (-1095.607) * (-1094.793) (-1096.367) [-1098.019] (-1096.782) -- 0:00:54
      180000 -- (-1097.362) [-1099.448] (-1097.602) (-1096.247) * (-1094.658) (-1096.340) [-1095.584] (-1098.305) -- 0:00:54

      Average standard deviation of split frequencies: 0.023483

      180500 -- (-1099.177) (-1099.010) [-1097.165] (-1094.965) * (-1095.289) [-1095.698] (-1096.189) (-1097.076) -- 0:00:54
      181000 -- [-1097.289] (-1099.525) (-1095.522) (-1095.720) * (-1096.908) (-1096.869) [-1094.867] (-1097.172) -- 0:00:54
      181500 -- (-1097.379) [-1095.266] (-1098.711) (-1097.127) * (-1095.282) (-1097.125) [-1096.724] (-1097.269) -- 0:00:54
      182000 -- [-1098.475] (-1095.681) (-1096.450) (-1100.420) * (-1100.858) (-1098.663) [-1094.499] (-1097.034) -- 0:00:53
      182500 -- (-1099.032) [-1095.057] (-1097.458) (-1095.279) * (-1096.960) [-1096.011] (-1096.511) (-1095.814) -- 0:00:53
      183000 -- (-1096.754) [-1096.910] (-1097.280) (-1096.469) * [-1096.020] (-1101.180) (-1096.987) (-1095.736) -- 0:00:53
      183500 -- (-1095.451) (-1101.172) [-1096.968] (-1097.195) * (-1100.921) [-1097.565] (-1096.191) (-1095.173) -- 0:00:53
      184000 -- [-1095.275] (-1097.161) (-1099.991) (-1097.438) * (-1101.055) [-1095.034] (-1098.295) (-1094.928) -- 0:00:53
      184500 -- [-1098.200] (-1097.489) (-1095.670) (-1098.529) * (-1099.258) [-1095.688] (-1094.622) (-1095.454) -- 0:00:53
      185000 -- [-1096.339] (-1096.479) (-1097.259) (-1101.426) * (-1096.858) (-1099.793) (-1097.845) [-1097.313] -- 0:00:52

      Average standard deviation of split frequencies: 0.021289

      185500 -- [-1096.025] (-1100.401) (-1096.340) (-1095.978) * (-1100.273) [-1098.002] (-1096.821) (-1099.428) -- 0:00:52
      186000 -- [-1096.056] (-1097.797) (-1098.734) (-1094.803) * (-1095.800) (-1096.625) [-1097.605] (-1097.223) -- 0:00:52
      186500 -- [-1095.008] (-1095.963) (-1097.905) (-1096.260) * (-1094.439) (-1101.222) (-1097.310) [-1096.563] -- 0:00:52
      187000 -- (-1096.386) [-1096.485] (-1095.875) (-1095.524) * (-1094.573) [-1097.517] (-1098.429) (-1095.600) -- 0:00:52
      187500 -- (-1096.094) [-1098.260] (-1096.668) (-1095.490) * (-1095.210) (-1097.170) [-1096.888] (-1103.357) -- 0:00:52
      188000 -- [-1096.890] (-1096.104) (-1095.910) (-1095.492) * (-1096.849) (-1098.005) [-1096.889] (-1098.369) -- 0:00:51
      188500 -- (-1095.854) [-1097.722] (-1095.763) (-1097.391) * (-1097.087) (-1101.245) (-1098.237) [-1097.834] -- 0:00:51
      189000 -- [-1095.942] (-1098.062) (-1096.955) (-1097.640) * (-1096.852) (-1098.346) (-1098.430) [-1097.217] -- 0:00:51
      189500 -- [-1095.858] (-1099.242) (-1095.449) (-1096.713) * (-1096.096) [-1097.573] (-1098.362) (-1097.418) -- 0:00:51
      190000 -- (-1096.344) (-1097.241) (-1095.404) [-1096.265] * [-1097.639] (-1097.123) (-1099.631) (-1100.084) -- 0:00:51

      Average standard deviation of split frequencies: 0.021139

      190500 -- (-1097.839) [-1095.629] (-1095.835) (-1096.918) * (-1097.637) (-1095.581) (-1097.127) [-1100.001] -- 0:00:50
      191000 -- [-1096.532] (-1097.958) (-1094.933) (-1097.539) * (-1097.455) (-1094.846) [-1094.818] (-1096.947) -- 0:00:50
      191500 -- (-1095.514) (-1097.066) (-1095.131) [-1097.282] * (-1095.089) [-1096.590] (-1094.636) (-1099.650) -- 0:00:50
      192000 -- (-1097.182) (-1095.496) (-1096.837) [-1096.773] * [-1095.916] (-1095.252) (-1096.364) (-1099.853) -- 0:00:50
      192500 -- [-1095.929] (-1098.614) (-1095.425) (-1098.402) * (-1094.801) (-1097.713) [-1096.401] (-1103.660) -- 0:00:50
      193000 -- (-1095.803) (-1097.264) [-1097.248] (-1100.483) * [-1094.809] (-1095.520) (-1096.543) (-1098.666) -- 0:00:54
      193500 -- (-1096.487) (-1097.913) (-1095.296) [-1097.797] * (-1095.560) [-1097.256] (-1097.323) (-1098.399) -- 0:00:54
      194000 -- (-1097.209) [-1094.885] (-1096.407) (-1097.331) * (-1098.852) [-1099.161] (-1094.980) (-1101.346) -- 0:00:54
      194500 -- (-1098.370) (-1097.792) [-1097.715] (-1097.332) * (-1101.417) [-1097.028] (-1096.207) (-1099.895) -- 0:00:53
      195000 -- (-1103.373) (-1094.904) [-1097.617] (-1096.098) * (-1096.317) (-1095.483) (-1096.888) [-1099.893] -- 0:00:53

      Average standard deviation of split frequencies: 0.021646

      195500 -- (-1103.172) (-1095.505) (-1100.800) [-1098.282] * (-1104.865) [-1096.744] (-1096.309) (-1098.892) -- 0:00:53
      196000 -- [-1100.604] (-1097.350) (-1097.838) (-1103.161) * (-1099.117) [-1095.446] (-1096.125) (-1097.962) -- 0:00:53
      196500 -- (-1102.821) [-1101.882] (-1098.160) (-1096.671) * [-1095.677] (-1095.591) (-1099.419) (-1098.596) -- 0:00:53
      197000 -- [-1096.802] (-1098.750) (-1099.176) (-1096.312) * (-1096.089) [-1096.710] (-1096.611) (-1097.921) -- 0:00:52
      197500 -- [-1097.047] (-1097.076) (-1099.178) (-1096.127) * [-1098.586] (-1097.236) (-1102.112) (-1095.396) -- 0:00:52
      198000 -- (-1099.607) (-1097.403) [-1098.234] (-1099.075) * (-1100.424) [-1099.042] (-1100.526) (-1095.770) -- 0:00:52
      198500 -- (-1095.104) [-1098.773] (-1100.808) (-1095.211) * (-1096.531) [-1095.582] (-1098.462) (-1095.930) -- 0:00:52
      199000 -- [-1095.237] (-1096.601) (-1097.955) (-1095.525) * (-1096.779) (-1094.871) (-1096.887) [-1095.828] -- 0:00:52
      199500 -- (-1095.423) [-1096.099] (-1102.579) (-1096.904) * (-1095.993) [-1096.025] (-1098.110) (-1096.201) -- 0:00:52
      200000 -- (-1099.452) [-1096.793] (-1096.507) (-1096.511) * (-1098.114) (-1096.488) (-1097.195) [-1095.989] -- 0:00:51

      Average standard deviation of split frequencies: 0.020621

      200500 -- (-1099.146) (-1099.195) [-1098.047] (-1098.439) * (-1097.208) (-1096.221) (-1097.125) [-1094.926] -- 0:00:51
      201000 -- (-1098.644) [-1098.282] (-1098.094) (-1096.546) * (-1096.543) (-1095.709) (-1096.027) [-1098.706] -- 0:00:51
      201500 -- (-1095.116) (-1096.428) (-1097.971) [-1097.409] * (-1094.896) (-1094.758) [-1096.996] (-1097.617) -- 0:00:51
      202000 -- (-1095.666) (-1096.633) (-1098.208) [-1095.409] * [-1094.939] (-1096.041) (-1099.913) (-1101.423) -- 0:00:51
      202500 -- [-1098.356] (-1095.244) (-1094.853) (-1097.037) * [-1094.428] (-1096.604) (-1096.718) (-1097.114) -- 0:00:51
      203000 -- (-1096.875) (-1095.409) (-1097.957) [-1096.158] * (-1098.000) (-1097.713) [-1095.389] (-1096.207) -- 0:00:51
      203500 -- (-1101.271) (-1095.684) (-1097.948) [-1094.954] * (-1099.880) [-1096.529] (-1094.720) (-1095.970) -- 0:00:50
      204000 -- (-1099.712) (-1098.161) (-1095.186) [-1094.506] * [-1101.031] (-1097.629) (-1098.644) (-1097.059) -- 0:00:50
      204500 -- (-1098.490) (-1100.257) (-1100.885) [-1096.930] * (-1098.121) (-1096.662) [-1100.352] (-1097.267) -- 0:00:50
      205000 -- [-1098.155] (-1094.801) (-1094.624) (-1097.900) * [-1099.067] (-1096.850) (-1097.392) (-1096.232) -- 0:00:50

      Average standard deviation of split frequencies: 0.017926

      205500 -- (-1098.975) [-1095.841] (-1094.644) (-1096.184) * (-1095.572) [-1095.161] (-1097.968) (-1099.799) -- 0:00:50
      206000 -- (-1099.561) (-1096.747) (-1096.123) [-1096.524] * (-1094.477) [-1096.743] (-1097.663) (-1096.860) -- 0:00:50
      206500 -- (-1097.610) (-1098.511) (-1095.733) [-1096.616] * (-1096.362) [-1096.230] (-1099.878) (-1097.331) -- 0:00:49
      207000 -- (-1098.077) (-1098.472) [-1098.097] (-1095.989) * (-1096.608) (-1099.452) [-1100.487] (-1097.179) -- 0:00:49
      207500 -- (-1096.118) [-1096.964] (-1097.335) (-1097.534) * (-1098.551) (-1096.634) [-1096.418] (-1097.838) -- 0:00:49
      208000 -- (-1100.126) (-1095.513) [-1095.248] (-1097.697) * (-1097.684) [-1095.638] (-1100.658) (-1098.470) -- 0:00:53
      208500 -- (-1097.085) [-1095.671] (-1096.160) (-1096.347) * (-1098.229) (-1097.538) [-1098.328] (-1100.182) -- 0:00:53
      209000 -- [-1095.123] (-1096.742) (-1095.559) (-1097.010) * (-1098.235) [-1098.779] (-1099.811) (-1095.849) -- 0:00:52
      209500 -- (-1095.110) (-1095.909) (-1096.481) [-1096.605] * [-1097.287] (-1100.533) (-1098.522) (-1095.848) -- 0:00:52
      210000 -- (-1098.877) (-1095.537) (-1097.011) [-1098.029] * [-1095.516] (-1098.140) (-1096.404) (-1096.145) -- 0:00:52

      Average standard deviation of split frequencies: 0.016223

      210500 -- (-1095.421) (-1096.911) (-1100.377) [-1095.874] * [-1094.913] (-1095.452) (-1097.382) (-1095.839) -- 0:00:52
      211000 -- (-1097.897) [-1096.467] (-1097.255) (-1095.657) * (-1095.320) [-1095.690] (-1097.144) (-1096.193) -- 0:00:52
      211500 -- (-1095.299) [-1097.819] (-1096.433) (-1094.848) * [-1098.506] (-1095.411) (-1096.987) (-1095.017) -- 0:00:52
      212000 -- (-1095.452) (-1096.158) (-1096.407) [-1099.901] * (-1096.999) (-1098.516) [-1095.275] (-1095.743) -- 0:00:52
      212500 -- [-1096.269] (-1099.867) (-1095.565) (-1095.080) * (-1095.558) (-1098.079) [-1095.550] (-1095.835) -- 0:00:51
      213000 -- (-1097.295) [-1094.943] (-1099.771) (-1095.286) * (-1103.909) (-1098.229) [-1096.819] (-1095.600) -- 0:00:51
      213500 -- [-1096.813] (-1095.877) (-1097.378) (-1099.031) * (-1097.469) (-1095.072) (-1098.591) [-1095.809] -- 0:00:51
      214000 -- (-1097.355) [-1095.816] (-1097.938) (-1101.387) * (-1098.079) (-1095.326) [-1098.184] (-1098.493) -- 0:00:51
      214500 -- (-1096.660) (-1098.216) (-1098.377) [-1100.182] * (-1103.051) (-1096.576) [-1096.916] (-1097.259) -- 0:00:51
      215000 -- (-1096.405) (-1095.091) [-1095.352] (-1097.411) * (-1100.165) (-1096.522) [-1098.808] (-1095.789) -- 0:00:51

      Average standard deviation of split frequencies: 0.018263

      215500 -- (-1098.852) [-1095.949] (-1098.128) (-1096.610) * (-1100.994) (-1101.201) (-1101.105) [-1096.626] -- 0:00:50
      216000 -- (-1098.464) (-1100.208) (-1097.856) [-1096.145] * (-1095.804) (-1095.378) (-1101.041) [-1095.814] -- 0:00:50
      216500 -- (-1100.658) (-1096.165) [-1096.624] (-1099.979) * (-1095.315) [-1095.117] (-1098.309) (-1097.372) -- 0:00:50
      217000 -- (-1096.717) (-1096.301) [-1096.308] (-1097.842) * (-1097.719) [-1094.482] (-1099.128) (-1096.066) -- 0:00:50
      217500 -- (-1094.804) (-1095.957) [-1096.674] (-1097.933) * [-1095.899] (-1098.213) (-1099.344) (-1101.816) -- 0:00:50
      218000 -- (-1095.457) (-1097.865) (-1098.077) [-1096.266] * (-1096.498) [-1095.350] (-1095.815) (-1095.790) -- 0:00:50
      218500 -- (-1097.026) [-1097.971] (-1096.968) (-1095.806) * (-1095.799) [-1098.782] (-1101.322) (-1095.499) -- 0:00:50
      219000 -- [-1095.189] (-1095.050) (-1095.735) (-1094.948) * (-1095.351) (-1105.659) (-1097.992) [-1095.952] -- 0:00:49
      219500 -- (-1095.600) (-1095.475) [-1094.607] (-1096.936) * (-1095.842) [-1098.187] (-1097.748) (-1095.972) -- 0:00:49
      220000 -- [-1096.070] (-1098.131) (-1097.628) (-1100.031) * (-1095.591) (-1095.569) [-1096.622] (-1095.213) -- 0:00:49

      Average standard deviation of split frequencies: 0.018664

      220500 -- (-1098.852) [-1097.534] (-1098.322) (-1096.176) * (-1103.193) [-1095.165] (-1095.370) (-1094.823) -- 0:00:49
      221000 -- (-1098.709) [-1098.045] (-1097.716) (-1099.014) * [-1096.198] (-1097.076) (-1095.446) (-1094.898) -- 0:00:49
      221500 -- [-1097.361] (-1097.156) (-1099.314) (-1096.091) * (-1097.395) (-1096.971) (-1097.011) [-1095.488] -- 0:00:49
      222000 -- (-1095.318) (-1096.484) [-1100.277] (-1095.631) * [-1096.987] (-1096.583) (-1096.047) (-1097.558) -- 0:00:49
      222500 -- (-1095.001) [-1096.394] (-1098.643) (-1095.133) * [-1096.417] (-1095.934) (-1096.085) (-1097.760) -- 0:00:48
      223000 -- (-1097.270) [-1097.028] (-1096.931) (-1095.695) * (-1097.716) [-1096.178] (-1096.096) (-1098.260) -- 0:00:52
      223500 -- (-1098.203) (-1098.052) (-1096.890) [-1097.740] * (-1100.560) [-1095.968] (-1098.767) (-1098.168) -- 0:00:52
      224000 -- (-1097.585) [-1096.725] (-1096.840) (-1097.573) * (-1102.496) (-1099.144) [-1098.521] (-1099.791) -- 0:00:51
      224500 -- (-1096.489) (-1098.638) (-1095.842) [-1098.352] * (-1096.314) [-1096.615] (-1097.854) (-1098.230) -- 0:00:51
      225000 -- [-1097.746] (-1099.396) (-1097.902) (-1097.042) * (-1094.733) (-1099.599) [-1098.435] (-1098.645) -- 0:00:51

      Average standard deviation of split frequencies: 0.018004

      225500 -- [-1098.347] (-1098.855) (-1098.507) (-1096.547) * (-1097.145) (-1098.391) (-1097.244) [-1096.937] -- 0:00:51
      226000 -- (-1100.068) (-1094.864) (-1096.570) [-1098.789] * [-1095.591] (-1097.064) (-1097.442) (-1096.732) -- 0:00:51
      226500 -- [-1096.127] (-1097.449) (-1098.106) (-1097.640) * (-1096.270) (-1097.004) (-1097.293) [-1097.244] -- 0:00:51
      227000 -- (-1096.091) [-1095.558] (-1094.735) (-1095.335) * [-1094.909] (-1096.388) (-1096.318) (-1096.327) -- 0:00:51
      227500 -- (-1097.590) (-1095.558) [-1095.615] (-1098.162) * (-1096.194) [-1097.448] (-1095.507) (-1095.992) -- 0:00:50
      228000 -- (-1095.297) (-1095.061) [-1094.991] (-1095.186) * [-1098.541] (-1100.769) (-1097.777) (-1095.449) -- 0:00:50
      228500 -- [-1097.726] (-1096.122) (-1097.124) (-1096.382) * (-1097.044) (-1096.386) (-1095.943) [-1096.863] -- 0:00:50
      229000 -- (-1095.099) (-1100.086) (-1097.620) [-1095.429] * (-1096.397) (-1095.864) (-1094.982) [-1097.323] -- 0:00:50
      229500 -- (-1096.437) (-1095.196) (-1094.607) [-1095.639] * (-1097.909) (-1095.258) [-1095.038] (-1095.532) -- 0:00:50
      230000 -- (-1097.979) (-1096.468) [-1095.236] (-1094.667) * (-1100.164) (-1095.235) [-1096.063] (-1096.461) -- 0:00:50

      Average standard deviation of split frequencies: 0.018506

      230500 -- (-1097.798) (-1096.012) (-1097.084) [-1095.389] * (-1096.033) (-1098.132) [-1099.004] (-1096.588) -- 0:00:50
      231000 -- (-1096.911) [-1095.919] (-1099.976) (-1096.381) * [-1097.074] (-1096.725) (-1098.402) (-1101.638) -- 0:00:49
      231500 -- (-1096.943) [-1095.489] (-1095.810) (-1095.248) * (-1095.897) (-1097.567) (-1096.656) [-1097.814] -- 0:00:49
      232000 -- (-1097.491) [-1095.506] (-1094.931) (-1095.750) * (-1095.948) (-1096.769) (-1097.452) [-1099.071] -- 0:00:49
      232500 -- (-1098.619) (-1103.215) (-1098.618) [-1095.543] * (-1096.369) (-1097.153) (-1097.252) [-1098.296] -- 0:00:49
      233000 -- (-1102.626) (-1106.585) [-1100.914] (-1096.784) * [-1099.652] (-1099.165) (-1095.579) (-1096.025) -- 0:00:49
      233500 -- [-1096.270] (-1102.773) (-1097.006) (-1096.960) * (-1100.248) (-1096.514) (-1096.009) [-1095.308] -- 0:00:49
      234000 -- (-1095.625) (-1096.691) (-1095.448) [-1095.797] * (-1097.019) (-1095.791) [-1095.888] (-1095.600) -- 0:00:49
      234500 -- [-1098.433] (-1097.283) (-1098.093) (-1095.683) * (-1095.862) (-1096.715) [-1096.434] (-1095.528) -- 0:00:48
      235000 -- (-1094.979) (-1096.524) [-1095.997] (-1098.161) * (-1096.232) [-1099.685] (-1094.723) (-1096.204) -- 0:00:48

      Average standard deviation of split frequencies: 0.017200

      235500 -- (-1094.942) (-1094.733) (-1095.890) [-1095.669] * (-1096.812) (-1099.657) [-1095.169] (-1095.249) -- 0:00:48
      236000 -- (-1098.521) (-1094.599) [-1097.685] (-1096.119) * (-1095.416) (-1100.183) [-1096.083] (-1094.709) -- 0:00:48
      236500 -- (-1101.199) [-1095.534] (-1095.241) (-1095.885) * (-1100.485) [-1097.656] (-1095.893) (-1094.831) -- 0:00:48
      237000 -- [-1097.234] (-1096.139) (-1095.139) (-1098.638) * (-1098.501) (-1099.121) (-1094.980) [-1098.982] -- 0:00:48
      237500 -- (-1098.277) (-1096.930) [-1095.790] (-1099.483) * (-1097.183) (-1096.023) [-1095.079] (-1096.296) -- 0:00:48
      238000 -- (-1096.688) (-1096.968) (-1095.055) [-1095.189] * (-1097.319) [-1097.222] (-1099.874) (-1098.665) -- 0:00:48
      238500 -- (-1097.423) [-1098.322] (-1095.404) (-1095.228) * (-1100.202) (-1095.872) [-1098.377] (-1095.977) -- 0:00:47
      239000 -- (-1096.128) (-1100.270) [-1096.305] (-1096.631) * (-1098.771) [-1095.905] (-1096.556) (-1096.963) -- 0:00:50
      239500 -- (-1099.108) [-1095.158] (-1095.762) (-1096.466) * (-1098.533) [-1095.650] (-1096.590) (-1097.937) -- 0:00:50
      240000 -- [-1095.171] (-1097.991) (-1095.702) (-1096.560) * (-1096.890) [-1096.553] (-1095.906) (-1103.308) -- 0:00:50

      Average standard deviation of split frequencies: 0.017398

      240500 -- (-1096.530) (-1098.354) (-1096.669) [-1096.994] * (-1098.795) (-1096.173) (-1097.737) [-1096.624] -- 0:00:50
      241000 -- [-1096.698] (-1098.381) (-1098.826) (-1097.009) * (-1096.050) [-1096.925] (-1099.578) (-1098.971) -- 0:00:50
      241500 -- (-1095.582) [-1096.029] (-1096.748) (-1098.271) * [-1095.970] (-1096.772) (-1101.927) (-1098.951) -- 0:00:50
      242000 -- [-1096.718] (-1095.410) (-1099.438) (-1095.031) * [-1095.122] (-1095.910) (-1101.925) (-1096.618) -- 0:00:50
      242500 -- (-1098.892) (-1095.069) [-1095.049] (-1095.244) * [-1095.385] (-1097.933) (-1095.834) (-1095.791) -- 0:00:49
      243000 -- (-1098.583) [-1095.479] (-1094.696) (-1097.770) * (-1096.942) (-1099.413) (-1099.901) [-1096.656] -- 0:00:49
      243500 -- (-1096.847) (-1095.491) [-1098.121] (-1094.623) * [-1097.511] (-1097.326) (-1096.838) (-1098.559) -- 0:00:49
      244000 -- (-1095.742) [-1098.650] (-1097.748) (-1099.419) * (-1101.157) [-1096.894] (-1100.792) (-1098.445) -- 0:00:49
      244500 -- [-1098.574] (-1097.777) (-1099.304) (-1096.745) * (-1101.771) [-1097.939] (-1100.228) (-1096.665) -- 0:00:49
      245000 -- [-1101.126] (-1095.894) (-1096.010) (-1096.854) * (-1101.616) (-1097.039) (-1098.136) [-1096.494] -- 0:00:49

      Average standard deviation of split frequencies: 0.017353

      245500 -- (-1098.298) (-1099.373) (-1096.615) [-1096.523] * (-1097.169) (-1099.236) [-1094.728] (-1096.952) -- 0:00:49
      246000 -- (-1102.192) (-1098.327) [-1096.411] (-1096.027) * (-1101.295) [-1094.826] (-1096.137) (-1097.933) -- 0:00:49
      246500 -- [-1097.034] (-1096.198) (-1095.723) (-1098.349) * (-1097.497) (-1097.377) (-1098.636) [-1096.400] -- 0:00:48
      247000 -- (-1095.892) (-1096.378) (-1095.853) [-1094.983] * (-1098.610) (-1097.458) (-1101.080) [-1095.664] -- 0:00:48
      247500 -- (-1096.122) (-1098.260) [-1095.665] (-1095.358) * (-1103.754) (-1100.168) (-1099.024) [-1096.782] -- 0:00:48
      248000 -- (-1097.158) [-1096.343] (-1095.517) (-1095.301) * [-1096.661] (-1098.527) (-1097.307) (-1099.444) -- 0:00:48
      248500 -- (-1097.179) (-1095.597) (-1094.965) [-1096.952] * [-1096.284] (-1098.219) (-1096.067) (-1099.838) -- 0:00:48
      249000 -- (-1098.253) [-1096.831] (-1095.096) (-1098.126) * [-1095.819] (-1095.318) (-1095.903) (-1096.134) -- 0:00:48
      249500 -- (-1100.061) [-1096.734] (-1095.523) (-1098.660) * (-1096.968) [-1096.964] (-1097.359) (-1095.975) -- 0:00:48
      250000 -- (-1097.814) [-1096.224] (-1099.109) (-1095.569) * (-1099.753) [-1094.576] (-1097.525) (-1096.393) -- 0:00:48

      Average standard deviation of split frequencies: 0.018924

      250500 -- (-1097.285) (-1096.365) [-1095.782] (-1099.502) * (-1095.674) (-1095.631) (-1099.655) [-1096.412] -- 0:00:47
      251000 -- [-1097.997] (-1095.863) (-1095.829) (-1097.669) * (-1101.678) (-1095.094) [-1098.017] (-1096.121) -- 0:00:47
      251500 -- (-1095.011) [-1095.665] (-1095.829) (-1098.554) * (-1094.988) (-1099.598) [-1099.750] (-1096.018) -- 0:00:47
      252000 -- (-1097.891) [-1095.146] (-1096.551) (-1098.561) * (-1097.759) [-1097.066] (-1100.803) (-1096.194) -- 0:00:47
      252500 -- (-1096.700) [-1096.850] (-1095.229) (-1095.820) * (-1099.494) (-1098.373) (-1098.830) [-1095.624] -- 0:00:47
      253000 -- (-1100.343) [-1094.866] (-1096.045) (-1096.021) * (-1096.546) (-1095.667) [-1095.538] (-1098.952) -- 0:00:47
      253500 -- (-1095.180) [-1098.129] (-1104.181) (-1094.743) * (-1099.536) (-1097.152) (-1098.262) [-1094.904] -- 0:00:47
      254000 -- (-1097.482) (-1099.271) (-1099.870) [-1094.967] * (-1097.365) [-1095.464] (-1096.234) (-1097.925) -- 0:00:46
      254500 -- (-1096.752) [-1096.999] (-1097.236) (-1096.887) * (-1095.409) (-1097.250) (-1099.507) [-1097.361] -- 0:00:46
      255000 -- [-1097.333] (-1095.095) (-1095.842) (-1098.403) * [-1095.293] (-1097.787) (-1097.186) (-1095.139) -- 0:00:49

      Average standard deviation of split frequencies: 0.018414

      255500 -- (-1096.799) (-1095.763) (-1095.781) [-1095.540] * (-1097.850) (-1096.199) (-1096.688) [-1096.160] -- 0:00:49
      256000 -- (-1095.003) [-1101.676] (-1095.685) (-1097.208) * (-1096.625) [-1095.700] (-1097.172) (-1095.577) -- 0:00:49
      256500 -- [-1097.611] (-1099.043) (-1095.457) (-1100.801) * (-1099.450) (-1095.422) [-1097.358] (-1096.834) -- 0:00:49
      257000 -- (-1099.911) (-1096.850) [-1096.380] (-1098.032) * (-1096.959) (-1099.101) (-1097.354) [-1095.213] -- 0:00:49
      257500 -- [-1097.513] (-1096.682) (-1096.270) (-1097.271) * (-1098.823) [-1099.960] (-1097.776) (-1098.349) -- 0:00:49
      258000 -- (-1098.742) (-1095.765) [-1099.919] (-1096.493) * (-1101.109) (-1097.126) (-1097.589) [-1098.486] -- 0:00:48
      258500 -- (-1096.885) [-1097.041] (-1095.972) (-1095.838) * (-1096.975) [-1094.683] (-1095.241) (-1097.964) -- 0:00:48
      259000 -- (-1097.700) (-1094.918) (-1101.140) [-1099.863] * (-1095.861) [-1094.525] (-1095.820) (-1095.509) -- 0:00:48
      259500 -- (-1098.995) (-1095.278) (-1096.506) [-1096.816] * (-1097.481) (-1094.769) [-1094.840] (-1098.615) -- 0:00:48
      260000 -- (-1097.892) [-1095.338] (-1096.822) (-1097.379) * (-1095.873) (-1097.061) [-1096.445] (-1097.673) -- 0:00:48

      Average standard deviation of split frequencies: 0.017446

      260500 -- (-1098.721) (-1098.566) (-1096.749) [-1097.512] * (-1099.286) (-1096.514) (-1097.273) [-1095.454] -- 0:00:48
      261000 -- [-1100.780] (-1100.845) (-1094.733) (-1095.367) * (-1098.942) (-1099.891) [-1095.685] (-1097.023) -- 0:00:48
      261500 -- [-1097.430] (-1097.137) (-1100.898) (-1094.780) * (-1098.395) (-1100.259) (-1096.831) [-1098.349] -- 0:00:48
      262000 -- (-1095.517) (-1096.336) (-1099.609) [-1094.817] * (-1098.964) (-1098.345) (-1096.595) [-1095.307] -- 0:00:47
      262500 -- [-1095.168] (-1096.727) (-1099.139) (-1096.123) * (-1098.023) [-1095.492] (-1097.299) (-1095.619) -- 0:00:47
      263000 -- (-1095.390) (-1098.935) (-1099.025) [-1097.261] * (-1094.894) (-1095.628) [-1096.457] (-1098.772) -- 0:00:47
      263500 -- (-1097.225) (-1098.200) [-1096.923] (-1096.062) * (-1095.870) (-1096.112) (-1099.653) [-1096.497] -- 0:00:47
      264000 -- (-1097.773) (-1097.598) [-1096.526] (-1094.815) * (-1095.055) [-1095.147] (-1103.149) (-1094.467) -- 0:00:47
      264500 -- [-1095.811] (-1096.513) (-1097.112) (-1096.842) * (-1095.984) (-1095.749) (-1100.621) [-1097.572] -- 0:00:47
      265000 -- [-1095.800] (-1096.869) (-1097.068) (-1098.916) * [-1095.872] (-1098.978) (-1098.045) (-1096.995) -- 0:00:47

      Average standard deviation of split frequencies: 0.017305

      265500 -- (-1096.996) (-1101.212) [-1097.328] (-1098.227) * (-1097.747) (-1097.399) [-1097.805] (-1095.978) -- 0:00:47
      266000 -- [-1094.865] (-1095.453) (-1095.744) (-1099.603) * (-1096.934) [-1095.808] (-1096.382) (-1098.416) -- 0:00:46
      266500 -- (-1095.163) (-1096.144) [-1094.858] (-1098.790) * [-1094.977] (-1099.432) (-1095.722) (-1098.278) -- 0:00:46
      267000 -- [-1096.219] (-1096.512) (-1096.977) (-1095.898) * [-1097.621] (-1098.652) (-1095.720) (-1096.979) -- 0:00:46
      267500 -- (-1099.666) [-1095.132] (-1097.593) (-1095.883) * (-1095.680) [-1101.507] (-1097.044) (-1097.097) -- 0:00:46
      268000 -- (-1099.530) (-1095.178) (-1098.384) [-1095.889] * (-1099.686) [-1098.977] (-1098.054) (-1101.004) -- 0:00:46
      268500 -- (-1096.356) (-1096.644) (-1099.197) [-1096.911] * (-1094.791) [-1097.517] (-1103.267) (-1094.585) -- 0:00:46
      269000 -- (-1100.373) [-1096.734] (-1096.448) (-1096.237) * (-1098.763) (-1099.032) (-1097.943) [-1098.336] -- 0:00:46
      269500 -- [-1096.914] (-1097.514) (-1094.998) (-1100.029) * (-1099.643) (-1101.196) (-1098.405) [-1094.959] -- 0:00:46
      270000 -- [-1095.980] (-1096.986) (-1098.098) (-1100.097) * [-1099.376] (-1099.384) (-1096.382) (-1096.626) -- 0:00:45

      Average standard deviation of split frequencies: 0.018868

      270500 -- (-1098.798) [-1095.937] (-1095.467) (-1098.794) * (-1097.331) [-1096.700] (-1096.783) (-1097.098) -- 0:00:45
      271000 -- [-1096.792] (-1100.841) (-1095.968) (-1095.343) * (-1097.125) [-1096.686] (-1096.413) (-1098.084) -- 0:00:45
      271500 -- (-1095.907) (-1096.951) [-1094.665] (-1097.493) * [-1097.066] (-1096.109) (-1094.715) (-1095.723) -- 0:00:48
      272000 -- (-1096.740) [-1099.327] (-1094.984) (-1096.792) * (-1097.207) (-1096.606) (-1095.588) [-1095.736] -- 0:00:48
      272500 -- (-1096.487) (-1099.141) (-1098.316) [-1097.728] * [-1095.734] (-1095.758) (-1095.652) (-1096.608) -- 0:00:48
      273000 -- (-1097.232) (-1098.797) (-1096.127) [-1099.606] * (-1096.770) (-1096.173) [-1102.709] (-1098.631) -- 0:00:47
      273500 -- [-1095.065] (-1098.747) (-1097.559) (-1095.433) * (-1095.451) (-1094.798) [-1096.326] (-1096.020) -- 0:00:47
      274000 -- [-1095.197] (-1098.701) (-1096.545) (-1096.646) * (-1096.153) (-1095.405) [-1096.178] (-1095.490) -- 0:00:47
      274500 -- (-1096.118) (-1099.919) (-1098.979) [-1095.492] * (-1096.073) (-1095.238) [-1097.670] (-1094.965) -- 0:00:47
      275000 -- [-1095.926] (-1098.364) (-1096.071) (-1096.962) * (-1095.938) (-1095.798) [-1097.318] (-1094.914) -- 0:00:47

      Average standard deviation of split frequencies: 0.017080

      275500 -- (-1096.449) (-1099.368) [-1096.265] (-1096.649) * (-1095.059) (-1098.517) [-1099.985] (-1094.463) -- 0:00:47
      276000 -- (-1097.158) (-1099.416) (-1094.706) [-1097.069] * (-1097.915) (-1096.441) (-1097.791) [-1097.593] -- 0:00:47
      276500 -- [-1096.495] (-1100.093) (-1101.162) (-1096.259) * (-1095.078) (-1096.153) (-1094.765) [-1095.529] -- 0:00:47
      277000 -- [-1096.603] (-1096.568) (-1099.636) (-1096.439) * (-1096.285) (-1094.725) (-1094.942) [-1096.180] -- 0:00:46
      277500 -- (-1095.997) [-1096.761] (-1097.549) (-1096.486) * [-1096.447] (-1095.350) (-1094.755) (-1097.588) -- 0:00:46
      278000 -- (-1100.661) [-1095.982] (-1097.297) (-1095.408) * (-1095.845) [-1097.095] (-1096.760) (-1095.041) -- 0:00:46
      278500 -- (-1098.555) (-1095.179) [-1095.043] (-1094.820) * (-1097.854) [-1101.602] (-1094.970) (-1095.525) -- 0:00:46
      279000 -- [-1098.808] (-1096.298) (-1095.170) (-1097.998) * (-1096.591) (-1096.669) (-1096.662) [-1098.488] -- 0:00:46
      279500 -- (-1097.315) [-1096.301] (-1095.115) (-1096.601) * (-1097.214) [-1097.689] (-1097.785) (-1101.966) -- 0:00:46
      280000 -- (-1101.428) (-1096.510) (-1094.884) [-1095.772] * (-1097.303) (-1097.772) [-1095.109] (-1096.619) -- 0:00:46

      Average standard deviation of split frequencies: 0.016376

      280500 -- (-1097.008) (-1096.781) (-1096.347) [-1097.375] * [-1096.583] (-1095.663) (-1095.464) (-1099.900) -- 0:00:46
      281000 -- (-1096.617) (-1096.571) [-1096.751] (-1097.120) * [-1096.441] (-1097.019) (-1095.005) (-1095.589) -- 0:00:46
      281500 -- (-1096.618) (-1098.464) (-1096.210) [-1095.296] * [-1095.482] (-1098.181) (-1094.564) (-1098.242) -- 0:00:45
      282000 -- (-1097.298) (-1096.942) (-1098.122) [-1100.038] * (-1095.482) (-1096.604) [-1094.658] (-1099.348) -- 0:00:45
      282500 -- (-1097.426) [-1096.220] (-1097.236) (-1103.683) * (-1095.616) (-1095.927) (-1095.895) [-1095.650] -- 0:00:45
      283000 -- (-1097.760) (-1098.303) [-1095.610] (-1094.971) * [-1096.470] (-1094.829) (-1095.732) (-1095.979) -- 0:00:45
      283500 -- (-1103.999) [-1095.698] (-1098.132) (-1096.821) * (-1102.552) (-1100.069) [-1096.074] (-1095.445) -- 0:00:45
      284000 -- (-1099.892) [-1096.380] (-1096.236) (-1096.267) * (-1100.064) (-1103.043) [-1098.510] (-1096.595) -- 0:00:45
      284500 -- [-1101.721] (-1096.297) (-1095.439) (-1096.233) * (-1098.389) (-1098.230) (-1101.910) [-1097.860] -- 0:00:45
      285000 -- (-1103.774) [-1096.230] (-1095.389) (-1094.961) * (-1101.449) [-1096.969] (-1096.831) (-1101.266) -- 0:00:45

      Average standard deviation of split frequencies: 0.016916

      285500 -- (-1097.310) (-1097.022) (-1096.982) [-1095.021] * (-1105.949) (-1096.236) (-1098.429) [-1101.338] -- 0:00:45
      286000 -- (-1095.822) (-1098.057) [-1098.353] (-1096.102) * (-1096.091) [-1096.491] (-1097.399) (-1101.400) -- 0:00:44
      286500 -- (-1095.898) (-1097.569) [-1097.028] (-1096.102) * (-1096.041) (-1099.592) (-1098.133) [-1099.248] -- 0:00:44
      287000 -- (-1098.074) (-1095.567) [-1095.195] (-1095.636) * (-1097.606) (-1096.026) [-1099.532] (-1096.143) -- 0:00:44
      287500 -- (-1095.808) (-1096.327) [-1096.383] (-1096.349) * (-1105.481) (-1097.223) [-1096.316] (-1096.799) -- 0:00:47
      288000 -- [-1099.438] (-1097.734) (-1096.114) (-1096.254) * [-1097.344] (-1100.786) (-1096.634) (-1097.109) -- 0:00:46
      288500 -- [-1096.190] (-1097.930) (-1095.986) (-1099.111) * [-1095.549] (-1097.989) (-1095.773) (-1096.314) -- 0:00:46
      289000 -- [-1097.966] (-1096.035) (-1099.989) (-1095.245) * (-1095.460) (-1095.381) [-1094.837] (-1098.589) -- 0:00:46
      289500 -- [-1096.487] (-1095.853) (-1098.106) (-1094.672) * [-1096.518] (-1095.476) (-1095.973) (-1098.412) -- 0:00:46
      290000 -- (-1098.540) (-1097.229) (-1095.391) [-1097.983] * [-1099.223] (-1098.065) (-1098.633) (-1096.108) -- 0:00:46

      Average standard deviation of split frequencies: 0.017389

      290500 -- (-1096.403) (-1097.666) (-1095.426) [-1099.197] * [-1095.875] (-1096.125) (-1095.268) (-1097.825) -- 0:00:46
      291000 -- (-1096.719) [-1095.937] (-1096.154) (-1095.707) * [-1098.358] (-1096.354) (-1095.763) (-1096.216) -- 0:00:46
      291500 -- (-1095.202) [-1097.342] (-1096.380) (-1097.689) * [-1096.074] (-1096.308) (-1097.891) (-1097.700) -- 0:00:46
      292000 -- (-1095.426) (-1095.588) [-1095.727] (-1098.330) * (-1096.213) [-1097.246] (-1095.741) (-1096.494) -- 0:00:46
      292500 -- [-1096.483] (-1098.651) (-1095.859) (-1097.265) * (-1095.836) (-1095.736) (-1099.290) [-1098.199] -- 0:00:45
      293000 -- (-1097.242) (-1098.699) (-1095.501) [-1097.254] * (-1096.159) (-1098.124) (-1098.372) [-1095.252] -- 0:00:45
      293500 -- (-1094.908) (-1097.776) (-1099.037) [-1096.801] * (-1096.820) (-1100.130) (-1097.982) [-1095.252] -- 0:00:45
      294000 -- (-1096.564) [-1096.962] (-1096.297) (-1097.637) * (-1095.734) [-1099.158] (-1097.728) (-1094.562) -- 0:00:45
      294500 -- (-1098.353) (-1095.420) (-1096.111) [-1096.718] * [-1098.116] (-1097.034) (-1099.038) (-1098.638) -- 0:00:45
      295000 -- (-1095.288) (-1095.614) [-1096.384] (-1095.796) * (-1097.018) (-1096.095) [-1098.594] (-1097.218) -- 0:00:45

      Average standard deviation of split frequencies: 0.017518

      295500 -- (-1095.019) [-1096.404] (-1097.718) (-1097.055) * (-1097.218) (-1095.629) [-1095.260] (-1098.070) -- 0:00:45
      296000 -- (-1095.372) (-1097.290) (-1099.781) [-1097.477] * [-1103.417] (-1099.473) (-1095.070) (-1095.012) -- 0:00:45
      296500 -- (-1095.406) (-1099.849) (-1095.956) [-1095.611] * (-1096.908) (-1098.744) (-1098.315) [-1096.700] -- 0:00:45
      297000 -- (-1100.373) [-1095.285] (-1096.178) (-1095.986) * [-1096.497] (-1097.165) (-1099.053) (-1097.385) -- 0:00:44
      297500 -- (-1095.390) (-1096.776) (-1100.837) [-1096.096] * (-1096.181) [-1096.283] (-1098.861) (-1099.975) -- 0:00:44
      298000 -- (-1095.409) [-1095.433] (-1095.123) (-1100.338) * [-1095.168] (-1096.955) (-1100.049) (-1098.010) -- 0:00:44
      298500 -- (-1095.425) (-1096.627) (-1099.869) [-1096.915] * (-1097.285) (-1097.575) [-1095.001] (-1099.465) -- 0:00:44
      299000 -- [-1097.945] (-1096.719) (-1096.565) (-1096.556) * (-1098.782) (-1096.735) [-1095.562] (-1097.664) -- 0:00:44
      299500 -- [-1095.673] (-1099.036) (-1098.572) (-1096.028) * (-1096.861) (-1097.030) (-1095.650) [-1095.928] -- 0:00:44
      300000 -- (-1096.448) (-1096.662) (-1095.616) [-1095.962] * (-1097.258) [-1096.239] (-1099.229) (-1095.390) -- 0:00:44

      Average standard deviation of split frequencies: 0.016811

      300500 -- [-1095.681] (-1096.739) (-1097.415) (-1095.677) * (-1097.888) (-1095.934) [-1095.916] (-1096.279) -- 0:00:44
      301000 -- (-1096.958) [-1098.015] (-1096.069) (-1098.871) * (-1096.952) (-1094.741) [-1101.678] (-1095.661) -- 0:00:44
      301500 -- (-1096.128) (-1096.890) [-1094.899] (-1096.805) * [-1096.076] (-1097.320) (-1097.785) (-1096.147) -- 0:00:44
      302000 -- (-1097.304) (-1095.689) [-1096.839] (-1097.786) * (-1095.460) [-1095.327] (-1101.770) (-1095.278) -- 0:00:43
      302500 -- (-1095.300) (-1095.221) [-1095.643] (-1101.225) * [-1097.432] (-1099.937) (-1099.917) (-1096.288) -- 0:00:43
      303000 -- (-1096.587) (-1097.135) (-1096.049) [-1098.014] * (-1096.237) [-1099.515] (-1098.874) (-1097.266) -- 0:00:43
      303500 -- (-1097.211) [-1097.629] (-1095.940) (-1098.463) * [-1095.670] (-1096.930) (-1099.137) (-1095.116) -- 0:00:45
      304000 -- [-1098.146] (-1098.215) (-1101.192) (-1095.031) * (-1099.397) (-1101.070) [-1096.318] (-1096.729) -- 0:00:45
      304500 -- [-1099.368] (-1095.422) (-1099.560) (-1096.651) * (-1100.488) (-1094.776) [-1099.011] (-1095.675) -- 0:00:45
      305000 -- [-1095.624] (-1095.883) (-1099.789) (-1096.301) * (-1099.247) (-1095.829) (-1096.011) [-1097.057] -- 0:00:45

      Average standard deviation of split frequencies: 0.017108

      305500 -- (-1096.930) (-1096.377) (-1095.398) [-1094.588] * [-1097.935] (-1095.747) (-1095.721) (-1098.021) -- 0:00:45
      306000 -- (-1095.617) (-1097.156) (-1096.007) [-1094.667] * (-1098.187) (-1095.802) [-1099.514] (-1100.404) -- 0:00:45
      306500 -- (-1096.263) (-1099.050) [-1095.897] (-1095.264) * (-1101.643) (-1096.100) [-1099.510] (-1096.531) -- 0:00:45
      307000 -- [-1095.693] (-1099.919) (-1097.745) (-1099.364) * (-1096.499) (-1095.400) (-1098.401) [-1096.439] -- 0:00:45
      307500 -- [-1095.192] (-1096.448) (-1099.547) (-1095.201) * (-1097.151) (-1096.183) [-1095.274] (-1097.944) -- 0:00:45
      308000 -- (-1096.246) (-1099.064) [-1097.035] (-1094.917) * (-1102.160) [-1098.055] (-1095.350) (-1100.852) -- 0:00:44
      308500 -- [-1096.134] (-1095.206) (-1097.259) (-1094.921) * [-1098.014] (-1097.384) (-1095.227) (-1096.942) -- 0:00:44
      309000 -- (-1095.161) (-1096.673) (-1095.193) [-1096.422] * (-1098.204) [-1097.838] (-1096.121) (-1096.926) -- 0:00:44
      309500 -- [-1096.322] (-1097.868) (-1095.216) (-1096.032) * (-1097.220) [-1095.397] (-1096.395) (-1097.169) -- 0:00:44
      310000 -- (-1096.501) [-1097.113] (-1096.906) (-1096.781) * (-1096.001) (-1095.625) [-1095.768] (-1095.151) -- 0:00:44

      Average standard deviation of split frequencies: 0.018289

      310500 -- (-1098.650) (-1097.087) (-1096.423) [-1097.315] * (-1096.430) (-1096.908) (-1095.873) [-1095.217] -- 0:00:44
      311000 -- (-1096.040) (-1095.870) [-1095.542] (-1097.117) * (-1097.945) (-1097.785) [-1096.838] (-1095.407) -- 0:00:44
      311500 -- (-1100.396) (-1097.743) [-1095.601] (-1096.896) * (-1096.195) (-1099.652) (-1095.253) [-1096.809] -- 0:00:44
      312000 -- (-1098.258) (-1098.311) [-1095.491] (-1096.308) * (-1096.387) (-1098.066) (-1097.851) [-1097.676] -- 0:00:44
      312500 -- [-1097.073] (-1097.098) (-1099.134) (-1098.134) * (-1097.703) (-1099.135) (-1097.567) [-1098.177] -- 0:00:44
      313000 -- (-1098.215) (-1102.605) [-1095.491] (-1095.952) * [-1097.993] (-1100.378) (-1096.076) (-1101.930) -- 0:00:43
      313500 -- (-1101.087) (-1103.245) (-1098.315) [-1097.026] * (-1094.862) [-1094.754] (-1095.457) (-1095.164) -- 0:00:43
      314000 -- [-1096.751] (-1100.639) (-1096.796) (-1095.904) * (-1100.496) [-1097.659] (-1096.707) (-1099.633) -- 0:00:43
      314500 -- (-1098.325) (-1096.876) (-1096.588) [-1095.547] * (-1098.671) (-1097.349) [-1095.695] (-1096.638) -- 0:00:43
      315000 -- (-1097.386) [-1095.071] (-1101.708) (-1095.098) * [-1096.538] (-1100.718) (-1097.351) (-1095.551) -- 0:00:43

      Average standard deviation of split frequencies: 0.017430

      315500 -- (-1096.187) [-1101.056] (-1103.705) (-1099.604) * (-1096.153) [-1096.981] (-1095.680) (-1103.584) -- 0:00:43
      316000 -- (-1096.227) (-1098.684) (-1096.637) [-1098.004] * (-1096.156) [-1095.882] (-1101.984) (-1097.140) -- 0:00:43
      316500 -- (-1101.240) [-1096.440] (-1095.918) (-1096.887) * (-1097.259) [-1097.478] (-1096.992) (-1097.337) -- 0:00:43
      317000 -- (-1101.010) (-1096.085) [-1100.812] (-1096.735) * (-1098.225) [-1096.744] (-1095.188) (-1098.873) -- 0:00:43
      317500 -- [-1095.962] (-1096.801) (-1098.934) (-1096.223) * (-1097.588) (-1098.137) (-1096.931) [-1100.361] -- 0:00:42
      318000 -- [-1096.354] (-1097.921) (-1097.189) (-1099.170) * (-1097.845) [-1096.751] (-1097.125) (-1109.899) -- 0:00:42
      318500 -- (-1094.628) [-1099.797] (-1096.299) (-1098.458) * (-1101.243) (-1096.686) (-1098.229) [-1108.950] -- 0:00:42
      319000 -- [-1095.983] (-1097.907) (-1097.069) (-1099.049) * (-1096.904) [-1096.686] (-1099.882) (-1097.564) -- 0:00:42
      319500 -- (-1098.045) [-1097.183] (-1095.609) (-1097.601) * [-1095.169] (-1096.876) (-1097.287) (-1095.706) -- 0:00:42
      320000 -- (-1098.062) [-1096.614] (-1097.348) (-1097.041) * (-1096.325) [-1099.259] (-1095.997) (-1095.604) -- 0:00:44

      Average standard deviation of split frequencies: 0.017718

      320500 -- (-1097.835) (-1097.287) (-1095.676) [-1095.751] * (-1097.050) [-1095.200] (-1098.188) (-1095.851) -- 0:00:44
      321000 -- [-1097.666] (-1097.287) (-1095.101) (-1095.559) * [-1096.741] (-1098.739) (-1096.897) (-1099.408) -- 0:00:44
      321500 -- [-1097.328] (-1097.836) (-1098.316) (-1095.356) * [-1097.224] (-1099.759) (-1099.642) (-1096.338) -- 0:00:44
      322000 -- (-1101.922) [-1096.262] (-1098.882) (-1096.079) * (-1097.238) (-1099.270) [-1096.839] (-1096.186) -- 0:00:44
      322500 -- (-1096.670) (-1095.407) (-1096.522) [-1096.141] * (-1097.317) (-1099.230) (-1096.681) [-1094.993] -- 0:00:44
      323000 -- (-1100.545) [-1096.553] (-1095.227) (-1096.259) * (-1096.576) (-1099.802) (-1096.882) [-1097.825] -- 0:00:44
      323500 -- (-1096.571) [-1096.312] (-1095.746) (-1097.785) * [-1097.046] (-1095.604) (-1100.765) (-1095.501) -- 0:00:43
      324000 -- [-1099.822] (-1096.512) (-1095.000) (-1095.516) * (-1096.560) (-1098.271) (-1100.634) [-1095.919] -- 0:00:43
      324500 -- (-1096.545) (-1096.877) [-1094.693] (-1095.189) * (-1097.359) (-1100.070) (-1096.620) [-1095.152] -- 0:00:43
      325000 -- (-1098.476) (-1098.538) (-1094.998) [-1096.407] * (-1103.671) (-1095.099) (-1095.663) [-1094.955] -- 0:00:43

      Average standard deviation of split frequencies: 0.016846

      325500 -- (-1094.377) (-1097.084) (-1096.503) [-1097.631] * (-1095.855) [-1101.763] (-1096.649) (-1095.538) -- 0:00:43
      326000 -- (-1095.003) (-1094.595) (-1097.287) [-1095.507] * (-1095.545) (-1098.960) [-1099.463] (-1096.295) -- 0:00:43
      326500 -- (-1095.956) (-1096.908) [-1095.740] (-1100.217) * (-1094.901) (-1096.359) [-1097.850] (-1097.203) -- 0:00:43
      327000 -- (-1095.326) (-1096.759) [-1094.777] (-1099.010) * (-1095.055) (-1095.929) [-1097.134] (-1096.212) -- 0:00:43
      327500 -- (-1096.223) (-1097.488) (-1095.218) [-1102.531] * (-1096.224) (-1095.775) [-1098.876] (-1097.524) -- 0:00:43
      328000 -- [-1100.034] (-1099.811) (-1094.643) (-1096.558) * [-1095.201] (-1095.978) (-1097.679) (-1095.717) -- 0:00:43
      328500 -- (-1097.072) [-1097.050] (-1099.443) (-1096.803) * (-1095.345) (-1099.820) [-1097.290] (-1095.508) -- 0:00:42
      329000 -- (-1098.159) (-1095.594) (-1097.797) [-1098.917] * (-1096.050) (-1098.973) (-1098.558) [-1100.613] -- 0:00:42
      329500 -- (-1097.362) (-1094.742) (-1098.491) [-1097.173] * (-1095.211) (-1097.199) [-1100.060] (-1098.345) -- 0:00:42
      330000 -- (-1097.510) (-1095.515) [-1097.771] (-1098.474) * [-1095.251] (-1095.935) (-1099.859) (-1100.094) -- 0:00:42

      Average standard deviation of split frequencies: 0.016870

      330500 -- (-1096.734) [-1095.544] (-1096.296) (-1095.520) * (-1099.000) (-1097.041) [-1096.035] (-1094.949) -- 0:00:42
      331000 -- (-1094.716) [-1095.414] (-1097.917) (-1100.756) * (-1102.535) (-1096.731) [-1094.554] (-1099.693) -- 0:00:42
      331500 -- (-1096.939) (-1096.435) (-1095.406) [-1098.182] * [-1101.492] (-1096.462) (-1095.178) (-1096.314) -- 0:00:42
      332000 -- (-1097.716) [-1096.972] (-1095.365) (-1095.473) * (-1096.005) (-1096.756) [-1094.952] (-1096.989) -- 0:00:42
      332500 -- (-1100.643) (-1098.661) [-1095.082] (-1100.536) * (-1099.945) (-1100.368) (-1099.866) [-1096.481] -- 0:00:42
      333000 -- (-1099.547) (-1099.158) [-1095.905] (-1096.363) * (-1097.420) (-1099.348) (-1098.604) [-1095.481] -- 0:00:42
      333500 -- (-1098.323) [-1099.878] (-1094.724) (-1097.093) * (-1097.310) [-1096.972] (-1095.423) (-1096.263) -- 0:00:41
      334000 -- (-1100.949) (-1095.525) (-1095.261) [-1096.959] * [-1094.475] (-1095.637) (-1096.354) (-1096.275) -- 0:00:41
      334500 -- (-1101.704) (-1094.988) (-1094.730) [-1096.007] * (-1094.934) (-1095.150) [-1096.379] (-1098.027) -- 0:00:41
      335000 -- [-1099.647] (-1096.421) (-1098.691) (-1095.535) * (-1097.763) [-1095.646] (-1099.036) (-1097.409) -- 0:00:41

      Average standard deviation of split frequencies: 0.016290

      335500 -- [-1097.846] (-1097.070) (-1097.717) (-1098.074) * [-1094.870] (-1095.358) (-1097.808) (-1094.548) -- 0:00:41
      336000 -- (-1096.224) (-1097.367) (-1096.689) [-1095.234] * (-1097.745) [-1095.001] (-1097.814) (-1096.559) -- 0:00:43
      336500 -- (-1096.507) (-1099.322) (-1097.366) [-1095.069] * (-1096.629) (-1095.001) [-1096.470] (-1098.052) -- 0:00:43
      337000 -- (-1095.746) [-1096.129] (-1097.527) (-1095.046) * (-1095.603) (-1095.898) (-1097.350) [-1095.335] -- 0:00:43
      337500 -- (-1095.758) (-1096.825) [-1097.963] (-1098.752) * (-1096.142) (-1096.981) (-1097.161) [-1098.303] -- 0:00:43
      338000 -- (-1099.602) (-1096.065) [-1100.972] (-1098.558) * [-1097.245] (-1099.771) (-1095.605) (-1099.574) -- 0:00:43
      338500 -- (-1099.656) (-1096.626) [-1100.015] (-1099.095) * (-1097.328) (-1095.381) [-1097.301] (-1099.927) -- 0:00:42
      339000 -- (-1099.215) [-1095.934] (-1095.039) (-1098.047) * (-1094.626) [-1100.247] (-1097.825) (-1098.588) -- 0:00:42
      339500 -- (-1097.286) (-1097.361) (-1094.967) [-1096.440] * (-1098.330) (-1098.598) [-1100.966] (-1099.639) -- 0:00:42
      340000 -- (-1097.470) [-1098.415] (-1095.742) (-1097.381) * (-1097.850) (-1099.860) (-1097.810) [-1096.322] -- 0:00:42

      Average standard deviation of split frequencies: 0.016969

      340500 -- (-1097.475) (-1098.388) (-1097.246) [-1097.352] * (-1096.007) (-1096.270) (-1096.718) [-1096.299] -- 0:00:42
      341000 -- [-1095.720] (-1095.608) (-1103.057) (-1095.447) * (-1101.889) (-1095.760) (-1095.909) [-1095.202] -- 0:00:42
      341500 -- [-1095.367] (-1095.617) (-1095.687) (-1094.929) * (-1095.605) [-1095.401] (-1094.681) (-1096.631) -- 0:00:42
      342000 -- (-1097.454) (-1096.194) (-1096.577) [-1098.164] * (-1095.698) [-1097.268] (-1099.356) (-1095.827) -- 0:00:42
      342500 -- (-1096.117) (-1097.119) [-1096.522] (-1095.971) * [-1096.123] (-1095.522) (-1098.080) (-1096.154) -- 0:00:42
      343000 -- (-1101.929) [-1095.861] (-1098.299) (-1096.643) * (-1100.919) (-1095.098) [-1096.373] (-1096.367) -- 0:00:42
      343500 -- (-1098.889) (-1099.996) (-1097.695) [-1095.466] * (-1098.627) (-1095.020) [-1096.030] (-1094.701) -- 0:00:42
      344000 -- [-1099.199] (-1103.167) (-1096.231) (-1095.368) * [-1096.294] (-1096.799) (-1096.913) (-1094.701) -- 0:00:41
      344500 -- [-1098.594] (-1100.547) (-1098.091) (-1096.489) * (-1096.090) [-1097.199] (-1098.151) (-1095.544) -- 0:00:41
      345000 -- (-1095.699) (-1098.759) [-1101.211] (-1095.658) * [-1097.851] (-1095.582) (-1098.613) (-1097.210) -- 0:00:41

      Average standard deviation of split frequencies: 0.017353

      345500 -- (-1095.925) (-1097.152) [-1100.869] (-1098.556) * (-1096.666) [-1095.742] (-1097.207) (-1095.036) -- 0:00:41
      346000 -- (-1096.717) (-1097.233) (-1096.562) [-1095.257] * (-1098.562) (-1099.904) [-1095.677] (-1095.514) -- 0:00:41
      346500 -- [-1096.375] (-1096.012) (-1098.640) (-1095.742) * [-1096.742] (-1095.264) (-1096.150) (-1095.116) -- 0:00:41
      347000 -- (-1096.165) [-1097.744] (-1097.554) (-1095.581) * (-1100.996) [-1095.318] (-1095.300) (-1096.809) -- 0:00:41
      347500 -- (-1096.173) (-1097.246) (-1096.121) [-1096.966] * (-1096.635) (-1095.851) (-1095.612) [-1096.059] -- 0:00:41
      348000 -- (-1097.584) (-1095.413) (-1095.506) [-1096.200] * (-1097.641) (-1095.148) (-1095.812) [-1100.592] -- 0:00:41
      348500 -- [-1098.905] (-1097.275) (-1099.284) (-1094.776) * (-1100.408) (-1101.237) [-1095.219] (-1096.767) -- 0:00:41
      349000 -- (-1097.254) [-1095.963] (-1098.143) (-1094.843) * (-1101.949) (-1098.168) (-1098.871) [-1096.483] -- 0:00:41
      349500 -- [-1095.202] (-1097.081) (-1100.118) (-1096.128) * (-1095.852) (-1095.853) [-1099.497] (-1096.437) -- 0:00:40
      350000 -- (-1096.086) (-1096.766) [-1099.803] (-1099.779) * (-1095.802) [-1096.286] (-1102.743) (-1098.878) -- 0:00:40

      Average standard deviation of split frequencies: 0.016344

      350500 -- (-1096.263) [-1096.847] (-1096.815) (-1096.394) * (-1095.249) (-1097.150) [-1099.879] (-1095.533) -- 0:00:40
      351000 -- (-1097.467) (-1097.240) [-1095.679] (-1100.486) * [-1095.014] (-1098.781) (-1099.560) (-1095.627) -- 0:00:40
      351500 -- [-1095.944] (-1096.351) (-1096.711) (-1103.572) * (-1095.217) (-1097.623) [-1101.420] (-1099.433) -- 0:00:40
      352000 -- (-1094.846) (-1098.246) (-1096.778) [-1096.436] * (-1096.244) [-1097.463] (-1100.366) (-1102.058) -- 0:00:40
      352500 -- [-1094.533] (-1099.641) (-1100.168) (-1101.208) * [-1098.964] (-1097.093) (-1097.421) (-1099.082) -- 0:00:42
      353000 -- [-1096.068] (-1100.259) (-1096.486) (-1101.178) * (-1096.626) (-1096.666) (-1095.485) [-1095.441] -- 0:00:42
      353500 -- [-1096.751] (-1098.533) (-1096.640) (-1100.400) * (-1095.768) (-1097.562) [-1096.318] (-1097.390) -- 0:00:42
      354000 -- [-1096.890] (-1099.369) (-1095.315) (-1095.535) * [-1095.763] (-1098.338) (-1094.689) (-1098.379) -- 0:00:41
      354500 -- (-1097.195) [-1097.548] (-1096.967) (-1096.523) * (-1099.764) (-1099.742) [-1095.625] (-1097.671) -- 0:00:41
      355000 -- (-1095.523) (-1094.939) (-1095.888) [-1100.797] * (-1099.234) (-1097.656) [-1097.110] (-1099.021) -- 0:00:41

      Average standard deviation of split frequencies: 0.015820

      355500 -- (-1097.818) (-1094.864) [-1097.752] (-1100.348) * (-1097.018) [-1096.521] (-1096.260) (-1100.710) -- 0:00:41
      356000 -- [-1094.858] (-1096.540) (-1097.173) (-1099.578) * (-1096.590) (-1097.963) (-1096.516) [-1100.963] -- 0:00:41
      356500 -- [-1095.967] (-1097.264) (-1096.268) (-1096.100) * (-1095.112) (-1097.930) [-1098.179] (-1101.395) -- 0:00:41
      357000 -- (-1096.252) [-1098.523] (-1094.923) (-1095.289) * (-1096.010) (-1096.711) [-1097.038] (-1097.465) -- 0:00:41
      357500 -- (-1096.279) (-1096.572) [-1100.236] (-1094.810) * (-1099.030) (-1097.766) (-1096.219) [-1095.781] -- 0:00:41
      358000 -- [-1096.181] (-1095.746) (-1095.466) (-1094.828) * [-1094.775] (-1097.592) (-1097.986) (-1098.189) -- 0:00:41
      358500 -- (-1096.991) (-1096.732) [-1096.383] (-1094.943) * (-1095.398) (-1096.702) (-1098.521) [-1096.081] -- 0:00:41
      359000 -- [-1097.199] (-1097.467) (-1096.298) (-1095.139) * (-1095.142) [-1098.085] (-1099.000) (-1096.563) -- 0:00:41
      359500 -- [-1101.393] (-1095.794) (-1098.842) (-1094.961) * (-1096.156) [-1096.015] (-1094.626) (-1095.751) -- 0:00:40
      360000 -- (-1099.060) [-1097.513] (-1095.523) (-1096.729) * (-1096.601) [-1095.976] (-1096.956) (-1097.092) -- 0:00:40

      Average standard deviation of split frequencies: 0.014377

      360500 -- (-1103.115) (-1096.271) (-1096.948) [-1094.626] * [-1099.312] (-1099.900) (-1098.308) (-1094.948) -- 0:00:40
      361000 -- [-1096.318] (-1095.966) (-1096.813) (-1094.732) * (-1103.041) (-1103.141) (-1095.281) [-1095.396] -- 0:00:40
      361500 -- (-1094.624) (-1096.871) (-1096.056) [-1095.588] * [-1098.229] (-1096.437) (-1097.062) (-1098.039) -- 0:00:40
      362000 -- (-1094.642) (-1099.616) (-1096.845) [-1097.067] * (-1097.432) (-1097.295) (-1097.846) [-1104.189] -- 0:00:40
      362500 -- (-1095.393) (-1101.497) (-1099.336) [-1098.425] * (-1097.615) (-1098.984) [-1096.205] (-1099.274) -- 0:00:40
      363000 -- [-1095.580] (-1097.367) (-1096.337) (-1100.116) * (-1096.439) (-1101.644) [-1098.580] (-1101.646) -- 0:00:40
      363500 -- (-1095.158) (-1096.905) [-1103.101] (-1097.578) * [-1096.109] (-1096.659) (-1095.611) (-1099.028) -- 0:00:40
      364000 -- (-1097.401) (-1099.192) (-1098.477) [-1098.252] * (-1096.568) (-1101.535) [-1096.467] (-1097.712) -- 0:00:40
      364500 -- [-1097.024] (-1096.907) (-1096.423) (-1098.365) * (-1094.640) (-1101.018) (-1096.476) [-1097.687] -- 0:00:40
      365000 -- (-1098.276) (-1097.782) (-1097.405) [-1097.883] * (-1094.847) (-1096.719) (-1102.267) [-1099.854] -- 0:00:40

      Average standard deviation of split frequencies: 0.014371

      365500 -- (-1101.011) (-1095.391) [-1095.585] (-1095.285) * (-1100.055) (-1094.807) [-1103.228] (-1099.086) -- 0:00:39
      366000 -- (-1096.553) (-1096.885) (-1096.380) [-1095.290] * [-1097.035] (-1096.035) (-1097.340) (-1096.534) -- 0:00:39
      366500 -- (-1094.929) [-1096.539] (-1095.808) (-1095.220) * [-1095.239] (-1099.141) (-1099.960) (-1095.320) -- 0:00:39
      367000 -- (-1097.884) (-1096.824) [-1097.686] (-1096.459) * [-1094.565] (-1099.697) (-1097.897) (-1095.662) -- 0:00:39
      367500 -- (-1098.098) (-1094.953) (-1095.581) [-1097.551] * (-1095.737) (-1094.970) [-1098.712] (-1099.936) -- 0:00:39
      368000 -- (-1096.199) [-1096.337] (-1096.747) (-1096.786) * [-1095.034] (-1095.436) (-1099.198) (-1097.060) -- 0:00:39
      368500 -- (-1097.114) [-1095.667] (-1100.215) (-1096.909) * [-1105.282] (-1095.640) (-1096.364) (-1098.953) -- 0:00:41
      369000 -- (-1096.970) (-1097.125) (-1099.069) [-1095.794] * (-1095.753) [-1095.619] (-1096.655) (-1098.478) -- 0:00:41
      369500 -- (-1096.878) [-1097.695] (-1096.909) (-1096.375) * [-1096.367] (-1096.828) (-1097.230) (-1098.013) -- 0:00:40
      370000 -- [-1096.469] (-1095.860) (-1100.797) (-1095.839) * [-1098.008] (-1098.778) (-1095.957) (-1098.274) -- 0:00:40

      Average standard deviation of split frequencies: 0.013142

      370500 -- (-1095.427) [-1099.033] (-1100.320) (-1095.225) * (-1100.708) (-1099.960) [-1096.574] (-1095.675) -- 0:00:40
      371000 -- [-1095.961] (-1097.487) (-1098.992) (-1097.167) * [-1097.100] (-1096.249) (-1100.294) (-1095.910) -- 0:00:40
      371500 -- (-1098.675) (-1098.005) (-1098.547) [-1094.685] * (-1098.785) (-1097.772) [-1098.535] (-1095.481) -- 0:00:40
      372000 -- [-1096.521] (-1098.390) (-1099.044) (-1097.659) * [-1097.523] (-1100.669) (-1095.262) (-1100.373) -- 0:00:40
      372500 -- [-1097.847] (-1099.220) (-1097.791) (-1099.441) * [-1097.370] (-1099.677) (-1096.469) (-1098.379) -- 0:00:40
      373000 -- [-1101.192] (-1094.720) (-1097.903) (-1097.882) * (-1094.993) (-1095.063) (-1097.383) [-1097.651] -- 0:00:40
      373500 -- (-1096.771) [-1096.190] (-1097.129) (-1097.475) * (-1096.200) [-1095.412] (-1098.858) (-1099.327) -- 0:00:40
      374000 -- (-1094.530) [-1097.679] (-1096.541) (-1096.977) * (-1095.186) [-1097.892] (-1098.710) (-1096.627) -- 0:00:40
      374500 -- (-1095.317) (-1097.712) (-1096.554) [-1099.824] * (-1095.285) (-1099.683) (-1100.868) [-1100.045] -- 0:00:40
      375000 -- (-1095.067) (-1097.650) (-1095.204) [-1097.113] * (-1095.233) (-1097.558) [-1102.139] (-1100.101) -- 0:00:40

      Average standard deviation of split frequencies: 0.013512

      375500 -- (-1096.366) (-1098.048) (-1095.298) [-1097.315] * (-1098.212) (-1097.142) [-1096.175] (-1097.167) -- 0:00:39
      376000 -- (-1096.240) [-1098.075] (-1095.855) (-1100.845) * (-1096.244) (-1096.291) (-1095.806) [-1098.962] -- 0:00:39
      376500 -- [-1097.184] (-1096.121) (-1096.255) (-1099.161) * [-1095.179] (-1094.757) (-1097.367) (-1096.809) -- 0:00:39
      377000 -- [-1097.584] (-1095.520) (-1096.353) (-1095.176) * (-1095.051) (-1096.457) [-1097.442] (-1098.350) -- 0:00:39
      377500 -- [-1097.436] (-1095.628) (-1096.342) (-1099.059) * (-1097.714) (-1096.173) [-1096.026] (-1097.787) -- 0:00:39
      378000 -- (-1096.242) (-1096.667) (-1098.220) [-1095.905] * (-1095.181) (-1097.857) [-1098.374] (-1097.525) -- 0:00:39
      378500 -- (-1096.471) [-1095.697] (-1098.743) (-1103.370) * (-1096.990) (-1100.010) (-1097.375) [-1098.448] -- 0:00:39
      379000 -- (-1097.738) (-1095.965) [-1096.029] (-1101.044) * [-1096.684] (-1095.447) (-1097.915) (-1100.710) -- 0:00:39
      379500 -- (-1096.340) (-1096.286) (-1098.385) [-1098.025] * (-1096.531) (-1095.302) [-1100.455] (-1098.355) -- 0:00:39
      380000 -- (-1096.043) [-1096.981] (-1100.130) (-1097.756) * (-1098.020) (-1095.528) (-1100.726) [-1096.177] -- 0:00:39

      Average standard deviation of split frequencies: 0.013416

      380500 -- (-1100.986) (-1095.953) (-1098.071) [-1096.054] * (-1098.701) [-1094.874] (-1096.861) (-1096.958) -- 0:00:39
      381000 -- (-1097.560) (-1097.028) [-1095.924] (-1095.906) * (-1097.981) [-1097.160] (-1095.768) (-1100.598) -- 0:00:38
      381500 -- (-1096.329) (-1096.233) (-1096.411) [-1095.725] * [-1096.063] (-1094.593) (-1095.845) (-1098.035) -- 0:00:38
      382000 -- [-1094.705] (-1095.324) (-1095.957) (-1095.033) * (-1096.447) [-1095.375] (-1096.861) (-1095.576) -- 0:00:38
      382500 -- [-1096.173] (-1099.323) (-1094.715) (-1097.763) * (-1098.467) [-1095.018] (-1098.084) (-1096.946) -- 0:00:38
      383000 -- (-1096.568) [-1097.622] (-1094.907) (-1098.873) * [-1098.198] (-1096.508) (-1096.874) (-1096.029) -- 0:00:38
      383500 -- (-1098.522) [-1097.573] (-1100.550) (-1097.002) * (-1094.582) [-1096.163] (-1096.581) (-1098.671) -- 0:00:38
      384000 -- (-1096.847) (-1096.815) (-1099.735) [-1097.367] * (-1095.004) (-1095.741) [-1096.601] (-1096.726) -- 0:00:38
      384500 -- [-1097.387] (-1099.983) (-1097.060) (-1096.278) * [-1095.554] (-1104.165) (-1096.056) (-1096.425) -- 0:00:38
      385000 -- (-1100.305) (-1096.534) [-1097.083] (-1097.302) * (-1097.729) (-1097.365) (-1096.984) [-1096.156] -- 0:00:39

      Average standard deviation of split frequencies: 0.013162

      385500 -- (-1095.827) [-1100.371] (-1095.170) (-1100.336) * (-1095.983) (-1097.258) (-1097.326) [-1096.824] -- 0:00:39
      386000 -- (-1095.701) (-1102.710) [-1099.015] (-1096.808) * (-1095.415) (-1096.342) [-1097.990] (-1103.226) -- 0:00:39
      386500 -- (-1095.512) (-1101.080) (-1096.813) [-1096.322] * [-1096.145] (-1096.257) (-1095.053) (-1098.720) -- 0:00:39
      387000 -- (-1096.862) [-1100.268] (-1095.109) (-1096.603) * (-1096.453) (-1097.244) (-1097.106) [-1098.681] -- 0:00:39
      387500 -- (-1097.637) (-1099.550) (-1097.244) [-1095.387] * (-1101.171) (-1097.075) [-1096.873] (-1096.654) -- 0:00:39
      388000 -- (-1097.413) (-1097.449) (-1095.529) [-1097.268] * [-1100.798] (-1096.797) (-1098.417) (-1094.897) -- 0:00:39
      388500 -- (-1095.862) (-1095.259) (-1096.497) [-1095.299] * (-1096.869) (-1095.590) (-1095.553) [-1098.026] -- 0:00:39
      389000 -- [-1097.616] (-1097.046) (-1096.644) (-1095.458) * (-1096.606) (-1095.524) [-1095.765] (-1095.270) -- 0:00:39
      389500 -- [-1096.304] (-1095.428) (-1098.046) (-1097.714) * [-1097.445] (-1098.295) (-1095.019) (-1094.690) -- 0:00:39
      390000 -- [-1096.480] (-1099.173) (-1098.509) (-1100.606) * [-1096.610] (-1097.048) (-1095.899) (-1095.317) -- 0:00:39

      Average standard deviation of split frequencies: 0.013210

      390500 -- (-1097.429) (-1097.301) [-1095.356] (-1098.304) * [-1095.744] (-1095.633) (-1095.459) (-1096.794) -- 0:00:39
      391000 -- (-1096.450) (-1098.764) (-1097.262) [-1099.436] * (-1095.795) (-1095.723) (-1098.034) [-1096.761] -- 0:00:38
      391500 -- [-1098.381] (-1095.280) (-1097.367) (-1098.662) * [-1097.471] (-1096.044) (-1096.379) (-1099.478) -- 0:00:38
      392000 -- (-1096.028) (-1095.127) [-1098.391] (-1095.328) * [-1096.615] (-1096.456) (-1095.643) (-1098.912) -- 0:00:38
      392500 -- (-1097.843) (-1098.844) [-1097.519] (-1094.554) * (-1096.392) [-1098.704] (-1095.802) (-1100.448) -- 0:00:38
      393000 -- (-1102.366) [-1095.562] (-1097.133) (-1098.965) * (-1095.284) (-1099.428) [-1097.028] (-1098.068) -- 0:00:38
      393500 -- (-1100.450) [-1096.139] (-1099.274) (-1099.391) * (-1095.331) (-1097.636) (-1096.180) [-1095.777] -- 0:00:38
      394000 -- (-1097.887) (-1099.014) [-1097.505] (-1097.228) * (-1098.075) (-1096.219) [-1097.020] (-1098.475) -- 0:00:38
      394500 -- (-1097.731) [-1097.864] (-1099.258) (-1095.405) * (-1097.089) (-1098.052) [-1100.173] (-1108.135) -- 0:00:38
      395000 -- [-1098.233] (-1097.063) (-1101.796) (-1095.269) * [-1096.723] (-1094.602) (-1095.914) (-1097.066) -- 0:00:38

      Average standard deviation of split frequencies: 0.012907

      395500 -- (-1099.041) [-1094.895] (-1095.705) (-1096.899) * (-1097.747) [-1096.077] (-1098.886) (-1100.599) -- 0:00:38
      396000 -- (-1097.503) (-1097.189) [-1095.699] (-1097.129) * (-1097.243) (-1095.316) (-1097.862) [-1094.944] -- 0:00:38
      396500 -- (-1100.440) [-1095.926] (-1096.295) (-1095.329) * (-1094.951) (-1100.135) (-1096.741) [-1101.941] -- 0:00:38
      397000 -- (-1099.832) (-1099.679) (-1095.909) [-1095.508] * [-1096.678] (-1099.275) (-1100.765) (-1097.831) -- 0:00:37
      397500 -- (-1101.425) (-1097.857) [-1095.420] (-1097.853) * (-1098.587) [-1096.715] (-1098.314) (-1100.278) -- 0:00:37
      398000 -- (-1099.493) (-1095.871) [-1095.838] (-1098.847) * (-1099.473) (-1096.205) [-1097.299] (-1098.270) -- 0:00:37
      398500 -- (-1095.473) (-1097.315) (-1096.803) [-1095.111] * (-1095.621) (-1097.870) [-1098.851] (-1102.968) -- 0:00:37
      399000 -- [-1095.398] (-1097.112) (-1097.654) (-1098.565) * (-1096.138) (-1098.063) (-1100.327) [-1095.983] -- 0:00:37
      399500 -- [-1095.157] (-1096.705) (-1096.723) (-1095.688) * (-1098.468) (-1098.028) (-1097.103) [-1096.728] -- 0:00:37
      400000 -- [-1095.468] (-1095.729) (-1095.974) (-1096.023) * (-1095.572) (-1095.145) [-1100.213] (-1096.983) -- 0:00:37

      Average standard deviation of split frequencies: 0.012746

      400500 -- (-1102.645) (-1096.882) (-1095.329) [-1094.559] * (-1096.404) (-1096.270) [-1095.255] (-1097.332) -- 0:00:37
      401000 -- (-1105.336) (-1096.401) (-1095.128) [-1096.630] * [-1096.125] (-1098.111) (-1097.569) (-1100.135) -- 0:00:38
      401500 -- (-1097.296) (-1097.204) (-1097.527) [-1095.937] * (-1096.700) (-1094.782) [-1096.934] (-1098.406) -- 0:00:38
      402000 -- (-1098.327) [-1097.871] (-1099.420) (-1097.627) * [-1095.191] (-1095.071) (-1097.147) (-1099.658) -- 0:00:38
      402500 -- (-1095.103) [-1096.359] (-1098.380) (-1096.431) * (-1095.694) (-1095.576) [-1095.742] (-1100.135) -- 0:00:38
      403000 -- [-1097.567] (-1098.840) (-1097.719) (-1096.507) * (-1096.927) (-1095.570) [-1097.256] (-1098.706) -- 0:00:38
      403500 -- [-1095.947] (-1095.173) (-1096.196) (-1096.886) * (-1097.512) (-1097.950) [-1097.310] (-1101.248) -- 0:00:38
      404000 -- (-1096.950) (-1096.557) (-1097.992) [-1095.974] * (-1099.887) (-1095.128) [-1096.583] (-1099.785) -- 0:00:38
      404500 -- [-1097.013] (-1097.023) (-1098.916) (-1099.992) * (-1100.368) [-1096.856] (-1097.660) (-1097.274) -- 0:00:38
      405000 -- [-1095.192] (-1097.262) (-1099.686) (-1098.210) * (-1098.450) [-1096.362] (-1097.946) (-1096.623) -- 0:00:38

      Average standard deviation of split frequencies: 0.012579

      405500 -- (-1096.052) (-1096.736) (-1098.203) [-1095.435] * [-1098.105] (-1095.999) (-1096.768) (-1097.428) -- 0:00:38
      406000 -- (-1098.254) (-1094.679) (-1094.511) [-1095.453] * [-1097.087] (-1101.617) (-1095.639) (-1096.617) -- 0:00:38
      406500 -- (-1104.144) (-1096.110) (-1094.511) [-1094.964] * (-1095.359) [-1102.905] (-1095.643) (-1100.693) -- 0:00:37
      407000 -- (-1103.230) (-1096.599) (-1098.764) [-1094.501] * (-1097.832) (-1095.936) (-1096.696) [-1096.237] -- 0:00:37
      407500 -- (-1097.912) [-1098.231] (-1095.490) (-1094.362) * (-1096.830) (-1096.824) (-1097.725) [-1095.591] -- 0:00:37
      408000 -- [-1096.171] (-1096.523) (-1097.178) (-1096.394) * [-1094.535] (-1095.713) (-1095.920) (-1099.717) -- 0:00:37
      408500 -- (-1096.789) (-1097.026) (-1098.550) [-1099.861] * (-1096.074) [-1096.327] (-1098.377) (-1100.587) -- 0:00:37
      409000 -- (-1096.904) (-1097.972) (-1095.480) [-1102.632] * [-1097.000] (-1096.381) (-1097.107) (-1095.676) -- 0:00:37
      409500 -- (-1095.388) (-1097.644) (-1095.405) [-1096.707] * (-1096.386) (-1098.118) [-1095.048] (-1095.162) -- 0:00:37
      410000 -- (-1095.409) (-1099.513) (-1097.794) [-1095.927] * [-1097.189] (-1096.964) (-1095.993) (-1097.462) -- 0:00:37

      Average standard deviation of split frequencies: 0.012499

      410500 -- (-1097.424) [-1098.168] (-1096.578) (-1097.788) * (-1095.017) [-1098.223] (-1096.974) (-1094.755) -- 0:00:37
      411000 -- (-1097.743) [-1098.276] (-1096.789) (-1096.145) * (-1094.803) (-1094.709) (-1098.157) [-1098.575] -- 0:00:37
      411500 -- (-1096.607) [-1097.091] (-1097.769) (-1094.528) * (-1094.873) (-1098.902) (-1098.447) [-1094.666] -- 0:00:37
      412000 -- (-1098.038) (-1100.816) [-1094.804] (-1094.855) * (-1094.727) (-1098.784) (-1097.189) [-1096.225] -- 0:00:37
      412500 -- (-1101.657) (-1095.392) (-1094.935) [-1094.524] * (-1099.886) [-1095.969] (-1101.442) (-1099.279) -- 0:00:37
      413000 -- (-1097.150) (-1096.426) (-1094.935) [-1094.704] * [-1099.011] (-1095.458) (-1099.598) (-1098.497) -- 0:00:36
      413500 -- (-1096.987) (-1098.248) (-1097.919) [-1096.041] * (-1097.433) (-1096.395) [-1095.203] (-1096.414) -- 0:00:36
      414000 -- (-1097.031) (-1097.523) (-1098.017) [-1095.609] * (-1098.238) (-1095.740) (-1095.562) [-1097.667] -- 0:00:36
      414500 -- (-1097.347) [-1097.660] (-1095.757) (-1096.221) * [-1097.321] (-1097.096) (-1097.225) (-1098.949) -- 0:00:36
      415000 -- (-1096.209) (-1098.344) (-1095.713) [-1095.174] * (-1099.936) [-1098.189] (-1094.748) (-1095.117) -- 0:00:36

      Average standard deviation of split frequencies: 0.011465

      415500 -- [-1095.150] (-1096.630) (-1095.370) (-1094.660) * [-1096.547] (-1099.431) (-1094.748) (-1098.373) -- 0:00:36
      416000 -- (-1097.400) (-1102.236) (-1102.393) [-1096.366] * (-1097.400) (-1101.626) (-1096.644) [-1096.506] -- 0:00:36
      416500 -- (-1097.596) (-1101.130) (-1101.205) [-1097.775] * (-1095.448) [-1101.398] (-1096.318) (-1098.038) -- 0:00:36
      417000 -- [-1097.629] (-1096.500) (-1097.992) (-1097.765) * [-1096.604] (-1099.693) (-1095.962) (-1096.520) -- 0:00:36
      417500 -- (-1098.382) (-1096.590) (-1106.176) [-1096.628] * (-1097.786) (-1100.257) (-1098.151) [-1096.156] -- 0:00:37
      418000 -- (-1095.018) (-1096.329) [-1097.689] (-1098.516) * (-1096.580) (-1096.060) (-1101.775) [-1095.858] -- 0:00:37
      418500 -- [-1095.145] (-1097.478) (-1099.336) (-1098.975) * (-1095.878) [-1095.898] (-1098.611) (-1096.860) -- 0:00:37
      419000 -- (-1095.652) (-1096.957) (-1096.770) [-1097.096] * [-1097.437] (-1097.570) (-1098.718) (-1097.567) -- 0:00:37
      419500 -- (-1096.800) (-1095.215) (-1097.869) [-1096.770] * (-1101.082) (-1096.785) (-1097.955) [-1094.971] -- 0:00:37
      420000 -- [-1096.539] (-1096.291) (-1095.378) (-1095.039) * (-1096.675) [-1098.033] (-1097.255) (-1096.729) -- 0:00:37

      Average standard deviation of split frequencies: 0.011136

      420500 -- (-1097.238) (-1095.702) (-1095.284) [-1096.298] * (-1095.332) [-1094.816] (-1098.091) (-1094.830) -- 0:00:37
      421000 -- (-1096.190) (-1096.304) [-1095.648] (-1095.429) * (-1094.786) (-1097.048) [-1095.775] (-1097.563) -- 0:00:37
      421500 -- (-1095.079) (-1097.219) (-1097.119) [-1095.438] * (-1096.418) (-1097.455) (-1095.552) [-1097.180] -- 0:00:37
      422000 -- [-1095.090] (-1102.913) (-1098.521) (-1096.173) * (-1097.648) (-1102.411) [-1095.677] (-1095.346) -- 0:00:36
      422500 -- [-1094.965] (-1097.222) (-1095.245) (-1095.667) * [-1095.262] (-1099.106) (-1095.900) (-1097.752) -- 0:00:36
      423000 -- (-1097.639) (-1103.100) (-1096.049) [-1097.374] * (-1096.432) [-1095.926] (-1098.191) (-1096.165) -- 0:00:36
      423500 -- [-1096.351] (-1102.051) (-1095.155) (-1096.265) * (-1099.254) (-1095.663) [-1096.107] (-1096.324) -- 0:00:36
      424000 -- (-1098.122) (-1100.413) [-1096.689] (-1101.217) * (-1099.925) [-1095.790] (-1097.420) (-1096.448) -- 0:00:36
      424500 -- (-1097.503) (-1098.195) (-1100.158) [-1095.423] * (-1098.325) (-1098.784) (-1095.833) [-1096.141] -- 0:00:36
      425000 -- (-1097.710) (-1098.507) [-1101.173] (-1096.482) * [-1096.346] (-1096.193) (-1095.420) (-1096.149) -- 0:00:36

      Average standard deviation of split frequencies: 0.011326

      425500 -- (-1097.091) [-1096.710] (-1095.408) (-1096.407) * [-1097.256] (-1099.316) (-1095.016) (-1096.802) -- 0:00:36
      426000 -- (-1095.191) (-1096.140) [-1097.138] (-1097.084) * (-1099.236) [-1097.338] (-1099.710) (-1095.042) -- 0:00:36
      426500 -- [-1096.037] (-1096.268) (-1095.913) (-1097.522) * (-1095.901) (-1094.647) [-1095.848] (-1096.442) -- 0:00:36
      427000 -- (-1095.976) [-1098.765] (-1095.650) (-1095.707) * (-1099.659) (-1095.926) [-1097.057] (-1095.461) -- 0:00:36
      427500 -- (-1096.667) (-1097.371) [-1094.648] (-1095.266) * (-1096.106) [-1095.887] (-1095.299) (-1094.644) -- 0:00:36
      428000 -- (-1096.476) (-1097.325) (-1096.402) [-1095.549] * [-1096.064] (-1096.918) (-1095.831) (-1094.631) -- 0:00:36
      428500 -- [-1096.423] (-1097.240) (-1095.042) (-1095.618) * (-1097.192) (-1099.344) (-1097.419) [-1094.648] -- 0:00:36
      429000 -- (-1096.225) (-1100.365) [-1095.660] (-1097.146) * (-1100.959) [-1097.466] (-1095.591) (-1094.708) -- 0:00:35
      429500 -- (-1099.063) (-1099.693) (-1095.453) [-1098.842] * (-1100.043) (-1099.752) [-1096.536] (-1098.381) -- 0:00:35
      430000 -- (-1098.892) [-1095.483] (-1095.537) (-1098.863) * (-1100.579) (-1096.658) (-1095.379) [-1095.475] -- 0:00:35

      Average standard deviation of split frequencies: 0.011075

      430500 -- [-1096.046] (-1095.663) (-1095.627) (-1100.620) * (-1096.773) [-1095.662] (-1096.128) (-1099.645) -- 0:00:35
      431000 -- (-1096.518) [-1095.172] (-1097.495) (-1097.383) * (-1096.424) [-1098.310] (-1095.626) (-1102.275) -- 0:00:35
      431500 -- (-1094.919) (-1096.988) [-1096.642] (-1095.598) * [-1095.314] (-1098.195) (-1096.947) (-1101.220) -- 0:00:35
      432000 -- (-1098.775) (-1097.218) [-1096.049] (-1096.550) * (-1097.381) [-1095.673] (-1098.223) (-1095.997) -- 0:00:35
      432500 -- [-1096.354] (-1096.601) (-1098.075) (-1099.131) * (-1098.175) [-1096.022] (-1096.371) (-1095.774) -- 0:00:35
      433000 -- [-1094.475] (-1098.820) (-1097.349) (-1096.638) * (-1096.601) [-1095.915] (-1095.198) (-1095.754) -- 0:00:35
      433500 -- [-1095.733] (-1096.105) (-1102.584) (-1096.451) * (-1096.535) (-1097.471) [-1095.038] (-1096.622) -- 0:00:35
      434000 -- [-1095.946] (-1099.078) (-1097.875) (-1097.572) * (-1095.326) (-1098.485) (-1095.237) [-1096.559] -- 0:00:36
      434500 -- (-1096.195) (-1099.846) [-1095.363] (-1098.941) * (-1095.099) (-1097.950) [-1095.951] (-1098.484) -- 0:00:36
      435000 -- (-1096.305) (-1098.680) (-1096.299) [-1094.839] * (-1094.883) (-1095.803) (-1097.141) [-1099.042] -- 0:00:36

      Average standard deviation of split frequencies: 0.011639

      435500 -- [-1102.625] (-1098.908) (-1096.078) (-1095.426) * [-1095.723] (-1097.655) (-1096.372) (-1098.011) -- 0:00:36
      436000 -- (-1103.823) (-1097.091) [-1095.356] (-1094.860) * (-1094.703) (-1098.840) (-1097.310) [-1100.846] -- 0:00:36
      436500 -- (-1104.087) [-1097.732] (-1096.215) (-1095.301) * (-1097.395) [-1097.828] (-1097.257) (-1098.658) -- 0:00:36
      437000 -- (-1101.801) (-1097.019) [-1096.001] (-1097.031) * (-1098.563) (-1098.280) (-1097.406) [-1098.974] -- 0:00:36
      437500 -- (-1099.205) (-1096.551) [-1095.569] (-1098.025) * [-1097.314] (-1097.389) (-1096.304) (-1097.322) -- 0:00:36
      438000 -- [-1098.066] (-1100.273) (-1096.194) (-1099.397) * (-1099.498) [-1097.302] (-1096.576) (-1103.028) -- 0:00:35
      438500 -- (-1097.351) (-1101.480) [-1096.736] (-1096.958) * [-1098.395] (-1096.034) (-1095.218) (-1097.948) -- 0:00:35
      439000 -- [-1098.726] (-1098.106) (-1094.696) (-1096.053) * (-1098.793) (-1095.601) [-1095.237] (-1101.139) -- 0:00:35
      439500 -- (-1096.325) (-1097.732) [-1095.344] (-1097.039) * (-1100.744) (-1095.830) [-1100.941] (-1096.688) -- 0:00:35
      440000 -- (-1097.571) (-1096.364) (-1094.569) [-1096.980] * [-1101.231] (-1095.349) (-1098.553) (-1098.134) -- 0:00:35

      Average standard deviation of split frequencies: 0.011054

      440500 -- (-1101.296) (-1094.990) (-1097.346) [-1097.462] * (-1097.714) [-1095.593] (-1097.339) (-1098.478) -- 0:00:35
      441000 -- (-1097.871) [-1096.843] (-1096.752) (-1097.515) * [-1094.976] (-1095.285) (-1099.648) (-1096.954) -- 0:00:35
      441500 -- (-1096.673) (-1097.749) [-1097.496] (-1099.474) * (-1096.011) (-1095.870) [-1096.631] (-1099.182) -- 0:00:35
      442000 -- (-1095.300) [-1099.678] (-1097.380) (-1095.425) * (-1097.643) (-1096.474) [-1096.256] (-1097.222) -- 0:00:35
      442500 -- (-1095.658) (-1096.405) (-1101.182) [-1096.453] * (-1094.860) (-1095.152) [-1094.787] (-1098.095) -- 0:00:35
      443000 -- [-1094.538] (-1096.478) (-1101.368) (-1095.993) * (-1095.396) (-1095.044) [-1097.376] (-1095.873) -- 0:00:35
      443500 -- (-1097.406) (-1095.997) (-1100.929) [-1096.318] * (-1097.161) [-1097.783] (-1095.219) (-1102.923) -- 0:00:35
      444000 -- (-1095.091) [-1097.067] (-1096.416) (-1099.255) * [-1097.007] (-1096.955) (-1099.230) (-1097.642) -- 0:00:35
      444500 -- [-1096.779] (-1097.575) (-1097.481) (-1096.823) * (-1095.621) (-1099.784) (-1097.582) [-1099.147] -- 0:00:34
      445000 -- (-1095.934) (-1101.170) (-1095.316) [-1098.276] * (-1097.005) (-1098.589) [-1098.250] (-1096.743) -- 0:00:34

      Average standard deviation of split frequencies: 0.011957

      445500 -- [-1099.711] (-1104.394) (-1096.445) (-1098.159) * [-1095.604] (-1098.550) (-1099.372) (-1095.615) -- 0:00:34
      446000 -- (-1101.976) [-1098.023] (-1097.523) (-1096.934) * (-1097.503) [-1096.051] (-1096.119) (-1100.248) -- 0:00:34
      446500 -- (-1097.255) (-1098.092) (-1099.261) [-1096.591] * (-1102.764) (-1095.227) (-1098.888) [-1095.443] -- 0:00:34
      447000 -- (-1097.019) [-1097.286] (-1096.347) (-1095.421) * (-1100.812) (-1095.560) [-1096.827] (-1095.277) -- 0:00:34
      447500 -- (-1097.808) (-1097.782) [-1097.464] (-1096.456) * (-1098.382) (-1095.902) (-1096.191) [-1096.423] -- 0:00:34
      448000 -- (-1098.824) [-1098.663] (-1097.150) (-1097.561) * (-1098.443) [-1096.758] (-1097.471) (-1095.975) -- 0:00:34
      448500 -- [-1097.535] (-1103.377) (-1095.560) (-1097.175) * [-1095.980] (-1096.329) (-1095.655) (-1096.788) -- 0:00:34
      449000 -- [-1096.249] (-1099.018) (-1095.503) (-1094.823) * (-1095.012) [-1095.052] (-1098.147) (-1096.264) -- 0:00:34
      449500 -- [-1096.862] (-1101.483) (-1097.712) (-1094.988) * (-1099.342) (-1098.783) (-1095.750) [-1097.207] -- 0:00:34
      450000 -- (-1097.611) [-1096.476] (-1097.699) (-1094.987) * (-1097.340) (-1098.134) [-1097.830] (-1097.384) -- 0:00:34

      Average standard deviation of split frequencies: 0.011702

      450500 -- (-1094.491) (-1095.963) (-1096.558) [-1096.276] * (-1100.709) [-1097.984] (-1098.843) (-1097.188) -- 0:00:35
      451000 -- [-1094.733] (-1097.119) (-1095.317) (-1096.991) * (-1104.992) [-1095.643] (-1095.818) (-1097.192) -- 0:00:35
      451500 -- (-1099.687) (-1099.404) [-1094.800] (-1096.842) * (-1098.344) (-1095.743) (-1097.781) [-1095.943] -- 0:00:35
      452000 -- (-1099.189) (-1097.856) (-1099.003) [-1096.104] * [-1096.241] (-1096.260) (-1096.077) (-1096.499) -- 0:00:35
      452500 -- (-1098.390) [-1095.896] (-1094.874) (-1095.580) * [-1096.738] (-1095.139) (-1098.763) (-1097.203) -- 0:00:35
      453000 -- (-1097.163) (-1096.769) (-1095.277) [-1099.155] * (-1095.908) [-1096.044] (-1098.082) (-1095.821) -- 0:00:35
      453500 -- (-1096.503) (-1097.200) (-1102.090) [-1096.721] * [-1096.249] (-1098.002) (-1098.758) (-1097.308) -- 0:00:34
      454000 -- (-1096.207) (-1095.027) [-1097.830] (-1100.107) * (-1095.892) (-1096.738) (-1097.573) [-1095.897] -- 0:00:34
      454500 -- (-1096.008) (-1098.053) [-1098.344] (-1096.949) * [-1096.456] (-1097.057) (-1097.740) (-1096.681) -- 0:00:34
      455000 -- [-1095.292] (-1096.566) (-1095.728) (-1096.092) * (-1097.129) (-1101.497) [-1097.570] (-1095.670) -- 0:00:34

      Average standard deviation of split frequencies: 0.011441

      455500 -- (-1095.653) [-1097.682] (-1097.234) (-1096.273) * [-1097.217] (-1099.424) (-1095.731) (-1095.241) -- 0:00:34
      456000 -- [-1100.048] (-1096.531) (-1097.992) (-1097.040) * (-1097.535) [-1098.894] (-1096.547) (-1103.484) -- 0:00:34
      456500 -- [-1097.492] (-1095.354) (-1099.615) (-1095.119) * [-1096.116] (-1099.525) (-1096.700) (-1096.164) -- 0:00:34
      457000 -- (-1099.193) [-1096.345] (-1096.779) (-1097.695) * (-1097.692) (-1095.538) [-1097.699] (-1095.209) -- 0:00:34
      457500 -- (-1097.028) (-1096.215) [-1096.996] (-1097.921) * [-1097.915] (-1096.089) (-1095.212) (-1100.831) -- 0:00:34
      458000 -- (-1095.094) (-1096.528) [-1096.004] (-1097.315) * (-1099.070) [-1096.664] (-1095.334) (-1099.111) -- 0:00:34
      458500 -- (-1098.252) (-1097.006) [-1096.273] (-1095.859) * [-1099.344] (-1096.753) (-1095.651) (-1101.046) -- 0:00:34
      459000 -- [-1098.027] (-1097.386) (-1097.253) (-1097.032) * (-1097.390) (-1095.532) [-1095.343] (-1098.922) -- 0:00:34
      459500 -- (-1101.404) [-1097.138] (-1096.481) (-1099.832) * (-1096.445) [-1097.532] (-1095.518) (-1095.885) -- 0:00:34
      460000 -- (-1096.312) [-1095.262] (-1095.813) (-1096.676) * (-1098.494) [-1095.820] (-1099.713) (-1097.410) -- 0:00:34

      Average standard deviation of split frequencies: 0.011448

      460500 -- (-1096.487) [-1097.182] (-1095.654) (-1098.019) * (-1097.921) [-1094.520] (-1095.852) (-1099.043) -- 0:00:33
      461000 -- (-1095.897) (-1096.000) [-1096.524] (-1100.402) * (-1096.541) (-1095.576) [-1094.924] (-1099.144) -- 0:00:33
      461500 -- [-1096.818] (-1096.982) (-1095.561) (-1096.065) * (-1096.547) (-1098.605) (-1097.039) [-1096.634] -- 0:00:33
      462000 -- (-1096.977) (-1098.469) [-1096.123] (-1095.818) * [-1095.491] (-1096.119) (-1096.383) (-1096.180) -- 0:00:33
      462500 -- [-1099.535] (-1097.485) (-1097.161) (-1095.367) * (-1096.790) (-1095.308) [-1096.908] (-1095.799) -- 0:00:33
      463000 -- (-1098.998) [-1098.460] (-1098.034) (-1097.115) * [-1097.339] (-1096.340) (-1098.175) (-1095.279) -- 0:00:33
      463500 -- [-1097.430] (-1096.517) (-1097.367) (-1097.335) * [-1100.658] (-1096.759) (-1101.660) (-1099.130) -- 0:00:33
      464000 -- (-1096.732) (-1098.152) (-1097.000) [-1095.621] * (-1099.196) (-1098.535) [-1100.954] (-1100.758) -- 0:00:33
      464500 -- (-1096.099) (-1099.671) [-1097.376] (-1098.133) * (-1097.881) (-1097.387) [-1097.484] (-1100.961) -- 0:00:33
      465000 -- (-1096.064) (-1096.324) (-1095.731) [-1098.426] * (-1100.220) [-1097.924] (-1097.142) (-1098.121) -- 0:00:33

      Average standard deviation of split frequencies: 0.011697

      465500 -- (-1095.511) (-1096.241) (-1094.663) [-1101.102] * (-1097.265) [-1097.439] (-1098.281) (-1099.333) -- 0:00:33
      466000 -- (-1097.310) [-1095.148] (-1099.864) (-1096.345) * (-1097.409) [-1095.618] (-1096.122) (-1098.958) -- 0:00:34
      466500 -- (-1094.872) (-1098.827) [-1096.545] (-1100.002) * [-1097.463] (-1097.263) (-1095.700) (-1099.723) -- 0:00:34
      467000 -- (-1100.252) [-1099.465] (-1098.408) (-1101.725) * (-1096.831) (-1098.295) (-1098.472) [-1095.044] -- 0:00:34
      467500 -- (-1101.268) (-1099.818) [-1096.860] (-1095.418) * [-1096.473] (-1097.883) (-1096.883) (-1098.776) -- 0:00:34
      468000 -- (-1097.619) [-1097.674] (-1096.151) (-1095.836) * (-1100.020) (-1100.010) (-1096.492) [-1096.011] -- 0:00:34
      468500 -- [-1097.005] (-1097.473) (-1096.101) (-1094.722) * (-1094.814) (-1096.990) [-1095.979] (-1097.070) -- 0:00:34
      469000 -- [-1096.223] (-1095.769) (-1096.403) (-1094.873) * (-1099.637) (-1095.532) [-1098.339] (-1097.651) -- 0:00:33
      469500 -- [-1096.284] (-1095.882) (-1096.748) (-1095.652) * [-1097.835] (-1098.383) (-1099.372) (-1094.996) -- 0:00:33
      470000 -- (-1096.122) (-1100.943) [-1097.248] (-1095.978) * [-1094.995] (-1101.045) (-1099.457) (-1095.813) -- 0:00:33

      Average standard deviation of split frequencies: 0.010642

      470500 -- [-1096.160] (-1098.347) (-1096.650) (-1099.796) * (-1096.457) (-1100.408) (-1096.022) [-1097.047] -- 0:00:33
      471000 -- (-1099.053) (-1096.821) [-1098.115] (-1095.394) * [-1095.842] (-1095.408) (-1097.871) (-1096.953) -- 0:00:33
      471500 -- (-1097.412) (-1096.217) [-1097.181] (-1098.038) * (-1095.732) [-1102.259] (-1095.190) (-1098.932) -- 0:00:33
      472000 -- [-1095.414] (-1096.875) (-1095.085) (-1102.524) * (-1094.923) (-1097.945) [-1095.522] (-1098.832) -- 0:00:33
      472500 -- [-1097.166] (-1098.945) (-1095.701) (-1099.459) * [-1101.459] (-1097.161) (-1096.077) (-1097.114) -- 0:00:33
      473000 -- [-1095.725] (-1097.150) (-1096.297) (-1094.726) * [-1095.586] (-1097.343) (-1096.181) (-1098.011) -- 0:00:33
      473500 -- (-1096.223) [-1097.134] (-1097.079) (-1095.582) * [-1099.144] (-1098.441) (-1097.177) (-1096.201) -- 0:00:33
      474000 -- (-1096.402) [-1097.209] (-1097.984) (-1094.651) * (-1101.612) (-1097.068) [-1097.551] (-1096.143) -- 0:00:33
      474500 -- (-1098.259) (-1097.178) [-1096.354] (-1095.360) * [-1101.272] (-1098.188) (-1100.145) (-1095.050) -- 0:00:33
      475000 -- (-1098.714) [-1103.801] (-1098.201) (-1095.560) * [-1097.681] (-1097.039) (-1096.174) (-1099.600) -- 0:00:33

      Average standard deviation of split frequencies: 0.010522

      475500 -- [-1095.305] (-1094.678) (-1097.347) (-1098.892) * [-1095.852] (-1096.971) (-1096.785) (-1096.835) -- 0:00:33
      476000 -- (-1096.061) [-1097.425] (-1096.533) (-1097.989) * [-1095.623] (-1097.413) (-1098.734) (-1096.584) -- 0:00:33
      476500 -- (-1096.048) (-1095.073) (-1095.502) [-1095.362] * [-1096.113] (-1097.813) (-1096.818) (-1098.906) -- 0:00:32
      477000 -- (-1097.062) (-1099.135) (-1097.460) [-1096.505] * (-1096.773) (-1097.509) (-1097.531) [-1095.463] -- 0:00:32
      477500 -- (-1096.513) (-1098.897) (-1098.168) [-1099.169] * (-1097.547) (-1099.441) [-1096.947] (-1099.887) -- 0:00:32
      478000 -- (-1096.269) (-1096.891) (-1095.296) [-1097.264] * [-1095.128] (-1097.074) (-1095.553) (-1095.909) -- 0:00:32
      478500 -- (-1095.622) [-1095.583] (-1099.893) (-1100.805) * (-1099.905) (-1096.658) (-1097.103) [-1098.865] -- 0:00:32
      479000 -- (-1095.003) (-1094.924) (-1096.498) [-1098.289] * (-1097.562) [-1095.749] (-1095.535) (-1097.586) -- 0:00:32
      479500 -- (-1101.587) (-1097.193) (-1095.786) [-1097.844] * (-1096.681) [-1097.613] (-1096.425) (-1098.151) -- 0:00:32
      480000 -- (-1102.453) [-1099.400] (-1100.199) (-1099.799) * [-1095.780] (-1098.751) (-1097.367) (-1099.520) -- 0:00:32

      Average standard deviation of split frequencies: 0.010298

      480500 -- (-1101.788) (-1094.385) (-1106.128) [-1095.758] * (-1095.339) (-1100.173) (-1099.050) [-1096.401] -- 0:00:33
      481000 -- (-1100.420) (-1097.702) [-1098.483] (-1096.877) * [-1095.481] (-1096.002) (-1096.655) (-1097.526) -- 0:00:33
      481500 -- [-1099.136] (-1095.672) (-1098.446) (-1095.715) * (-1095.888) [-1095.822] (-1100.645) (-1098.767) -- 0:00:33
      482000 -- [-1096.604] (-1094.602) (-1095.779) (-1096.339) * (-1098.897) (-1098.637) [-1096.905] (-1098.457) -- 0:00:33
      482500 -- (-1095.048) (-1099.148) (-1099.083) [-1098.678] * (-1096.520) (-1098.300) (-1097.124) [-1096.451] -- 0:00:33
      483000 -- (-1097.381) (-1101.505) [-1097.357] (-1102.908) * (-1097.676) [-1097.035] (-1095.518) (-1098.745) -- 0:00:33
      483500 -- (-1096.110) (-1097.381) (-1097.329) [-1097.505] * (-1094.776) (-1098.091) [-1095.939] (-1095.186) -- 0:00:33
      484000 -- [-1095.540] (-1095.908) (-1097.147) (-1101.765) * (-1094.343) [-1095.731] (-1098.906) (-1096.670) -- 0:00:33
      484500 -- [-1096.626] (-1097.422) (-1096.862) (-1101.111) * [-1098.079] (-1096.544) (-1098.008) (-1096.709) -- 0:00:32
      485000 -- (-1096.624) (-1097.285) (-1095.664) [-1097.329] * (-1095.750) (-1094.865) [-1097.016] (-1095.231) -- 0:00:32

      Average standard deviation of split frequencies: 0.010152

      485500 -- (-1096.944) (-1097.347) [-1097.539] (-1098.570) * (-1097.462) [-1095.034] (-1098.129) (-1097.967) -- 0:00:32
      486000 -- (-1098.689) (-1096.694) [-1097.703] (-1098.402) * (-1096.178) [-1096.627] (-1097.460) (-1097.286) -- 0:00:32
      486500 -- [-1094.882] (-1096.230) (-1097.648) (-1097.072) * (-1096.503) (-1095.344) [-1099.175] (-1103.011) -- 0:00:32
      487000 -- (-1095.965) (-1096.693) (-1099.377) [-1095.818] * (-1098.704) (-1094.985) (-1097.682) [-1095.335] -- 0:00:32
      487500 -- (-1096.506) (-1100.213) (-1095.840) [-1097.823] * (-1097.459) [-1095.206] (-1100.445) (-1094.935) -- 0:00:32
      488000 -- (-1097.122) [-1096.879] (-1094.613) (-1099.575) * [-1095.885] (-1098.772) (-1106.742) (-1095.320) -- 0:00:32
      488500 -- (-1097.806) (-1094.707) [-1094.740] (-1098.055) * (-1097.303) [-1098.679] (-1100.881) (-1099.753) -- 0:00:32
      489000 -- [-1098.310] (-1095.065) (-1094.776) (-1099.133) * (-1096.083) (-1095.518) (-1096.366) [-1098.933] -- 0:00:32
      489500 -- [-1097.830] (-1097.332) (-1095.287) (-1095.998) * (-1096.664) [-1096.747] (-1100.139) (-1095.084) -- 0:00:32
      490000 -- (-1095.979) [-1097.200] (-1097.830) (-1096.491) * (-1095.807) (-1095.875) (-1095.353) [-1096.674] -- 0:00:32

      Average standard deviation of split frequencies: 0.009287

      490500 -- (-1096.163) [-1098.616] (-1097.899) (-1097.331) * (-1094.579) [-1099.143] (-1096.837) (-1096.619) -- 0:00:32
      491000 -- (-1096.502) [-1097.382] (-1098.398) (-1098.382) * (-1094.420) (-1095.736) [-1096.574] (-1097.028) -- 0:00:32
      491500 -- (-1098.050) (-1096.596) [-1097.401] (-1095.118) * (-1096.471) (-1096.345) [-1097.297] (-1096.278) -- 0:00:32
      492000 -- (-1095.629) (-1098.345) [-1097.785] (-1096.109) * [-1094.456] (-1096.678) (-1095.198) (-1095.165) -- 0:00:32
      492500 -- (-1102.023) (-1097.058) (-1096.494) [-1095.747] * [-1095.836] (-1095.806) (-1095.655) (-1095.418) -- 0:00:31
      493000 -- (-1098.350) (-1095.305) [-1096.423] (-1097.568) * (-1096.281) (-1095.893) (-1096.917) [-1097.102] -- 0:00:31
      493500 -- [-1096.895] (-1095.218) (-1095.620) (-1097.627) * (-1096.714) [-1097.209] (-1096.438) (-1097.296) -- 0:00:31
      494000 -- [-1097.254] (-1096.244) (-1096.678) (-1096.926) * (-1097.747) (-1098.735) [-1098.767] (-1095.425) -- 0:00:31
      494500 -- [-1095.721] (-1096.651) (-1096.661) (-1102.782) * (-1098.290) [-1095.925] (-1100.036) (-1095.747) -- 0:00:31
      495000 -- [-1095.979] (-1097.357) (-1100.259) (-1095.791) * [-1098.147] (-1098.693) (-1098.082) (-1099.080) -- 0:00:32

      Average standard deviation of split frequencies: 0.010098

      495500 -- (-1097.170) (-1099.848) [-1095.560] (-1095.872) * (-1097.235) [-1097.296] (-1098.139) (-1097.000) -- 0:00:32
      496000 -- (-1095.702) (-1099.242) (-1096.866) [-1095.075] * (-1098.272) [-1099.952] (-1094.578) (-1094.626) -- 0:00:32
      496500 -- (-1094.539) [-1095.541] (-1098.805) (-1096.163) * (-1096.062) (-1099.322) (-1094.910) [-1095.887] -- 0:00:32
      497000 -- (-1094.536) (-1096.647) [-1096.027] (-1098.250) * [-1095.875] (-1100.153) (-1095.496) (-1096.069) -- 0:00:32
      497500 -- (-1094.723) (-1098.382) [-1094.977] (-1097.476) * [-1096.530] (-1096.661) (-1095.296) (-1095.029) -- 0:00:32
      498000 -- (-1098.656) [-1095.600] (-1094.848) (-1097.851) * [-1096.546] (-1095.014) (-1098.567) (-1100.218) -- 0:00:32
      498500 -- (-1098.649) [-1096.492] (-1096.014) (-1098.334) * [-1094.719] (-1095.484) (-1097.361) (-1096.947) -- 0:00:32
      499000 -- (-1096.863) (-1096.492) (-1101.697) [-1096.570] * [-1097.720] (-1096.212) (-1095.792) (-1096.711) -- 0:00:32
      499500 -- (-1097.125) [-1096.273] (-1100.088) (-1095.757) * [-1096.487] (-1097.027) (-1095.860) (-1096.010) -- 0:00:32
      500000 -- (-1099.015) (-1095.715) (-1100.413) [-1095.836] * (-1100.786) (-1095.255) (-1096.135) [-1098.054] -- 0:00:32

      Average standard deviation of split frequencies: 0.009416

      500500 -- [-1097.920] (-1096.536) (-1098.234) (-1095.987) * (-1095.215) (-1094.795) [-1095.758] (-1098.415) -- 0:00:31
      501000 -- (-1096.964) [-1096.480] (-1096.254) (-1095.704) * (-1095.596) (-1096.290) (-1095.793) [-1097.727] -- 0:00:31