--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:44:06 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/trxB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -539.37 -543.38
2 -539.37 -543.07
--------------------------------------
TOTAL -539.37 -543.24
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894584 0.091191 0.348881 1.486362 0.856159 1501.00 1501.00 1.000
r(A<->C){all} 0.166035 0.019279 0.000056 0.448688 0.134071 337.56 358.82 1.005
r(A<->G){all} 0.165238 0.021269 0.000010 0.465043 0.122750 177.69 206.06 1.000
r(A<->T){all} 0.165159 0.019206 0.000066 0.449068 0.128394 121.92 172.44 1.002
r(C<->G){all} 0.162675 0.020394 0.000117 0.457370 0.120537 78.44 87.36 1.000
r(C<->T){all} 0.173331 0.022342 0.000076 0.473259 0.130754 242.29 245.46 1.000
r(G<->T){all} 0.167561 0.019319 0.000065 0.456349 0.129856 213.78 234.94 1.000
pi(A){all} 0.225661 0.000436 0.183494 0.266444 0.224755 1239.35 1346.76 1.001
pi(C){all} 0.253526 0.000493 0.208006 0.295116 0.253253 966.07 1133.60 1.000
pi(G){all} 0.299722 0.000513 0.256436 0.343357 0.299581 1171.60 1233.01 1.001
pi(T){all} 0.221091 0.000413 0.183818 0.263757 0.220078 1134.13 1317.57 1.000
alpha{1,2} 0.418170 0.222718 0.000134 1.395940 0.254997 991.51 1246.26 1.000
alpha{3} 0.447122 0.222128 0.000290 1.370687 0.306475 1501.00 1501.00 1.000
pinvar{all} 0.995801 0.000024 0.986348 0.999998 0.997394 1248.14 1333.49 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -518.213573
Model 2: PositiveSelection -518.213734
Model 0: one-ratio -518.213573
Model 7: beta -518.213573
Model 8: beta&w>1 -518.213573
Model 0 vs 1 0.0
Model 2 vs 1 3.2200000009652285E-4
Model 8 vs 7 0.0
>C1
MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
>C2
MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
>C3
MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
>C4
MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
>C5
MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
>C6
MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=130
C1 MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
C2 MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
C3 MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
C4 MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
C5 MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
C6 MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
**************************************************
C1 FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
C2 FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
C3 FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
C4 FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
C5 FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
C6 FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
**************************************************
C1 DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
C2 DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
C3 DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
C4 DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
C5 DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
C6 DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
******************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3900]--->[3900]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.462 Mb, Max= 30.660 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
C2 MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
C3 MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
C4 MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
C5 MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
C6 MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
**************************************************
C1 FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
C2 FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
C3 FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
C4 FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
C5 FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
C6 FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
**************************************************
C1 DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
C2 DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
C3 DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
C4 DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
C5 DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
C6 DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
******************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT
C2 ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT
C3 ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT
C4 ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT
C5 ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT
C6 ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT
**************************************************
C1 TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG
C2 TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG
C3 TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG
C4 TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG
C5 TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG
C6 TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG
**************************************************
C1 TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG
C2 TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG
C3 TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG
C4 TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG
C5 TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG
C6 TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG
**************************************************
C1 TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA
C2 TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA
C3 TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA
C4 TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA
C5 TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA
C6 TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA
**************************************************
C1 CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC
C2 CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC
C3 CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC
C4 CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC
C5 CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC
C6 CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC
**************************************************
C1 CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG
C2 CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG
C3 CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG
C4 CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG
C5 CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG
C6 CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG
**************************************************
C1 GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT
C2 GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT
C3 GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT
C4 GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT
C5 GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT
C6 GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT
**************************************************
C1 CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC
C2 CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC
C3 CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC
C4 CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC
C5 CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC
C6 CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC
****************************************
>C1
ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT
TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG
TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG
TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA
CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC
CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG
GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT
CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC
>C2
ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT
TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG
TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG
TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA
CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC
CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG
GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT
CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC
>C3
ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT
TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG
TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG
TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA
CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC
CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG
GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT
CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC
>C4
ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT
TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG
TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG
TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA
CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC
CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG
GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT
CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC
>C5
ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT
TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG
TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG
TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA
CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC
CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG
GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT
CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC
>C6
ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT
TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG
TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG
TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA
CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC
CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG
GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT
CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC
>C1
MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
>C2
MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
>C3
MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
>C4
MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
>C5
MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
>C6
MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 390 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579790574
Setting output file names to "/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 164527930
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0861762785
Seed = 944376866
Swapseed = 1579790574
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -872.838646 -- -24.965149
Chain 2 -- -872.838563 -- -24.965149
Chain 3 -- -872.838646 -- -24.965149
Chain 4 -- -872.838646 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -872.838646 -- -24.965149
Chain 2 -- -872.838696 -- -24.965149
Chain 3 -- -872.838696 -- -24.965149
Chain 4 -- -872.838646 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-872.839] (-872.839) (-872.839) (-872.839) * [-872.839] (-872.839) (-872.839) (-872.839)
500 -- (-548.162) [-546.686] (-549.820) (-547.192) * (-549.716) [-549.568] (-547.068) (-549.496) -- 0:00:00
1000 -- (-546.332) (-554.122) [-545.864] (-549.255) * (-546.195) (-550.600) (-549.033) [-551.236] -- 0:00:00
1500 -- [-546.089] (-549.850) (-553.915) (-543.884) * (-544.974) [-546.228] (-547.273) (-548.276) -- 0:00:00
2000 -- (-546.965) (-552.769) (-546.932) [-548.310] * (-547.520) [-545.797] (-553.219) (-549.097) -- 0:00:00
2500 -- (-549.441) (-554.193) [-545.740] (-552.012) * (-548.330) (-548.012) (-554.284) [-546.989] -- 0:00:00
3000 -- (-547.342) [-545.705] (-551.295) (-552.658) * (-546.532) [-549.839] (-549.291) (-550.997) -- 0:00:00
3500 -- [-551.259] (-543.929) (-545.480) (-550.221) * (-547.147) [-548.212] (-548.125) (-550.767) -- 0:00:00
4000 -- (-543.974) [-552.420] (-547.114) (-558.594) * [-557.102] (-550.964) (-552.591) (-558.391) -- 0:00:00
4500 -- (-549.011) (-547.588) (-550.093) [-549.687] * (-550.963) [-546.199] (-548.880) (-549.053) -- 0:00:00
5000 -- (-550.729) (-549.166) (-551.197) [-545.145] * (-545.766) [-542.744] (-560.482) (-547.235) -- 0:00:00
Average standard deviation of split frequencies: 0.104757
5500 -- (-555.917) (-548.546) [-548.808] (-553.471) * (-552.769) [-548.551] (-554.985) (-549.501) -- 0:00:00
6000 -- (-548.030) (-546.040) (-547.783) [-551.775] * [-546.824] (-547.192) (-544.656) (-545.263) -- 0:00:00
6500 -- (-554.539) (-549.346) (-547.732) [-548.196] * (-549.281) (-549.914) (-541.421) [-548.988] -- 0:00:00
7000 -- (-553.947) (-548.943) (-554.975) [-548.809] * [-547.349] (-549.120) (-540.303) (-549.451) -- 0:00:00
7500 -- (-550.798) [-551.353] (-550.274) (-552.541) * (-549.638) [-555.288] (-538.045) (-549.347) -- 0:00:00
8000 -- (-548.652) (-553.428) [-544.336] (-543.817) * (-545.722) [-548.212] (-539.217) (-554.405) -- 0:00:00
8500 -- [-550.175] (-557.188) (-549.062) (-549.212) * [-549.724] (-555.569) (-540.920) (-561.315) -- 0:00:00
9000 -- (-547.199) (-547.229) [-550.331] (-557.091) * (-551.404) (-550.285) [-540.465] (-555.408) -- 0:00:00
9500 -- (-547.025) (-551.426) [-550.485] (-547.281) * (-552.502) (-547.855) (-540.724) [-543.071] -- 0:00:00
10000 -- (-552.012) (-545.931) (-557.991) [-554.144] * (-549.505) (-548.727) (-540.693) [-553.191] -- 0:00:00
Average standard deviation of split frequencies: 0.076335
10500 -- (-556.361) (-551.324) (-550.705) [-551.964] * [-548.848] (-544.625) (-541.211) (-544.666) -- 0:00:00
11000 -- [-545.422] (-548.964) (-548.532) (-556.943) * (-551.896) [-547.448] (-540.826) (-554.537) -- 0:00:00
11500 -- [-547.572] (-551.387) (-546.550) (-552.358) * (-554.724) [-548.644] (-539.760) (-554.214) -- 0:00:00
12000 -- (-553.989) (-558.163) [-553.579] (-540.769) * (-546.624) [-546.572] (-539.118) (-563.842) -- 0:00:00
12500 -- (-550.513) [-555.219] (-546.569) (-539.320) * (-550.679) (-546.206) [-540.593] (-551.714) -- 0:00:00
13000 -- (-557.052) (-547.705) [-549.329] (-540.215) * (-557.040) (-550.380) [-540.434] (-558.375) -- 0:00:00
13500 -- (-554.482) (-549.210) [-551.695] (-541.093) * (-547.375) (-548.725) [-539.024] (-557.631) -- 0:00:00
14000 -- (-556.280) [-552.673] (-549.000) (-543.159) * (-546.470) (-547.881) [-546.927] (-553.650) -- 0:01:10
14500 -- (-553.814) (-542.473) (-549.776) [-538.225] * (-545.644) (-549.043) [-540.184] (-555.102) -- 0:01:07
15000 -- (-547.936) [-551.586] (-546.788) (-539.541) * [-547.472] (-545.670) (-538.173) (-542.264) -- 0:01:05
Average standard deviation of split frequencies: 0.051993
15500 -- (-546.455) (-552.974) (-551.043) [-539.731] * [-557.219] (-545.063) (-545.920) (-540.601) -- 0:01:03
16000 -- (-541.021) (-551.931) [-547.657] (-539.228) * (-552.112) (-544.966) (-540.688) [-538.921] -- 0:01:01
16500 -- (-543.921) (-546.602) (-545.998) [-542.206] * (-546.439) [-549.615] (-539.515) (-539.813) -- 0:00:59
17000 -- [-540.346] (-549.670) (-552.882) (-543.321) * [-545.907] (-549.191) (-539.111) (-540.292) -- 0:00:57
17500 -- [-538.820] (-546.861) (-545.944) (-540.852) * (-548.132) [-543.095] (-540.947) (-540.450) -- 0:00:56
18000 -- (-539.788) (-554.182) (-554.620) [-539.338] * (-550.672) [-548.385] (-538.286) (-543.547) -- 0:00:54
18500 -- (-542.239) [-554.977] (-551.691) (-539.114) * (-550.492) [-546.500] (-538.404) (-538.228) -- 0:00:53
19000 -- (-539.082) (-549.702) (-555.472) [-539.076] * [-546.405] (-557.178) (-542.124) (-540.886) -- 0:00:51
19500 -- [-539.846] (-545.048) (-547.545) (-540.182) * (-548.635) (-544.702) [-540.987] (-542.350) -- 0:00:50
20000 -- [-538.609] (-548.568) (-549.291) (-539.127) * (-551.526) (-574.634) [-539.780] (-540.029) -- 0:00:49
Average standard deviation of split frequencies: 0.047140
20500 -- (-541.384) [-545.212] (-563.123) (-538.669) * (-550.205) (-540.927) (-539.210) [-539.561] -- 0:00:47
21000 -- [-541.008] (-554.030) (-548.430) (-538.430) * [-550.344] (-542.113) (-540.224) (-538.802) -- 0:00:46
21500 -- (-537.994) [-549.688] (-543.491) (-543.264) * (-553.525) (-540.568) [-538.672] (-544.869) -- 0:00:45
22000 -- (-543.303) [-546.032] (-541.349) (-540.858) * [-553.439] (-540.147) (-538.078) (-540.023) -- 0:00:44
22500 -- (-539.590) [-549.478] (-540.676) (-540.359) * (-554.667) [-543.742] (-539.674) (-539.607) -- 0:00:43
23000 -- [-539.230] (-546.715) (-540.479) (-540.388) * [-542.715] (-539.453) (-541.444) (-539.097) -- 0:00:42
23500 -- (-538.907) [-547.353] (-538.052) (-539.589) * (-546.713) (-540.680) [-539.077] (-538.366) -- 0:00:41
24000 -- (-539.779) (-552.022) (-539.410) [-538.346] * (-557.302) [-540.944] (-538.964) (-538.918) -- 0:00:40
24500 -- (-540.297) (-552.003) [-539.121] (-540.196) * [-551.386] (-540.441) (-543.188) (-539.244) -- 0:00:39
25000 -- (-538.386) (-551.607) [-540.788] (-539.666) * (-548.225) [-542.583] (-541.726) (-544.076) -- 0:00:39
Average standard deviation of split frequencies: 0.037086
25500 -- (-540.450) [-551.646] (-539.591) (-542.161) * [-548.637] (-541.557) (-541.475) (-541.777) -- 0:00:38
26000 -- (-539.183) (-552.540) [-540.414] (-540.429) * (-552.866) (-539.267) [-539.261] (-541.154) -- 0:00:37
26500 -- (-539.303) [-547.716] (-539.534) (-542.200) * (-548.223) (-538.457) (-539.396) [-539.485] -- 0:00:36
27000 -- (-541.038) (-548.789) (-538.510) [-541.552] * (-547.214) (-541.274) (-541.631) [-538.679] -- 0:00:36
27500 -- (-543.722) (-554.116) [-538.591] (-539.067) * (-550.746) (-540.640) [-539.496] (-538.733) -- 0:00:35
28000 -- (-543.482) (-555.932) [-540.292] (-538.296) * (-551.133) (-539.331) [-538.944] (-539.282) -- 0:00:34
28500 -- (-538.898) (-552.435) (-539.613) [-538.773] * (-552.240) [-538.170] (-542.653) (-540.732) -- 0:00:34
29000 -- (-538.607) (-550.390) (-538.799) [-542.929] * (-556.704) (-539.561) (-539.890) [-540.683] -- 0:00:33
29500 -- (-539.917) [-546.557] (-541.301) (-539.704) * (-545.746) (-538.871) (-539.991) [-539.894] -- 0:01:05
30000 -- [-538.676] (-553.119) (-539.924) (-542.813) * (-551.444) (-538.738) (-538.865) [-539.768] -- 0:01:04
Average standard deviation of split frequencies: 0.032281
30500 -- (-542.387) [-545.905] (-538.283) (-539.729) * [-551.083] (-539.873) (-539.021) (-540.430) -- 0:01:03
31000 -- (-539.397) [-552.706] (-541.624) (-546.199) * (-544.472) (-539.601) (-541.070) [-544.452] -- 0:01:02
31500 -- (-540.443) (-553.168) (-541.419) [-541.907] * (-549.588) [-538.758] (-542.582) (-539.625) -- 0:01:01
32000 -- (-538.275) [-557.025] (-541.565) (-538.421) * (-548.254) (-541.027) [-541.557] (-539.158) -- 0:01:00
32500 -- (-539.269) (-561.330) [-538.927] (-539.784) * (-554.422) (-543.570) [-539.294] (-539.092) -- 0:00:59
33000 -- [-539.105] (-542.023) (-539.309) (-538.813) * [-543.394] (-543.125) (-540.194) (-539.949) -- 0:00:58
33500 -- (-538.921) (-538.754) (-538.325) [-539.556] * (-555.268) (-542.498) [-540.516] (-538.596) -- 0:00:57
34000 -- (-539.434) (-540.864) (-542.963) [-539.045] * (-548.387) (-541.511) [-541.139] (-543.500) -- 0:00:56
34500 -- (-540.555) (-539.976) (-543.017) [-540.089] * (-551.957) [-539.348] (-540.714) (-539.387) -- 0:00:55
35000 -- (-539.184) [-539.005] (-542.404) (-546.119) * (-549.375) (-539.362) [-540.342] (-543.114) -- 0:00:55
Average standard deviation of split frequencies: 0.033081
35500 -- (-538.336) (-540.749) [-539.903] (-545.032) * [-550.075] (-540.520) (-538.648) (-539.502) -- 0:00:54
36000 -- [-539.033] (-539.608) (-539.752) (-542.474) * (-551.953) (-542.757) [-538.731] (-538.615) -- 0:00:53
36500 -- (-540.107) (-539.257) [-540.218] (-540.632) * (-553.774) (-542.479) (-543.000) [-538.609] -- 0:00:52
37000 -- [-538.939] (-539.276) (-539.096) (-539.876) * [-540.744] (-538.725) (-543.065) (-539.073) -- 0:00:52
37500 -- (-539.653) (-539.207) (-538.156) [-538.429] * (-538.224) (-538.194) (-539.296) [-539.000] -- 0:00:51
38000 -- (-539.621) (-539.101) [-538.690] (-542.771) * (-540.497) (-539.021) (-540.784) [-538.689] -- 0:00:50
38500 -- (-544.043) (-538.259) (-538.939) [-541.989] * (-541.187) (-538.256) [-539.402] (-538.434) -- 0:00:49
39000 -- (-541.057) (-541.541) [-538.192] (-537.776) * (-540.262) [-539.056] (-540.046) (-538.694) -- 0:00:49
39500 -- [-540.214] (-540.063) (-539.080) (-541.383) * (-546.525) (-542.883) (-541.895) [-539.439] -- 0:00:48
40000 -- [-540.067] (-539.255) (-538.590) (-543.588) * (-539.681) [-542.981] (-541.934) (-540.485) -- 0:00:48
Average standard deviation of split frequencies: 0.034776
40500 -- [-539.291] (-538.863) (-539.670) (-538.946) * [-539.942] (-544.178) (-539.164) (-540.667) -- 0:00:47
41000 -- (-541.125) [-538.229] (-543.181) (-539.705) * (-541.510) (-547.345) (-539.887) [-539.353] -- 0:00:46
41500 -- [-539.785] (-538.462) (-538.728) (-538.501) * (-538.555) (-543.207) (-540.577) [-541.927] -- 0:00:46
42000 -- (-538.050) (-538.441) (-541.771) [-539.865] * (-540.923) (-544.425) [-540.484] (-543.090) -- 0:00:45
42500 -- [-538.993] (-540.961) (-544.417) (-542.211) * (-543.466) [-543.196] (-540.273) (-541.775) -- 0:00:45
43000 -- (-539.292) [-539.756] (-543.677) (-539.509) * [-542.700] (-538.922) (-542.014) (-539.781) -- 0:00:44
43500 -- (-542.926) (-538.199) (-539.856) [-538.518] * (-540.740) [-539.743] (-538.218) (-539.395) -- 0:00:43
44000 -- (-540.046) [-538.247] (-539.727) (-540.072) * (-542.429) (-541.740) (-538.655) [-541.434] -- 0:00:43
44500 -- [-538.279] (-538.300) (-538.922) (-538.937) * (-539.117) (-542.753) [-539.063] (-543.266) -- 0:00:42
45000 -- (-538.506) (-538.557) [-538.172] (-539.005) * (-539.065) (-539.300) (-538.377) [-538.612] -- 0:00:42
Average standard deviation of split frequencies: 0.031720
45500 -- (-543.577) [-539.430] (-539.744) (-540.791) * (-541.275) [-537.941] (-539.371) (-539.012) -- 0:00:41
46000 -- (-540.235) [-538.565] (-540.717) (-539.785) * (-538.955) [-538.602] (-538.051) (-540.000) -- 0:01:02
46500 -- (-542.417) [-539.370] (-541.764) (-542.893) * (-539.643) (-538.825) [-538.572] (-539.836) -- 0:01:01
47000 -- (-543.507) (-539.079) (-543.199) [-538.274] * (-543.911) [-538.623] (-538.319) (-539.378) -- 0:01:00
47500 -- (-541.732) (-538.859) (-542.972) [-538.965] * [-538.592] (-538.120) (-540.535) (-540.848) -- 0:01:00
48000 -- (-538.718) (-537.895) (-539.544) [-539.354] * (-539.793) [-538.119] (-538.463) (-542.957) -- 0:00:59
48500 -- (-540.401) (-539.087) [-540.871] (-541.617) * (-539.684) (-538.358) (-539.493) [-543.061] -- 0:00:58
49000 -- (-546.298) [-539.233] (-541.018) (-539.439) * (-539.755) (-539.905) [-538.814] (-538.135) -- 0:00:58
49500 -- (-546.134) [-538.991] (-539.343) (-539.736) * (-539.771) [-541.822] (-541.412) (-538.856) -- 0:00:57
50000 -- (-541.148) (-540.972) [-540.020] (-540.421) * [-538.541] (-543.481) (-542.589) (-538.563) -- 0:00:57
Average standard deviation of split frequencies: 0.030570
50500 -- (-539.605) [-537.863] (-544.258) (-539.239) * [-540.056] (-539.470) (-538.383) (-538.850) -- 0:00:56
51000 -- (-540.595) (-539.110) (-541.016) [-541.210] * [-540.119] (-538.713) (-539.186) (-538.539) -- 0:00:55
51500 -- [-540.333] (-538.034) (-539.216) (-542.634) * (-539.859) (-540.100) [-543.934] (-537.748) -- 0:00:55
52000 -- [-539.001] (-540.800) (-537.741) (-539.681) * (-538.806) [-539.881] (-542.099) (-538.233) -- 0:00:54
52500 -- (-539.008) [-539.199] (-539.118) (-539.053) * (-538.406) (-539.549) (-539.745) [-541.838] -- 0:00:54
53000 -- (-539.685) [-538.774] (-539.079) (-539.558) * (-539.639) (-543.414) (-539.244) [-539.003] -- 0:00:53
53500 -- [-542.273] (-544.936) (-539.960) (-538.495) * (-540.399) (-541.746) [-539.149] (-539.075) -- 0:00:53
54000 -- (-540.341) [-539.623] (-539.981) (-540.974) * (-542.392) (-542.294) [-539.371] (-540.889) -- 0:00:52
54500 -- (-541.680) [-541.665] (-544.358) (-541.759) * [-538.420] (-544.457) (-539.833) (-539.147) -- 0:00:52
55000 -- (-540.196) (-541.356) (-541.335) [-547.612] * (-538.872) [-544.760] (-539.370) (-540.572) -- 0:00:51
Average standard deviation of split frequencies: 0.029042
55500 -- (-543.260) [-539.846] (-542.446) (-541.201) * (-542.324) [-543.629] (-546.212) (-540.968) -- 0:00:51
56000 -- (-539.835) (-540.081) (-544.010) [-540.558] * (-541.569) (-539.485) [-539.389] (-539.388) -- 0:00:50
56500 -- (-538.872) [-540.291] (-541.798) (-541.627) * (-542.061) (-538.047) (-539.764) [-539.416] -- 0:00:50
57000 -- (-539.142) (-539.209) [-538.079] (-539.102) * (-540.672) [-537.989] (-540.160) (-540.385) -- 0:00:49
57500 -- (-538.773) [-538.728] (-542.054) (-541.020) * (-542.945) [-539.116] (-540.661) (-539.568) -- 0:00:49
58000 -- (-538.932) (-540.367) [-540.215] (-540.215) * (-540.164) [-539.351] (-541.884) (-544.435) -- 0:00:48
58500 -- (-538.492) (-539.473) [-539.121] (-543.227) * (-538.384) (-539.954) [-540.187] (-542.109) -- 0:00:48
59000 -- (-543.763) (-542.058) [-542.654] (-542.548) * [-539.376] (-542.574) (-540.117) (-541.625) -- 0:00:47
59500 -- (-541.865) (-537.944) [-540.872] (-548.494) * [-537.924] (-539.377) (-540.869) (-540.381) -- 0:00:47
60000 -- (-539.292) [-540.355] (-537.986) (-548.865) * (-537.816) (-539.238) [-538.113] (-540.147) -- 0:00:47
Average standard deviation of split frequencies: 0.026808
60500 -- [-541.634] (-544.194) (-538.923) (-543.405) * (-539.469) [-539.252] (-539.213) (-539.016) -- 0:00:46
61000 -- (-542.616) (-539.301) (-542.302) [-539.099] * (-543.444) [-538.957] (-538.901) (-539.896) -- 0:00:46
61500 -- (-541.022) (-538.926) (-539.419) [-538.994] * [-541.088] (-540.749) (-540.728) (-538.337) -- 0:00:45
62000 -- (-541.846) (-539.330) [-538.807] (-540.577) * (-541.978) (-539.096) [-539.525] (-541.672) -- 0:00:45
62500 -- (-538.538) (-539.425) (-539.887) [-538.800] * (-542.248) (-541.518) (-540.962) [-538.813] -- 0:01:00
63000 -- (-539.805) (-538.619) (-538.037) [-538.445] * (-542.787) [-543.347] (-539.623) (-538.337) -- 0:00:59
63500 -- (-541.886) (-539.571) [-538.125] (-538.979) * (-540.851) [-539.983] (-539.422) (-539.370) -- 0:00:58
64000 -- (-540.336) (-539.218) [-541.067] (-539.824) * (-540.217) (-539.228) (-539.074) [-539.910] -- 0:00:58
64500 -- (-539.149) (-539.921) [-539.494] (-539.784) * (-541.904) (-539.961) [-538.241] (-538.504) -- 0:00:58
65000 -- (-538.492) (-540.508) [-540.281] (-539.680) * (-539.976) [-538.185] (-538.328) (-538.271) -- 0:00:57
Average standard deviation of split frequencies: 0.025849
65500 -- (-538.949) (-539.435) (-538.952) [-540.010] * [-538.595] (-538.049) (-540.795) (-539.126) -- 0:00:57
66000 -- [-538.536] (-541.983) (-538.090) (-541.919) * (-541.005) [-540.446] (-542.188) (-538.985) -- 0:00:56
66500 -- (-537.907) (-539.070) (-540.437) [-539.103] * [-542.139] (-538.817) (-539.508) (-539.525) -- 0:00:56
67000 -- (-538.617) (-539.083) [-542.655] (-544.549) * (-544.214) (-540.640) [-539.255] (-539.448) -- 0:00:55
67500 -- (-542.618) [-540.401] (-545.001) (-541.364) * [-538.377] (-540.827) (-539.010) (-540.005) -- 0:00:55
68000 -- (-541.329) (-537.960) [-540.581] (-539.802) * (-539.938) (-538.402) (-538.759) [-538.378] -- 0:00:54
68500 -- (-542.481) (-541.628) (-541.234) [-540.243] * (-541.192) [-539.945] (-539.319) (-539.724) -- 0:00:54
69000 -- [-541.302] (-540.379) (-540.472) (-538.284) * (-538.094) [-539.802] (-544.370) (-539.361) -- 0:00:53
69500 -- (-540.710) (-538.920) (-538.899) [-542.810] * (-540.596) [-538.671] (-538.867) (-538.371) -- 0:00:53
70000 -- [-539.517] (-541.215) (-543.608) (-540.709) * (-538.586) (-543.723) [-539.017] (-539.152) -- 0:00:53
Average standard deviation of split frequencies: 0.025413
70500 -- (-540.126) (-539.950) (-540.520) [-540.986] * (-542.211) (-543.844) (-538.650) [-539.306] -- 0:00:52
71000 -- (-542.648) [-539.958] (-540.819) (-539.248) * (-540.062) (-540.636) [-538.478] (-538.541) -- 0:00:52
71500 -- (-539.489) (-538.331) (-540.332) [-540.479] * (-542.168) [-542.540] (-538.559) (-538.552) -- 0:00:51
72000 -- (-538.538) (-541.766) [-540.009] (-538.647) * (-541.363) (-544.219) [-541.351] (-545.045) -- 0:00:51
72500 -- (-542.793) (-542.404) [-540.633] (-539.300) * [-541.953] (-539.163) (-539.407) (-540.765) -- 0:00:51
73000 -- (-541.637) (-539.332) (-538.712) [-538.875] * (-540.329) (-540.616) [-538.898] (-540.509) -- 0:00:50
73500 -- (-539.573) [-538.396] (-542.346) (-542.619) * (-540.346) (-540.223) [-538.747] (-540.032) -- 0:00:50
74000 -- [-540.429] (-540.135) (-542.407) (-540.406) * [-539.882] (-540.512) (-538.158) (-539.862) -- 0:00:50
74500 -- (-542.294) (-541.255) (-540.908) [-542.258] * [-540.599] (-543.189) (-540.286) (-538.645) -- 0:00:49
75000 -- (-540.494) [-540.711] (-538.391) (-540.665) * (-538.519) (-539.208) (-540.335) [-539.516] -- 0:00:49
Average standard deviation of split frequencies: 0.025106
75500 -- (-539.375) (-538.959) (-539.193) [-537.716] * (-538.764) (-539.184) [-539.275] (-541.151) -- 0:00:48
76000 -- (-539.555) [-539.510] (-539.870) (-540.335) * (-539.290) (-541.278) [-544.084] (-541.093) -- 0:00:48
76500 -- [-538.433] (-540.768) (-541.274) (-542.288) * [-538.373] (-539.365) (-539.062) (-539.842) -- 0:00:48
77000 -- (-538.602) (-539.479) [-538.360] (-544.724) * (-540.109) (-540.050) [-540.625] (-539.692) -- 0:00:47
77500 -- (-539.376) (-539.381) [-539.520] (-539.299) * (-546.159) [-539.232] (-539.430) (-539.535) -- 0:00:47
78000 -- (-544.535) (-538.722) (-538.662) [-538.227] * (-539.667) (-539.788) (-538.792) [-542.855] -- 0:00:47
78500 -- (-543.011) (-539.733) (-541.019) [-538.744] * [-537.820] (-539.584) (-540.993) (-542.884) -- 0:00:46
79000 -- (-542.013) (-540.768) [-540.651] (-544.150) * (-540.078) (-540.263) (-543.576) [-538.501] -- 0:00:46
79500 -- (-545.541) [-540.041] (-540.252) (-543.419) * [-539.018] (-539.264) (-543.640) (-538.691) -- 0:00:57
80000 -- (-544.469) (-538.651) [-539.488] (-540.668) * (-540.190) (-539.429) [-539.343] (-541.430) -- 0:00:57
Average standard deviation of split frequencies: 0.023375
80500 -- [-540.997] (-538.369) (-539.387) (-539.998) * [-539.438] (-542.456) (-539.464) (-540.317) -- 0:00:57
81000 -- (-546.424) [-539.901] (-540.166) (-540.606) * [-541.931] (-542.757) (-541.560) (-538.380) -- 0:00:56
81500 -- (-539.890) (-538.459) (-540.878) [-541.388] * (-538.417) [-538.075] (-540.588) (-540.125) -- 0:00:56
82000 -- [-540.565] (-543.247) (-541.406) (-542.430) * (-540.214) (-539.783) [-541.562] (-538.419) -- 0:00:55
82500 -- (-540.366) (-541.030) [-540.553] (-540.343) * (-538.434) [-538.250] (-542.153) (-538.414) -- 0:00:55
83000 -- (-541.899) (-540.022) [-539.855] (-538.993) * (-544.963) (-539.085) [-538.647] (-539.895) -- 0:00:55
83500 -- (-538.412) [-539.177] (-539.196) (-538.735) * [-539.802] (-539.883) (-538.411) (-537.892) -- 0:00:54
84000 -- (-538.499) (-545.629) [-539.074] (-543.485) * (-541.262) (-544.341) [-538.360] (-541.328) -- 0:00:54
84500 -- (-538.577) [-542.960] (-538.857) (-540.732) * (-538.206) [-541.995] (-538.253) (-539.995) -- 0:00:54
85000 -- (-539.301) (-545.865) (-541.921) [-540.841] * (-540.003) (-539.136) [-539.507] (-538.943) -- 0:00:53
Average standard deviation of split frequencies: 0.023492
85500 -- [-539.907] (-544.288) (-540.922) (-539.642) * (-538.165) [-539.176] (-539.796) (-538.682) -- 0:00:53
86000 -- (-539.587) (-543.238) (-538.747) [-538.418] * [-538.671] (-540.741) (-540.255) (-538.412) -- 0:00:53
86500 -- [-539.749] (-540.957) (-542.456) (-538.150) * [-539.552] (-546.472) (-545.050) (-539.372) -- 0:00:52
87000 -- (-543.996) (-540.741) (-540.052) [-538.952] * (-538.908) [-541.000] (-543.210) (-544.626) -- 0:00:52
87500 -- (-539.061) (-541.146) [-539.610] (-537.956) * [-539.651] (-539.689) (-539.217) (-539.521) -- 0:00:52
88000 -- (-544.334) (-538.490) (-539.457) [-540.798] * [-540.785] (-544.051) (-545.969) (-540.027) -- 0:00:51
88500 -- (-545.403) (-539.404) [-541.598] (-540.607) * [-538.331] (-537.819) (-545.795) (-539.778) -- 0:00:51
89000 -- (-548.702) (-540.528) (-541.240) [-538.249] * (-544.563) (-548.894) [-540.902] (-540.232) -- 0:00:51
89500 -- (-546.758) (-540.880) (-539.350) [-541.326] * [-540.166] (-549.165) (-543.764) (-541.765) -- 0:00:50
90000 -- [-539.574] (-540.762) (-539.325) (-543.041) * (-538.944) [-538.010] (-538.649) (-538.877) -- 0:00:50
Average standard deviation of split frequencies: 0.026776
90500 -- [-538.353] (-543.762) (-539.141) (-540.312) * [-543.587] (-540.528) (-538.767) (-540.553) -- 0:00:50
91000 -- (-538.682) (-539.113) (-540.829) [-541.426] * [-539.635] (-540.163) (-543.343) (-538.125) -- 0:00:49
91500 -- [-539.644] (-539.040) (-543.365) (-543.227) * (-541.394) [-541.338] (-538.156) (-539.214) -- 0:00:49
92000 -- (-538.177) (-539.136) [-538.213] (-544.780) * (-540.641) (-541.150) (-540.847) [-538.813] -- 0:00:49
92500 -- (-538.867) [-539.596] (-539.471) (-542.551) * (-541.469) (-540.293) [-539.866] (-538.567) -- 0:00:49
93000 -- (-540.260) (-542.832) (-539.460) [-547.067] * (-539.572) (-541.952) (-539.109) [-541.975] -- 0:00:48
93500 -- (-542.704) (-537.868) (-547.222) [-544.509] * (-539.438) (-540.909) (-539.562) [-544.871] -- 0:00:48
94000 -- (-539.677) (-539.856) (-539.540) [-539.028] * (-541.702) [-539.741] (-538.095) (-540.605) -- 0:00:48
94500 -- (-541.275) (-541.419) (-542.513) [-540.280] * [-539.134] (-542.064) (-537.996) (-542.089) -- 0:00:47
95000 -- (-544.525) (-538.960) [-542.444] (-538.330) * (-539.355) (-543.343) [-539.418] (-540.274) -- 0:00:47
Average standard deviation of split frequencies: 0.025586
95500 -- (-544.896) (-538.811) (-539.278) [-541.236] * [-538.526] (-539.149) (-539.459) (-539.739) -- 0:00:47
96000 -- (-541.014) (-538.365) (-539.367) [-540.253] * (-545.740) (-538.796) [-539.747] (-539.483) -- 0:00:47
96500 -- [-539.974] (-542.150) (-538.903) (-539.970) * [-539.100] (-540.280) (-540.990) (-541.106) -- 0:00:56
97000 -- (-542.729) (-538.852) [-538.361] (-543.915) * (-539.500) [-539.322] (-538.845) (-541.297) -- 0:00:55
97500 -- (-538.704) [-542.144] (-539.033) (-544.400) * [-539.240] (-539.634) (-539.860) (-541.846) -- 0:00:55
98000 -- (-541.953) [-541.453] (-540.611) (-541.457) * (-541.468) (-540.350) [-540.780] (-541.299) -- 0:00:55
98500 -- (-544.958) [-539.866] (-539.816) (-541.025) * (-540.682) (-539.839) [-542.289] (-543.957) -- 0:00:54
99000 -- (-545.822) [-541.052] (-539.316) (-541.407) * (-541.354) (-540.772) (-542.922) [-537.991] -- 0:00:54
99500 -- (-540.899) [-538.785] (-544.489) (-542.183) * [-540.649] (-538.920) (-538.172) (-540.602) -- 0:00:54
100000 -- (-541.200) (-540.757) (-541.025) [-542.464] * (-540.925) (-538.826) (-540.569) [-540.408] -- 0:00:54
Average standard deviation of split frequencies: 0.023934
100500 -- (-542.900) (-540.252) (-542.291) [-542.604] * [-540.925] (-541.022) (-543.486) (-540.354) -- 0:00:53
101000 -- [-540.332] (-541.829) (-541.016) (-539.954) * (-538.941) [-540.204] (-540.012) (-542.284) -- 0:00:53
101500 -- [-539.280] (-549.002) (-540.112) (-541.780) * [-538.697] (-539.792) (-538.643) (-543.105) -- 0:00:53
102000 -- (-538.751) (-539.758) (-540.261) [-539.570] * [-540.560] (-539.636) (-541.321) (-543.126) -- 0:00:52
102500 -- (-540.573) (-538.688) (-539.189) [-542.320] * (-539.812) [-538.294] (-541.814) (-538.945) -- 0:00:52
103000 -- (-541.029) [-539.320] (-539.602) (-539.554) * [-539.885] (-540.457) (-542.087) (-540.785) -- 0:00:52
103500 -- (-542.975) [-541.552] (-538.942) (-540.983) * (-540.399) (-545.558) [-539.306] (-540.753) -- 0:00:51
104000 -- (-539.595) (-539.052) (-541.258) [-539.094] * (-539.817) (-540.303) [-538.203] (-540.337) -- 0:00:51
104500 -- [-540.373] (-541.892) (-540.197) (-538.460) * [-540.677] (-539.866) (-538.063) (-540.513) -- 0:00:51
105000 -- (-539.481) (-540.300) (-539.979) [-538.775] * (-538.402) [-544.272] (-542.664) (-540.369) -- 0:00:51
Average standard deviation of split frequencies: 0.022977
105500 -- [-541.151] (-538.755) (-539.913) (-539.388) * [-537.844] (-546.075) (-539.411) (-539.315) -- 0:00:50
106000 -- (-539.751) [-540.448] (-541.620) (-540.322) * (-540.011) [-542.778] (-543.086) (-543.079) -- 0:00:50
106500 -- (-550.013) [-539.729] (-538.238) (-539.980) * (-543.110) [-543.827] (-539.494) (-539.872) -- 0:00:50
107000 -- [-541.273] (-542.633) (-538.863) (-541.442) * [-540.359] (-539.771) (-538.205) (-540.555) -- 0:00:50
107500 -- (-540.582) (-544.856) [-539.454] (-540.684) * [-539.581] (-539.090) (-540.776) (-538.680) -- 0:00:49
108000 -- [-540.647] (-544.028) (-539.008) (-541.006) * (-540.860) (-539.179) (-542.323) [-537.794] -- 0:00:49
108500 -- [-543.738] (-539.754) (-542.468) (-539.386) * [-541.289] (-538.468) (-542.509) (-538.159) -- 0:00:49
109000 -- (-540.704) [-541.110] (-538.828) (-544.386) * (-538.301) (-539.590) (-540.159) [-539.872] -- 0:00:49
109500 -- (-539.917) (-539.431) (-540.058) [-543.360] * (-546.160) (-538.802) (-541.473) [-538.568] -- 0:00:48
110000 -- (-539.045) (-538.104) [-539.703] (-539.834) * (-542.639) [-540.248] (-543.645) (-539.676) -- 0:00:48
Average standard deviation of split frequencies: 0.023192
110500 -- (-541.178) [-540.426] (-542.129) (-539.453) * (-538.746) (-538.823) [-540.719] (-539.172) -- 0:00:48
111000 -- (-540.307) [-541.781] (-538.636) (-538.485) * (-539.363) [-540.304] (-540.142) (-539.724) -- 0:00:48
111500 -- (-543.366) (-538.970) (-538.669) [-538.967] * [-540.994] (-541.621) (-539.409) (-543.451) -- 0:00:47
112000 -- [-542.257] (-539.200) (-541.341) (-540.618) * (-539.113) [-540.198] (-542.100) (-544.271) -- 0:00:47
112500 -- (-539.949) (-540.601) (-540.397) [-538.099] * (-538.964) (-539.089) [-540.632] (-538.388) -- 0:00:47
113000 -- (-539.129) [-539.311] (-539.577) (-539.446) * (-541.081) [-539.486] (-539.800) (-542.556) -- 0:00:54
113500 -- (-540.043) [-539.946] (-539.970) (-542.799) * (-543.955) (-538.880) (-539.013) [-540.583] -- 0:00:54
114000 -- (-541.809) (-540.024) (-538.405) [-541.394] * (-541.980) (-542.782) [-539.236] (-541.595) -- 0:00:54
114500 -- (-542.229) (-542.501) [-541.680] (-538.983) * (-540.691) (-542.969) (-542.116) [-541.361] -- 0:00:54
115000 -- (-538.986) (-539.234) (-545.109) [-540.452] * (-540.878) (-540.859) (-538.790) [-541.305] -- 0:00:53
Average standard deviation of split frequencies: 0.022351
115500 -- (-540.582) (-542.015) [-544.525] (-540.277) * (-541.913) (-540.313) (-538.680) [-539.432] -- 0:00:53
116000 -- (-538.795) [-541.268] (-539.552) (-545.069) * [-539.806] (-540.220) (-538.891) (-542.190) -- 0:00:53
116500 -- [-542.059] (-541.220) (-539.277) (-545.118) * [-541.937] (-540.083) (-542.038) (-541.147) -- 0:00:53
117000 -- (-540.490) (-540.596) [-538.603] (-539.411) * (-539.601) (-538.851) [-541.499] (-542.238) -- 0:00:52
117500 -- (-542.521) (-539.165) (-538.774) [-538.042] * [-539.958] (-542.561) (-542.843) (-539.371) -- 0:00:52
118000 -- [-539.425] (-539.391) (-541.714) (-542.293) * [-539.853] (-540.228) (-538.661) (-540.534) -- 0:00:52
118500 -- (-540.099) (-538.854) (-545.309) [-539.571] * [-540.404] (-539.574) (-539.663) (-540.736) -- 0:00:52
119000 -- (-541.909) (-538.305) (-540.959) [-539.897] * (-537.848) [-538.371] (-538.966) (-539.029) -- 0:00:51
119500 -- (-541.721) [-538.111] (-538.584) (-539.168) * (-538.804) [-541.816] (-539.039) (-539.343) -- 0:00:51
120000 -- (-538.880) (-538.414) [-539.927] (-541.067) * (-539.453) (-537.939) (-539.070) [-538.537] -- 0:00:51
Average standard deviation of split frequencies: 0.025176
120500 -- (-539.283) (-540.478) [-538.795] (-540.016) * [-539.826] (-539.712) (-541.838) (-538.532) -- 0:00:51
121000 -- [-545.034] (-540.001) (-539.426) (-540.522) * (-537.772) (-539.736) [-539.150] (-542.253) -- 0:00:50
121500 -- [-542.905] (-540.907) (-542.842) (-543.871) * (-538.375) (-542.246) (-538.956) [-539.043] -- 0:00:50
122000 -- (-540.478) [-541.264] (-539.766) (-537.983) * [-540.164] (-538.895) (-538.591) (-540.336) -- 0:00:50
122500 -- (-541.859) (-541.574) [-538.982] (-538.322) * (-539.535) [-538.705] (-538.538) (-540.703) -- 0:00:50
123000 -- (-542.378) [-542.454] (-540.229) (-541.070) * (-538.482) (-543.136) [-538.160] (-538.571) -- 0:00:49
123500 -- (-541.860) (-547.092) (-538.364) [-540.379] * (-537.831) (-547.531) (-540.411) [-538.481] -- 0:00:49
124000 -- (-540.647) [-539.763] (-538.699) (-539.492) * (-539.065) (-543.564) [-539.495] (-539.867) -- 0:00:49
124500 -- (-540.085) (-539.965) [-540.191] (-542.929) * (-538.827) (-542.122) (-538.523) [-538.692] -- 0:00:49
125000 -- (-540.123) [-540.283] (-541.893) (-541.299) * (-540.275) (-539.683) [-540.301] (-537.976) -- 0:00:49
Average standard deviation of split frequencies: 0.023903
125500 -- (-538.980) [-538.727] (-540.415) (-539.318) * (-538.289) [-538.246] (-539.809) (-540.605) -- 0:00:48
126000 -- (-543.543) (-539.519) [-541.521] (-538.692) * (-539.731) (-539.271) (-539.622) [-542.289] -- 0:00:48
126500 -- (-541.350) (-544.886) (-538.348) [-538.680] * (-539.804) [-538.894] (-538.856) (-543.800) -- 0:00:48
127000 -- (-541.831) (-543.711) [-538.287] (-540.925) * (-542.073) (-541.421) [-538.914] (-540.195) -- 0:00:48
127500 -- [-541.288] (-541.262) (-538.486) (-543.322) * (-540.063) [-540.841] (-538.792) (-540.200) -- 0:00:47
128000 -- (-542.132) (-540.391) (-538.566) [-539.666] * (-539.745) (-539.338) [-541.859] (-538.888) -- 0:00:47
128500 -- (-541.221) [-541.399] (-539.014) (-545.089) * [-540.532] (-538.991) (-544.783) (-540.148) -- 0:00:47
129000 -- (-539.721) (-541.252) (-538.649) [-540.575] * (-540.083) (-538.917) [-541.479] (-539.239) -- 0:00:47
129500 -- (-541.906) [-542.649] (-540.989) (-542.004) * (-540.978) (-540.277) (-540.496) [-540.119] -- 0:00:47
130000 -- (-539.733) (-538.909) (-538.691) [-539.292] * (-541.709) (-538.616) (-541.069) [-540.420] -- 0:00:46
Average standard deviation of split frequencies: 0.023355
130500 -- [-538.390] (-540.276) (-540.991) (-539.379) * (-541.041) [-539.553] (-541.681) (-550.751) -- 0:00:53
131000 -- [-539.427] (-539.233) (-538.603) (-542.624) * (-544.008) (-541.316) (-545.144) [-539.511] -- 0:00:53
131500 -- (-539.434) (-544.222) (-538.582) [-539.131] * (-538.705) (-538.699) (-539.485) [-541.947] -- 0:00:52
132000 -- (-539.648) [-538.765] (-540.736) (-538.242) * (-538.862) [-541.023] (-538.542) (-543.080) -- 0:00:52
132500 -- (-541.359) [-541.798] (-539.376) (-538.729) * (-543.005) (-539.168) [-540.485] (-542.894) -- 0:00:52
133000 -- (-545.219) (-545.230) [-539.863] (-539.548) * (-540.863) (-540.588) [-538.737] (-544.992) -- 0:00:52
133500 -- (-539.515) [-540.626] (-538.759) (-540.890) * (-540.161) [-538.919] (-542.528) (-543.200) -- 0:00:51
134000 -- [-538.652] (-537.980) (-538.994) (-541.644) * (-539.915) (-540.461) [-540.239] (-542.577) -- 0:00:51
134500 -- (-540.447) [-539.635] (-541.244) (-538.297) * (-540.171) (-544.074) [-539.224] (-542.053) -- 0:00:51
135000 -- (-537.915) (-539.460) (-544.078) [-538.052] * (-538.764) (-539.905) (-539.004) [-541.577] -- 0:00:51
Average standard deviation of split frequencies: 0.024467
135500 -- (-538.281) (-540.228) (-544.873) [-540.219] * (-539.766) (-543.029) (-539.059) [-539.117] -- 0:00:51
136000 -- (-538.379) (-543.396) [-539.098] (-540.211) * (-540.360) (-538.670) [-537.995] (-538.292) -- 0:00:50
136500 -- (-539.778) (-542.736) [-540.687] (-540.620) * (-539.870) [-538.800] (-542.611) (-538.878) -- 0:00:50
137000 -- (-545.746) [-543.036] (-539.436) (-541.632) * (-538.448) [-541.083] (-541.375) (-540.514) -- 0:00:50
137500 -- (-539.681) (-543.766) (-539.775) [-540.293] * (-540.304) [-539.187] (-543.566) (-539.979) -- 0:00:50
138000 -- (-540.317) (-538.648) (-542.234) [-543.388] * [-541.232] (-540.099) (-544.906) (-539.970) -- 0:00:49
138500 -- (-538.281) (-539.394) [-538.730] (-541.356) * (-542.378) (-539.970) (-538.163) [-541.237] -- 0:00:49
139000 -- (-539.874) (-540.042) [-539.426] (-540.139) * (-540.792) (-539.147) (-538.976) [-539.251] -- 0:00:49
139500 -- [-538.247] (-541.790) (-544.780) (-542.174) * (-540.799) (-538.896) (-541.374) [-544.071] -- 0:00:49
140000 -- (-540.846) (-539.867) (-540.941) [-542.452] * (-538.922) (-541.568) (-538.925) [-542.322] -- 0:00:49
Average standard deviation of split frequencies: 0.021783
140500 -- (-541.757) (-539.685) [-542.761] (-539.163) * [-541.744] (-542.679) (-539.158) (-539.281) -- 0:00:48
141000 -- [-541.050] (-539.355) (-543.362) (-539.980) * (-541.106) (-538.942) [-543.235] (-541.611) -- 0:00:48
141500 -- (-541.687) [-540.042] (-542.645) (-543.413) * (-540.088) [-538.276] (-540.885) (-540.473) -- 0:00:48
142000 -- (-541.098) [-540.796] (-543.028) (-543.968) * (-551.236) (-540.309) [-539.366] (-538.430) -- 0:00:48
142500 -- [-538.208] (-539.227) (-541.282) (-539.979) * (-540.300) (-539.920) [-540.781] (-538.431) -- 0:00:48
143000 -- (-539.509) [-538.143] (-540.211) (-539.630) * (-540.266) [-541.547] (-538.531) (-539.005) -- 0:00:47
143500 -- (-539.534) (-538.272) (-539.059) [-540.682] * (-539.363) (-541.292) (-540.298) [-539.194] -- 0:00:47
144000 -- [-540.173] (-537.947) (-541.139) (-539.856) * (-538.757) [-539.667] (-541.130) (-539.808) -- 0:00:47
144500 -- (-541.041) [-540.868] (-539.570) (-542.295) * (-537.711) (-540.721) (-539.015) [-538.884] -- 0:00:47
145000 -- (-544.984) (-541.514) (-540.031) [-539.138] * (-537.799) [-539.623] (-539.397) (-538.452) -- 0:00:47
Average standard deviation of split frequencies: 0.021884
145500 -- [-542.961] (-539.887) (-540.199) (-537.947) * (-537.968) (-539.963) [-538.721] (-539.337) -- 0:00:46
146000 -- (-543.695) (-541.533) [-539.984] (-540.525) * (-540.991) [-542.488] (-541.791) (-540.633) -- 0:00:46
146500 -- [-542.347] (-542.105) (-540.952) (-540.602) * (-543.861) (-544.192) [-539.038] (-540.848) -- 0:00:46
147000 -- (-539.106) (-538.019) [-538.624] (-540.701) * (-539.595) (-541.392) [-539.283] (-541.829) -- 0:00:46
147500 -- (-540.159) [-538.589] (-538.131) (-538.982) * (-538.371) (-539.001) (-542.045) [-540.095] -- 0:00:46
148000 -- (-541.473) (-543.833) (-539.939) [-538.073] * (-538.440) (-541.430) (-541.507) [-540.746] -- 0:00:51
148500 -- (-538.381) (-542.376) [-538.724] (-538.605) * (-541.938) [-542.669] (-543.499) (-538.928) -- 0:00:51
149000 -- (-538.233) (-538.727) [-538.817] (-540.295) * (-540.285) (-538.590) (-539.457) [-540.366] -- 0:00:51
149500 -- (-541.953) (-541.931) [-539.455] (-540.456) * (-540.824) [-539.733] (-539.086) (-550.234) -- 0:00:51
150000 -- [-541.210] (-543.878) (-542.091) (-540.595) * [-539.174] (-539.707) (-538.616) (-539.315) -- 0:00:51
Average standard deviation of split frequencies: 0.021554
150500 -- (-538.704) (-540.884) [-539.717] (-540.066) * (-538.475) (-539.696) [-539.633] (-540.170) -- 0:00:50
151000 -- (-539.358) (-544.526) [-543.181] (-552.294) * (-540.872) (-543.295) (-540.863) [-538.750] -- 0:00:50
151500 -- (-539.182) [-541.630] (-544.255) (-539.640) * (-540.892) (-541.958) [-541.016] (-540.042) -- 0:00:50
152000 -- (-539.586) [-539.434] (-538.493) (-537.825) * (-539.904) (-539.098) [-539.046] (-540.757) -- 0:00:50
152500 -- (-541.608) (-539.384) [-539.184] (-541.117) * (-539.357) (-543.339) (-544.722) [-540.295] -- 0:00:50
153000 -- [-541.492] (-546.519) (-539.455) (-542.741) * (-540.150) (-544.514) (-543.606) [-538.864] -- 0:00:49
153500 -- [-540.693] (-543.012) (-539.125) (-538.443) * (-539.298) (-541.113) (-539.161) [-545.100] -- 0:00:49
154000 -- [-538.466] (-541.912) (-542.574) (-540.680) * [-542.795] (-538.519) (-539.258) (-544.596) -- 0:00:49
154500 -- (-541.082) (-542.300) [-539.586] (-542.065) * (-538.239) [-540.148] (-540.007) (-538.977) -- 0:00:49
155000 -- (-541.328) (-542.605) (-538.650) [-540.215] * (-538.927) (-539.216) [-537.992] (-539.071) -- 0:00:49
Average standard deviation of split frequencies: 0.021686
155500 -- (-539.683) [-538.991] (-539.858) (-540.432) * (-540.634) (-539.085) (-539.577) [-539.480] -- 0:00:48
156000 -- [-538.921] (-539.089) (-539.354) (-540.891) * (-540.968) (-541.575) (-539.982) [-540.937] -- 0:00:48
156500 -- (-541.022) (-541.523) (-545.553) [-541.548] * (-543.650) (-541.143) (-541.359) [-538.931] -- 0:00:48
157000 -- (-539.903) (-537.873) [-539.288] (-541.412) * [-539.998] (-539.945) (-538.186) (-539.538) -- 0:00:48
157500 -- (-540.195) [-540.239] (-539.779) (-539.704) * (-541.015) (-539.207) [-538.902] (-537.727) -- 0:00:48
158000 -- (-543.813) (-541.361) (-543.443) [-539.762] * (-538.171) (-539.184) (-538.177) [-537.979] -- 0:00:47
158500 -- [-538.967] (-541.110) (-543.036) (-543.009) * (-539.745) (-538.449) (-538.472) [-539.349] -- 0:00:47
159000 -- [-540.370] (-545.624) (-546.018) (-544.262) * (-541.863) [-538.651] (-539.781) (-540.797) -- 0:00:47
159500 -- [-539.520] (-539.523) (-543.291) (-539.227) * (-538.439) (-539.128) [-540.712] (-538.246) -- 0:00:47
160000 -- (-539.214) (-538.873) [-540.049] (-540.277) * (-540.205) (-540.480) (-539.794) [-538.398] -- 0:00:47
Average standard deviation of split frequencies: 0.021574
160500 -- (-539.798) (-539.393) [-539.545] (-538.077) * [-542.920] (-540.048) (-542.751) (-544.781) -- 0:00:47
161000 -- (-540.086) (-540.372) (-543.763) [-540.440] * (-539.425) (-542.442) [-539.911] (-539.833) -- 0:00:46
161500 -- (-540.868) (-539.292) [-540.313] (-543.235) * (-538.394) (-540.003) (-540.295) [-538.654] -- 0:00:46
162000 -- (-543.017) (-539.564) [-539.984] (-542.119) * [-538.798] (-547.237) (-540.715) (-541.067) -- 0:00:46
162500 -- (-539.973) (-539.589) (-539.120) [-538.293] * (-540.975) [-546.409] (-540.005) (-540.157) -- 0:00:46
163000 -- (-539.507) (-539.649) [-538.808] (-538.958) * (-540.377) (-539.898) [-539.520] (-541.208) -- 0:00:46
163500 -- (-541.151) (-541.200) [-540.607] (-542.342) * (-541.657) (-541.174) (-539.571) [-541.232] -- 0:00:46
164000 -- (-539.535) (-540.731) [-543.414] (-538.837) * [-539.867] (-538.412) (-538.509) (-539.704) -- 0:00:45
164500 -- (-541.827) (-542.928) (-542.859) [-538.790] * [-539.584] (-538.760) (-539.765) (-538.656) -- 0:00:45
165000 -- (-539.531) (-539.810) (-538.563) [-538.428] * (-539.253) (-541.749) (-539.584) [-538.677] -- 0:00:45
Average standard deviation of split frequencies: 0.019377
165500 -- [-538.831] (-539.706) (-542.122) (-540.019) * (-539.928) (-540.766) (-540.377) [-538.651] -- 0:00:50
166000 -- (-538.349) (-540.609) (-538.134) [-537.877] * (-540.315) (-543.034) [-540.622] (-538.484) -- 0:00:50
166500 -- [-542.951] (-541.794) (-541.561) (-539.847) * (-540.588) (-538.848) (-539.480) [-540.177] -- 0:00:50
167000 -- (-541.530) [-541.873] (-542.852) (-542.348) * (-543.948) (-540.085) [-543.788] (-539.756) -- 0:00:49
167500 -- (-542.527) (-539.154) [-541.740] (-538.613) * (-540.483) [-544.314] (-539.928) (-538.874) -- 0:00:49
168000 -- (-542.915) (-539.799) (-538.338) [-541.277] * [-541.096] (-540.016) (-539.341) (-538.122) -- 0:00:49
168500 -- (-542.146) (-544.713) (-538.948) [-539.345] * (-540.016) (-540.157) [-538.463] (-538.832) -- 0:00:49
169000 -- [-542.012] (-538.308) (-540.211) (-540.970) * (-539.463) (-539.162) [-538.392] (-539.589) -- 0:00:49
169500 -- (-539.590) (-538.683) (-540.105) [-538.753] * (-540.175) [-538.559] (-538.814) (-541.796) -- 0:00:48
170000 -- (-540.025) [-539.229] (-541.274) (-541.269) * (-540.614) (-540.866) (-541.114) [-538.253] -- 0:00:48
Average standard deviation of split frequencies: 0.018848
170500 -- (-543.803) [-539.907] (-544.155) (-542.545) * (-542.539) (-544.690) [-538.161] (-538.298) -- 0:00:48
171000 -- [-540.137] (-538.742) (-539.712) (-540.290) * (-540.086) (-540.501) [-538.252] (-538.670) -- 0:00:48
171500 -- (-541.464) (-543.109) [-539.510] (-540.121) * (-539.917) (-538.867) [-539.722] (-540.864) -- 0:00:48
172000 -- (-538.568) (-540.120) (-539.583) [-539.144] * [-539.574] (-540.596) (-539.561) (-541.082) -- 0:00:48
172500 -- (-538.310) (-543.947) [-539.155] (-539.425) * (-542.197) [-543.050] (-540.786) (-543.223) -- 0:00:47
173000 -- (-539.419) [-540.440] (-539.308) (-540.204) * (-538.829) [-539.507] (-542.157) (-539.531) -- 0:00:47
173500 -- (-541.878) (-543.779) [-537.997] (-538.594) * (-539.445) (-540.255) (-543.596) [-540.615] -- 0:00:47
174000 -- (-546.098) (-543.318) [-540.977] (-538.967) * [-545.420] (-540.023) (-539.252) (-540.376) -- 0:00:47
174500 -- (-540.583) (-543.805) (-541.378) [-539.695] * (-542.371) (-541.167) [-539.962] (-540.334) -- 0:00:47
175000 -- [-541.504] (-538.889) (-538.664) (-539.705) * (-541.270) (-541.124) (-539.572) [-539.511] -- 0:00:47
Average standard deviation of split frequencies: 0.017331
175500 -- (-540.983) (-539.560) [-539.453] (-542.851) * (-544.661) (-538.495) [-539.235] (-539.619) -- 0:00:46
176000 -- [-538.463] (-539.688) (-540.642) (-540.383) * (-543.348) (-539.352) (-540.466) [-538.851] -- 0:00:46
176500 -- (-538.583) [-541.525] (-539.716) (-540.721) * (-540.298) (-538.993) (-542.653) [-539.095] -- 0:00:46
177000 -- (-541.149) (-543.793) (-540.781) [-538.769] * (-538.102) [-539.048] (-542.113) (-539.076) -- 0:00:46
177500 -- (-539.746) (-544.951) (-539.589) [-544.563] * (-539.327) (-539.424) (-540.265) [-541.735] -- 0:00:46
178000 -- (-540.837) [-540.240] (-539.997) (-542.576) * (-541.184) (-539.485) [-539.738] (-542.354) -- 0:00:46
178500 -- (-540.374) (-538.510) [-544.221] (-541.287) * [-538.430] (-538.917) (-540.849) (-544.554) -- 0:00:46
179000 -- [-539.374] (-539.288) (-539.843) (-545.798) * (-538.962) (-538.434) [-538.824] (-550.231) -- 0:00:45
179500 -- (-541.856) (-540.188) [-538.718] (-540.876) * (-539.043) [-538.844] (-538.800) (-543.118) -- 0:00:45
180000 -- (-544.948) [-539.599] (-540.022) (-539.444) * (-537.914) (-541.678) [-537.945] (-540.991) -- 0:00:45
Average standard deviation of split frequencies: 0.015042
180500 -- (-540.800) (-539.287) [-540.661] (-539.562) * (-539.559) (-542.211) (-539.464) [-540.107] -- 0:00:45
181000 -- (-543.082) [-539.105] (-540.300) (-543.006) * (-541.785) (-538.973) [-541.198] (-540.521) -- 0:00:45
181500 -- [-541.617] (-539.333) (-542.966) (-543.532) * (-543.308) [-541.251] (-540.547) (-538.854) -- 0:00:45
182000 -- [-539.728] (-543.607) (-538.265) (-542.835) * (-540.721) [-547.195] (-541.240) (-538.118) -- 0:00:44
182500 -- (-540.081) (-544.598) [-540.113] (-539.625) * [-542.155] (-547.420) (-540.496) (-538.863) -- 0:00:49
183000 -- [-538.799] (-541.009) (-542.204) (-540.444) * (-546.142) (-540.302) [-539.388] (-539.600) -- 0:00:49
183500 -- (-539.393) [-546.774] (-540.380) (-539.817) * (-542.694) (-539.605) (-539.091) [-541.044] -- 0:00:48
184000 -- (-543.614) [-541.277] (-540.481) (-542.385) * (-540.527) (-541.622) (-541.419) [-539.737] -- 0:00:48
184500 -- (-546.828) (-540.159) [-539.006] (-539.102) * [-541.449] (-539.594) (-541.919) (-538.162) -- 0:00:48
185000 -- (-546.845) (-538.971) (-541.613) [-539.165] * (-538.215) [-539.079] (-539.833) (-538.869) -- 0:00:48
Average standard deviation of split frequencies: 0.013939
185500 -- (-540.166) [-539.750] (-542.185) (-539.693) * (-538.081) [-540.727] (-538.464) (-540.790) -- 0:00:48
186000 -- (-544.505) (-539.912) (-541.987) [-538.706] * (-541.048) (-542.323) [-539.995] (-539.223) -- 0:00:48
186500 -- [-542.347] (-540.600) (-538.518) (-543.964) * (-541.309) (-542.846) (-544.252) [-538.598] -- 0:00:47
187000 -- (-539.303) [-539.692] (-540.093) (-539.417) * (-539.794) (-537.782) [-538.542] (-540.409) -- 0:00:47
187500 -- (-540.149) (-538.620) [-539.660] (-538.965) * (-544.091) [-538.421] (-539.579) (-539.118) -- 0:00:47
188000 -- (-540.834) [-540.793] (-541.480) (-539.693) * [-546.250] (-538.338) (-539.356) (-539.810) -- 0:00:47
188500 -- [-538.640] (-540.432) (-539.405) (-539.094) * (-543.023) (-539.397) (-542.637) [-538.904] -- 0:00:47
189000 -- [-538.413] (-539.839) (-540.301) (-543.782) * (-537.835) [-540.199] (-540.580) (-544.177) -- 0:00:47
189500 -- (-538.769) [-541.077] (-539.771) (-539.646) * (-543.467) (-544.885) [-540.748] (-544.129) -- 0:00:47
190000 -- (-539.449) (-539.569) [-540.842] (-539.974) * (-539.676) (-543.347) (-546.594) [-541.392] -- 0:00:46
Average standard deviation of split frequencies: 0.011635
190500 -- (-543.283) (-543.013) [-538.315] (-539.486) * (-539.427) (-538.298) (-543.394) [-540.871] -- 0:00:46
191000 -- [-542.132] (-540.821) (-542.221) (-539.347) * [-539.556] (-539.320) (-542.142) (-538.766) -- 0:00:46
191500 -- [-540.295] (-540.932) (-541.060) (-539.580) * (-538.565) [-540.400] (-543.391) (-538.657) -- 0:00:46
192000 -- (-544.160) (-538.684) [-540.469] (-540.421) * [-537.922] (-542.926) (-540.471) (-542.521) -- 0:00:46
192500 -- (-543.384) (-539.081) [-540.409] (-541.018) * (-542.015) (-542.697) [-540.839] (-541.598) -- 0:00:46
193000 -- [-540.581] (-539.177) (-539.680) (-542.475) * (-542.264) [-538.765] (-541.682) (-539.461) -- 0:00:45
193500 -- (-540.718) [-540.047] (-541.108) (-541.651) * (-539.078) (-542.916) (-539.209) [-539.860] -- 0:00:45
194000 -- (-539.528) (-539.521) [-541.304] (-538.819) * [-541.411] (-541.831) (-539.794) (-539.895) -- 0:00:45
194500 -- (-545.029) (-538.450) [-538.900] (-538.056) * (-538.669) [-540.030] (-538.430) (-538.532) -- 0:00:45
195000 -- (-542.005) (-542.037) [-542.365] (-538.590) * (-543.689) (-541.839) [-540.058] (-541.924) -- 0:00:45
Average standard deviation of split frequencies: 0.009781
195500 -- (-542.949) (-538.450) [-539.819] (-538.229) * (-538.736) [-541.245] (-542.620) (-546.753) -- 0:00:45
196000 -- [-539.562] (-538.604) (-543.589) (-539.450) * (-539.582) (-542.509) (-540.174) [-547.541] -- 0:00:45
196500 -- (-540.173) [-538.467] (-542.908) (-540.350) * (-538.719) [-538.881] (-538.633) (-545.248) -- 0:00:44
197000 -- (-539.663) [-538.303] (-542.437) (-539.534) * (-540.039) [-539.109] (-539.708) (-539.857) -- 0:00:44
197500 -- [-543.228] (-538.538) (-537.945) (-543.184) * (-539.093) [-538.568] (-539.710) (-539.434) -- 0:00:44
198000 -- (-543.415) [-540.844] (-538.210) (-539.376) * [-539.908] (-538.694) (-540.644) (-539.497) -- 0:00:44
198500 -- (-541.076) [-538.148] (-541.539) (-539.340) * (-539.799) (-541.023) [-539.577] (-542.601) -- 0:00:44
199000 -- (-538.108) (-542.652) [-538.737] (-542.061) * (-540.179) [-538.235] (-538.513) (-541.315) -- 0:00:44
199500 -- (-539.640) (-540.922) (-539.458) [-539.137] * (-542.800) [-538.974] (-540.056) (-540.003) -- 0:00:44
200000 -- (-539.093) (-542.416) (-540.360) [-538.881] * (-540.029) (-538.898) (-539.064) [-541.321] -- 0:00:48
Average standard deviation of split frequencies: 0.008144
200500 -- [-538.662] (-541.428) (-542.088) (-541.499) * (-540.808) [-540.869] (-539.014) (-539.127) -- 0:00:47
201000 -- (-538.778) (-538.132) [-540.752] (-540.972) * (-547.734) (-541.142) (-541.921) [-539.312] -- 0:00:47
201500 -- (-539.976) (-539.820) [-542.262] (-539.211) * (-543.416) (-539.824) (-542.354) [-541.119] -- 0:00:47
202000 -- (-543.577) [-541.109] (-543.140) (-540.826) * [-541.823] (-539.412) (-539.151) (-538.681) -- 0:00:47
202500 -- (-539.191) (-539.140) [-538.295] (-539.852) * (-538.976) (-541.005) (-538.874) [-539.113] -- 0:00:47
203000 -- (-539.479) [-539.801] (-538.283) (-540.939) * (-537.971) (-541.153) (-538.926) [-538.078] -- 0:00:47
203500 -- (-539.744) (-540.516) (-539.622) [-540.784] * (-539.894) [-538.949] (-541.405) (-542.601) -- 0:00:46
204000 -- (-540.807) (-542.321) [-540.252] (-540.282) * (-540.871) (-539.056) (-541.585) [-539.562] -- 0:00:46
204500 -- (-539.244) [-538.130] (-540.535) (-539.071) * (-538.558) (-541.272) (-539.100) [-539.720] -- 0:00:46
205000 -- (-540.986) (-538.307) [-538.392] (-539.681) * (-539.679) (-539.272) [-541.215] (-540.724) -- 0:00:46
Average standard deviation of split frequencies: 0.009001
205500 -- (-539.610) (-539.284) [-538.241] (-540.967) * (-543.355) [-538.810] (-538.971) (-542.191) -- 0:00:46
206000 -- (-543.719) (-539.106) [-538.119] (-542.176) * (-542.384) (-541.611) [-538.831] (-543.435) -- 0:00:46
206500 -- (-543.462) [-541.668] (-538.063) (-539.947) * (-541.260) (-541.320) (-539.530) [-539.098] -- 0:00:46
207000 -- (-541.403) (-541.170) [-541.089] (-538.514) * [-538.993] (-540.503) (-539.924) (-539.896) -- 0:00:45
207500 -- [-540.601] (-539.534) (-540.833) (-539.344) * (-538.407) (-539.635) (-542.921) [-541.934] -- 0:00:45
208000 -- (-544.282) (-540.910) (-538.916) [-539.452] * (-538.798) (-539.724) (-543.726) [-541.309] -- 0:00:45
208500 -- (-539.895) (-538.770) (-541.964) [-538.622] * (-543.221) [-538.167] (-543.014) (-539.678) -- 0:00:45
209000 -- (-548.548) (-539.813) (-538.749) [-539.497] * [-540.367] (-538.703) (-543.171) (-539.000) -- 0:00:45
209500 -- (-543.778) (-538.512) (-538.416) [-539.175] * (-540.664) (-542.620) [-538.668] (-541.374) -- 0:00:45
210000 -- (-542.310) (-539.618) [-539.118] (-539.730) * (-538.580) (-541.583) [-540.549] (-541.598) -- 0:00:45
Average standard deviation of split frequencies: 0.007692
210500 -- (-542.651) (-544.480) (-540.755) [-540.742] * [-539.362] (-542.982) (-542.621) (-538.743) -- 0:00:45
211000 -- (-543.562) [-539.997] (-540.209) (-540.785) * (-539.102) [-539.106] (-540.416) (-538.821) -- 0:00:44
211500 -- (-538.501) (-542.936) (-540.022) [-540.815] * (-539.757) (-542.191) [-540.371] (-540.957) -- 0:00:44
212000 -- (-539.156) [-542.102] (-541.621) (-539.082) * (-543.224) (-538.723) [-538.586] (-543.931) -- 0:00:44
212500 -- (-539.057) (-542.875) (-539.248) [-545.270] * [-538.805] (-541.485) (-542.649) (-540.576) -- 0:00:44
213000 -- (-539.402) (-541.233) [-542.056] (-540.900) * (-538.575) [-540.277] (-542.149) (-542.232) -- 0:00:44
213500 -- (-538.363) (-539.936) (-539.304) [-540.128] * [-539.807] (-540.591) (-538.375) (-538.135) -- 0:00:44
214000 -- (-540.013) (-539.743) [-539.510] (-539.276) * (-544.415) (-540.464) [-539.402] (-539.538) -- 0:00:44
214500 -- (-539.830) (-539.454) (-541.249) [-540.364] * [-541.418] (-540.109) (-540.602) (-542.826) -- 0:00:43
215000 -- (-542.844) (-541.079) (-539.558) [-538.248] * [-539.763] (-542.052) (-543.604) (-539.160) -- 0:00:43
Average standard deviation of split frequencies: 0.008002
215500 -- (-539.754) (-538.248) (-539.480) [-541.189] * (-540.318) (-546.251) [-541.391] (-540.107) -- 0:00:43
216000 -- [-538.987] (-538.394) (-541.757) (-539.048) * (-540.376) (-539.544) (-539.779) [-544.310] -- 0:00:43
216500 -- (-541.579) (-541.573) (-540.574) [-539.204] * (-538.340) (-540.043) (-540.181) [-540.921] -- 0:00:43
217000 -- (-538.591) [-540.244] (-545.861) (-540.180) * [-540.883] (-538.588) (-538.971) (-539.811) -- 0:00:46
217500 -- [-540.038] (-538.756) (-538.192) (-540.647) * (-542.656) (-541.747) [-538.124] (-541.816) -- 0:00:46
218000 -- (-538.423) (-539.138) [-538.470] (-540.265) * (-541.859) (-542.373) [-538.251] (-541.851) -- 0:00:46
218500 -- (-538.519) [-539.373] (-539.510) (-539.456) * (-540.901) [-541.647] (-539.918) (-540.990) -- 0:00:46
219000 -- [-540.767] (-538.840) (-542.802) (-541.898) * (-539.828) (-539.027) (-538.595) [-540.371] -- 0:00:46
219500 -- (-541.673) [-540.216] (-543.678) (-542.025) * (-539.219) [-539.125] (-538.922) (-539.102) -- 0:00:46
220000 -- (-539.697) (-540.083) (-543.771) [-538.801] * (-538.454) [-538.278] (-539.721) (-537.975) -- 0:00:46
Average standard deviation of split frequencies: 0.009969
220500 -- (-538.646) [-539.115] (-541.095) (-540.109) * (-539.503) [-540.538] (-540.368) (-541.608) -- 0:00:45
221000 -- (-541.558) (-540.689) (-545.912) [-542.741] * [-538.297] (-538.503) (-538.348) (-543.938) -- 0:00:45
221500 -- (-539.557) [-539.669] (-539.640) (-541.190) * (-542.113) (-539.374) [-538.530] (-541.929) -- 0:00:45
222000 -- (-543.464) (-542.227) (-539.220) [-541.019] * (-541.741) (-542.039) [-541.274] (-543.515) -- 0:00:45
222500 -- [-540.350] (-542.248) (-539.683) (-539.780) * (-542.520) (-538.872) [-541.601] (-541.652) -- 0:00:45
223000 -- (-540.261) [-542.380] (-540.989) (-540.350) * (-540.856) (-540.168) [-540.886] (-537.914) -- 0:00:45
223500 -- (-540.657) (-541.415) [-541.124] (-538.988) * (-543.905) [-540.285] (-540.419) (-538.081) -- 0:00:45
224000 -- (-540.660) (-541.295) [-540.324] (-545.033) * (-545.381) [-539.174] (-538.699) (-538.894) -- 0:00:45
224500 -- (-539.452) (-538.966) [-542.119] (-540.957) * (-539.907) [-539.089] (-541.062) (-539.243) -- 0:00:44
225000 -- [-539.078] (-539.150) (-540.458) (-539.069) * (-542.080) [-538.148] (-538.269) (-541.714) -- 0:00:44
Average standard deviation of split frequencies: 0.009039
225500 -- [-540.815] (-540.195) (-539.429) (-538.806) * [-539.632] (-539.893) (-540.633) (-541.332) -- 0:00:44
226000 -- (-540.313) [-541.403] (-539.328) (-538.396) * (-539.073) (-541.935) [-539.209] (-542.700) -- 0:00:44
226500 -- (-540.372) (-539.312) [-539.117] (-538.568) * [-538.756] (-538.470) (-542.726) (-540.551) -- 0:00:44
227000 -- [-540.590] (-541.820) (-541.184) (-540.200) * (-541.855) (-539.493) (-540.473) [-540.805] -- 0:00:44
227500 -- (-539.048) [-539.021] (-538.534) (-538.782) * [-540.388] (-538.013) (-539.580) (-540.438) -- 0:00:44
228000 -- (-543.394) (-539.110) [-540.030] (-541.400) * [-538.938] (-540.345) (-539.942) (-540.882) -- 0:00:44
228500 -- [-546.336] (-538.676) (-539.923) (-538.535) * (-540.539) (-539.543) [-539.935] (-544.497) -- 0:00:43
229000 -- (-538.974) (-540.185) [-539.181] (-539.868) * (-541.662) [-541.066] (-539.786) (-539.773) -- 0:00:43
229500 -- (-538.801) [-540.164] (-542.047) (-541.756) * (-540.763) (-542.526) [-538.711] (-541.456) -- 0:00:43
230000 -- (-541.091) (-541.327) (-538.268) [-540.532] * (-539.460) [-542.727] (-539.749) (-541.834) -- 0:00:43
Average standard deviation of split frequencies: 0.009265
230500 -- (-539.681) (-539.953) (-539.478) [-539.636] * (-540.761) (-544.949) (-540.391) [-544.062] -- 0:00:43
231000 -- (-545.156) (-540.430) (-539.227) [-542.864] * (-539.752) (-544.256) (-544.764) [-538.787] -- 0:00:43
231500 -- (-539.667) (-538.887) [-538.437] (-542.232) * [-540.034] (-540.249) (-538.673) (-541.430) -- 0:00:43
232000 -- [-539.590] (-541.857) (-539.857) (-540.411) * (-542.677) [-541.136] (-542.182) (-538.562) -- 0:00:43
232500 -- (-538.196) (-539.897) (-537.950) [-539.423] * [-543.283] (-542.363) (-541.077) (-540.487) -- 0:00:42
233000 -- (-538.926) [-540.360] (-538.966) (-540.167) * (-538.522) (-541.016) (-543.290) [-542.761] -- 0:00:42
233500 -- (-539.711) [-543.698] (-539.818) (-539.402) * (-538.330) [-540.399] (-539.741) (-539.475) -- 0:00:42
234000 -- (-540.003) (-541.139) (-542.169) [-539.719] * (-540.751) (-542.871) [-539.294] (-538.764) -- 0:00:42
234500 -- (-542.939) [-540.751] (-541.106) (-538.561) * (-541.325) (-543.827) (-540.254) [-539.056] -- 0:00:45
235000 -- [-543.680] (-546.863) (-539.952) (-538.867) * (-540.490) (-540.554) (-545.878) [-540.431] -- 0:00:45
Average standard deviation of split frequencies: 0.009854
235500 -- [-538.293] (-542.330) (-540.030) (-540.367) * (-538.986) [-539.741] (-543.204) (-550.570) -- 0:00:45
236000 -- (-539.653) (-540.608) (-542.355) [-540.648] * [-538.568] (-539.605) (-538.664) (-541.216) -- 0:00:45
236500 -- [-539.006] (-538.871) (-542.380) (-538.611) * (-541.434) (-540.578) [-538.665] (-543.198) -- 0:00:45
237000 -- (-541.122) (-539.195) (-541.693) [-539.012] * (-542.758) [-538.843] (-539.768) (-539.762) -- 0:00:45
237500 -- (-540.498) (-538.722) [-539.619] (-539.190) * (-539.102) (-538.877) (-539.513) [-539.204] -- 0:00:44
238000 -- [-540.910] (-538.202) (-542.968) (-540.982) * (-539.558) [-538.441] (-539.068) (-541.813) -- 0:00:44
238500 -- [-543.217] (-544.991) (-541.877) (-545.921) * (-541.551) [-537.965] (-538.385) (-543.514) -- 0:00:44
239000 -- (-539.271) (-538.976) [-542.077] (-542.662) * (-540.262) (-537.965) [-538.356] (-549.248) -- 0:00:44
239500 -- (-540.103) (-541.195) (-537.825) [-538.513] * [-540.914] (-539.243) (-540.004) (-543.153) -- 0:00:44
240000 -- (-540.809) (-538.424) (-538.966) [-540.729] * (-538.627) [-538.635] (-539.429) (-540.220) -- 0:00:44
Average standard deviation of split frequencies: 0.009794
240500 -- (-542.728) (-538.115) [-538.162] (-538.118) * (-540.069) [-539.618] (-539.422) (-541.198) -- 0:00:44
241000 -- (-543.543) (-539.432) [-538.040] (-542.292) * (-542.584) (-539.341) [-539.404] (-539.926) -- 0:00:44
241500 -- (-539.168) (-538.065) [-538.591] (-539.396) * (-544.110) (-540.911) (-542.548) [-539.351] -- 0:00:43
242000 -- (-538.959) (-540.055) (-537.867) [-542.667] * (-540.641) (-540.175) (-540.198) [-541.329] -- 0:00:43
242500 -- (-538.110) [-539.246] (-540.135) (-539.403) * (-542.813) [-539.583] (-541.834) (-540.343) -- 0:00:43
243000 -- (-538.650) (-541.192) [-538.854] (-540.769) * (-542.239) [-539.279] (-539.832) (-540.736) -- 0:00:43
243500 -- (-543.840) (-541.456) [-539.841] (-539.541) * (-538.504) [-541.007] (-539.203) (-538.613) -- 0:00:43
244000 -- (-538.589) (-541.658) (-550.234) [-540.860] * (-542.397) (-537.947) (-539.636) [-540.925] -- 0:00:43
244500 -- (-539.307) (-538.466) [-548.833] (-540.838) * (-542.768) [-539.890] (-540.164) (-539.140) -- 0:00:43
245000 -- [-539.313] (-541.163) (-542.199) (-540.561) * (-540.748) [-539.096] (-539.605) (-537.933) -- 0:00:43
Average standard deviation of split frequencies: 0.009965
245500 -- (-540.969) (-541.237) (-539.434) [-539.665] * (-540.334) [-538.772] (-539.047) (-538.876) -- 0:00:43
246000 -- [-539.757] (-545.511) (-540.879) (-541.211) * (-539.631) (-539.850) (-539.333) [-537.848] -- 0:00:42
246500 -- (-539.873) (-542.077) [-544.023] (-539.075) * (-541.839) [-539.270] (-538.535) (-543.735) -- 0:00:42
247000 -- [-539.049] (-539.843) (-541.350) (-542.188) * (-539.603) (-539.431) (-540.697) [-544.001] -- 0:00:42
247500 -- (-545.494) [-538.373] (-540.160) (-542.124) * (-540.291) (-538.958) [-538.935] (-539.195) -- 0:00:42
248000 -- (-543.773) (-538.754) [-538.548] (-543.280) * [-539.866] (-539.996) (-539.292) (-542.044) -- 0:00:42
248500 -- (-542.771) (-540.929) (-543.748) [-540.223] * (-540.546) (-538.584) [-538.935] (-539.480) -- 0:00:42
249000 -- (-542.308) (-538.271) (-538.687) [-539.536] * (-541.414) (-538.685) (-542.770) [-538.422] -- 0:00:42
249500 -- (-539.749) (-538.388) [-539.671] (-538.606) * [-539.781] (-540.981) (-540.637) (-540.312) -- 0:00:42
250000 -- (-540.148) [-537.906] (-539.547) (-541.385) * (-540.046) [-542.452] (-540.901) (-539.986) -- 0:00:42
Average standard deviation of split frequencies: 0.010782
250500 -- [-543.728] (-537.934) (-538.318) (-539.022) * (-542.997) (-540.799) [-543.171] (-540.725) -- 0:00:41
251000 -- [-539.590] (-543.010) (-540.620) (-539.531) * (-540.648) (-540.481) [-538.798] (-541.894) -- 0:00:41
251500 -- (-538.920) (-538.319) (-540.794) [-540.288] * [-538.891] (-538.160) (-540.790) (-542.822) -- 0:00:41
252000 -- [-538.177] (-539.984) (-541.321) (-540.884) * (-538.708) (-541.808) [-539.125] (-540.297) -- 0:00:44
252500 -- (-543.780) [-539.120] (-542.244) (-541.763) * (-538.933) (-540.402) [-538.056] (-539.696) -- 0:00:44
253000 -- (-542.203) (-545.284) [-539.825] (-542.728) * (-539.157) (-543.165) [-539.190] (-543.732) -- 0:00:44
253500 -- (-540.157) (-545.378) [-543.194] (-544.474) * (-543.374) [-540.763] (-538.404) (-542.667) -- 0:00:44
254000 -- (-539.160) [-538.942] (-543.060) (-542.537) * (-544.029) (-543.209) [-539.876] (-539.894) -- 0:00:44
254500 -- (-538.644) [-538.379] (-539.059) (-538.411) * (-538.883) (-540.375) (-542.858) [-541.815] -- 0:00:43
255000 -- (-539.913) (-538.843) (-541.036) [-539.130] * [-539.783] (-540.174) (-540.612) (-543.910) -- 0:00:43
Average standard deviation of split frequencies: 0.010926
255500 -- (-543.690) (-542.588) [-545.188] (-539.001) * (-538.991) (-541.489) (-538.345) [-545.379] -- 0:00:43
256000 -- (-542.912) (-545.421) (-541.475) [-538.408] * (-538.186) [-541.122] (-540.090) (-543.283) -- 0:00:43
256500 -- (-540.822) (-541.677) (-540.022) [-539.230] * (-541.029) (-544.567) (-540.341) [-539.984] -- 0:00:43
257000 -- (-539.672) (-540.457) [-540.961] (-539.411) * (-538.157) [-542.338] (-540.760) (-540.678) -- 0:00:43
257500 -- (-539.043) (-539.414) (-542.659) [-539.475] * (-540.005) (-540.732) (-543.958) [-540.507] -- 0:00:43
258000 -- (-540.048) [-539.169] (-542.673) (-539.404) * (-539.939) (-540.504) [-542.973] (-540.600) -- 0:00:43
258500 -- (-540.372) (-539.111) [-538.653] (-542.232) * (-539.142) (-540.853) (-539.923) [-538.437] -- 0:00:43
259000 -- [-538.691] (-541.041) (-541.456) (-539.233) * (-539.024) (-543.467) [-539.331] (-541.277) -- 0:00:42
259500 -- (-539.132) [-539.981] (-541.548) (-542.943) * (-539.739) (-540.987) [-539.414] (-541.570) -- 0:00:42
260000 -- (-539.487) [-539.905] (-540.276) (-538.076) * (-540.481) [-541.439] (-538.733) (-539.960) -- 0:00:42
Average standard deviation of split frequencies: 0.010971
260500 -- (-540.574) (-539.486) [-537.892] (-545.557) * (-538.870) [-547.958] (-540.347) (-539.691) -- 0:00:42
261000 -- (-538.922) (-544.237) (-539.992) [-539.105] * (-538.667) [-541.510] (-538.382) (-539.343) -- 0:00:42
261500 -- (-539.621) (-542.791) [-540.548] (-541.197) * (-539.734) [-543.233] (-537.796) (-539.775) -- 0:00:42
262000 -- (-540.799) (-539.328) [-541.901] (-539.790) * [-545.411] (-539.272) (-538.576) (-540.317) -- 0:00:42
262500 -- (-540.202) (-539.854) [-539.608] (-546.437) * (-543.014) (-541.336) [-538.497] (-541.195) -- 0:00:42
263000 -- (-539.286) [-544.029] (-541.690) (-539.134) * (-540.571) (-538.411) (-545.867) [-540.399] -- 0:00:42
263500 -- (-540.763) (-541.086) (-546.601) [-541.243] * (-538.485) [-538.702] (-543.068) (-539.407) -- 0:00:41
264000 -- (-542.861) (-541.224) (-541.459) [-541.580] * (-538.667) (-543.051) [-539.473] (-537.885) -- 0:00:41
264500 -- (-543.285) [-541.481] (-542.213) (-540.056) * (-542.969) [-542.245] (-543.396) (-538.064) -- 0:00:41
265000 -- (-540.789) (-541.693) (-540.061) [-540.791] * [-541.550] (-539.358) (-539.157) (-538.964) -- 0:00:41
Average standard deviation of split frequencies: 0.012051
265500 -- (-539.611) (-541.892) (-539.199) [-539.669] * (-541.183) (-539.458) (-540.494) [-539.664] -- 0:00:41
266000 -- (-540.718) (-539.996) (-543.272) [-539.520] * (-540.357) [-540.375] (-543.250) (-538.831) -- 0:00:41
266500 -- (-541.455) (-539.854) [-540.950] (-538.785) * [-538.817] (-541.156) (-540.119) (-538.545) -- 0:00:41
267000 -- [-539.791] (-539.698) (-538.415) (-541.726) * (-539.025) [-540.662] (-541.912) (-541.516) -- 0:00:41
267500 -- (-539.456) (-541.746) (-539.108) [-541.002] * [-541.361] (-540.244) (-540.477) (-538.092) -- 0:00:41
268000 -- [-539.209] (-542.978) (-538.529) (-541.976) * (-539.234) (-539.326) (-540.507) [-539.067] -- 0:00:40
268500 -- (-540.809) [-545.763] (-539.529) (-538.722) * (-539.314) (-541.066) (-540.693) [-543.090] -- 0:00:40
269000 -- [-542.190] (-538.631) (-539.146) (-542.676) * [-541.082] (-538.303) (-538.109) (-538.780) -- 0:00:43
269500 -- [-539.533] (-540.218) (-543.593) (-540.690) * (-538.557) [-539.580] (-539.323) (-539.403) -- 0:00:43
270000 -- (-539.949) (-538.736) (-538.873) [-538.118] * (-541.309) (-540.917) (-539.975) [-539.744] -- 0:00:43
Average standard deviation of split frequencies: 0.011727
270500 -- (-541.490) [-538.813] (-541.500) (-539.989) * (-539.168) (-539.066) (-538.668) [-538.429] -- 0:00:43
271000 -- (-541.994) [-538.622] (-539.208) (-538.848) * (-539.828) [-540.901] (-539.606) (-542.734) -- 0:00:43
271500 -- [-540.529] (-539.250) (-539.385) (-538.885) * (-543.142) [-538.805] (-539.362) (-545.825) -- 0:00:42
272000 -- (-538.803) (-540.530) (-541.893) [-540.115] * (-540.266) [-541.152] (-539.428) (-542.683) -- 0:00:42
272500 -- [-538.956] (-540.094) (-541.583) (-539.163) * [-538.682] (-538.404) (-539.703) (-541.400) -- 0:00:42
273000 -- (-542.702) (-542.829) [-541.052] (-540.569) * [-538.422] (-540.663) (-543.621) (-539.825) -- 0:00:42
273500 -- (-538.588) (-538.154) [-541.004] (-544.111) * [-540.951] (-544.052) (-541.072) (-538.877) -- 0:00:42
274000 -- (-538.772) (-540.812) (-539.553) [-538.317] * (-543.512) (-540.706) (-541.218) [-541.538] -- 0:00:42
274500 -- [-541.418] (-539.095) (-538.019) (-540.919) * (-539.507) (-543.069) [-538.729] (-540.190) -- 0:00:42
275000 -- (-539.385) (-540.879) [-538.211] (-540.794) * (-539.292) (-538.743) [-539.182] (-540.419) -- 0:00:42
Average standard deviation of split frequencies: 0.010931
275500 -- (-538.952) (-543.908) [-539.764] (-541.173) * (-543.364) (-539.342) [-540.471] (-544.362) -- 0:00:42
276000 -- (-543.472) [-540.807] (-540.856) (-539.796) * (-541.585) [-539.494] (-538.766) (-542.186) -- 0:00:41
276500 -- (-543.785) (-539.823) [-543.738] (-541.767) * (-540.643) [-542.563] (-541.088) (-540.629) -- 0:00:41
277000 -- (-541.094) (-540.495) (-542.248) [-539.858] * (-539.261) [-538.919] (-539.713) (-541.613) -- 0:00:41
277500 -- [-539.253] (-542.284) (-541.421) (-545.224) * (-538.702) (-539.326) [-537.995] (-541.131) -- 0:00:41
278000 -- [-541.408] (-542.042) (-540.501) (-539.984) * (-540.069) (-542.105) (-538.474) [-538.598] -- 0:00:41
278500 -- (-538.339) (-539.836) [-542.403] (-539.683) * (-539.077) (-540.977) [-539.659] (-543.053) -- 0:00:41
279000 -- (-538.165) (-542.160) [-541.889] (-539.909) * (-539.768) [-539.230] (-541.864) (-544.732) -- 0:00:41
279500 -- [-537.830] (-541.285) (-541.426) (-540.117) * (-542.583) (-542.667) (-542.333) [-540.427] -- 0:00:41
280000 -- [-540.445] (-540.008) (-539.708) (-540.844) * (-540.660) (-539.359) (-539.005) [-540.321] -- 0:00:41
Average standard deviation of split frequencies: 0.009406
280500 -- (-539.426) [-538.601] (-538.208) (-541.379) * (-542.624) [-540.057] (-540.617) (-539.264) -- 0:00:41
281000 -- (-540.480) [-542.595] (-539.761) (-539.558) * (-539.174) (-540.041) (-541.863) [-538.883] -- 0:00:40
281500 -- (-540.612) [-538.952] (-539.583) (-539.595) * (-539.908) [-540.272] (-540.399) (-540.337) -- 0:00:40
282000 -- (-542.215) [-539.362] (-539.428) (-541.264) * (-539.454) [-538.911] (-542.054) (-538.573) -- 0:00:40
282500 -- (-539.393) (-539.468) (-540.818) [-541.464] * (-538.668) (-540.637) [-539.809] (-540.119) -- 0:00:40
283000 -- [-543.403] (-541.573) (-539.469) (-540.245) * [-540.432] (-538.956) (-540.571) (-541.504) -- 0:00:40
283500 -- (-540.704) [-540.963] (-539.293) (-540.023) * [-539.100] (-538.942) (-539.682) (-541.781) -- 0:00:40
284000 -- [-538.354] (-543.568) (-541.758) (-542.569) * (-542.074) [-538.517] (-538.342) (-539.232) -- 0:00:40
284500 -- (-539.955) [-541.685] (-544.512) (-541.890) * [-539.689] (-538.873) (-540.606) (-541.187) -- 0:00:40
285000 -- (-540.385) (-541.967) [-539.954] (-542.521) * (-544.311) (-542.836) (-542.463) [-541.520] -- 0:00:40
Average standard deviation of split frequencies: 0.010405
285500 -- (-538.330) [-542.518] (-539.306) (-546.360) * (-543.075) (-538.449) [-539.878] (-541.590) -- 0:00:40
286000 -- (-539.981) [-542.434] (-540.981) (-543.925) * (-540.389) (-540.139) (-538.435) [-539.067] -- 0:00:39
286500 -- (-541.283) (-544.392) (-539.403) [-545.036] * [-539.649] (-539.792) (-539.246) (-540.560) -- 0:00:42
287000 -- (-538.739) (-540.950) [-540.638] (-544.487) * (-540.559) (-542.539) (-540.950) [-540.467] -- 0:00:42
287500 -- (-542.338) (-541.135) [-542.167] (-539.668) * (-541.081) (-539.722) [-538.864] (-540.728) -- 0:00:42
288000 -- (-541.745) (-539.514) (-543.024) [-540.623] * (-541.583) (-538.888) (-539.038) [-539.921] -- 0:00:42
288500 -- [-540.193] (-541.544) (-538.468) (-541.758) * [-543.192] (-538.185) (-539.709) (-541.730) -- 0:00:41
289000 -- (-541.226) (-539.657) [-541.065] (-540.440) * [-540.534] (-540.891) (-543.813) (-538.744) -- 0:00:41
289500 -- [-540.737] (-539.487) (-544.275) (-539.007) * [-539.911] (-541.391) (-544.938) (-540.051) -- 0:00:41
290000 -- (-539.378) [-538.912] (-542.106) (-539.931) * (-542.316) [-541.408] (-539.947) (-540.317) -- 0:00:41
Average standard deviation of split frequencies: 0.010035
290500 -- (-540.812) [-540.708] (-539.496) (-539.332) * [-539.537] (-542.218) (-541.740) (-539.453) -- 0:00:41
291000 -- (-538.647) (-541.975) (-541.632) [-540.121] * (-542.532) (-538.803) (-538.903) [-542.667] -- 0:00:41
291500 -- (-540.669) (-540.110) [-539.140] (-541.611) * (-540.409) [-538.569] (-542.614) (-539.254) -- 0:00:41
292000 -- (-539.751) (-540.536) (-540.538) [-538.606] * [-538.648] (-540.487) (-542.859) (-538.814) -- 0:00:41
292500 -- (-539.013) (-539.923) (-538.453) [-538.618] * (-541.519) (-541.490) (-541.106) [-539.740] -- 0:00:41
293000 -- (-542.796) (-540.567) (-539.432) [-538.435] * (-541.290) [-539.653] (-537.783) (-542.243) -- 0:00:41
293500 -- [-539.858] (-540.592) (-542.291) (-543.077) * [-539.553] (-540.005) (-542.259) (-546.642) -- 0:00:40
294000 -- (-538.888) [-539.860] (-541.334) (-541.686) * (-540.137) [-539.973] (-541.540) (-540.437) -- 0:00:40
294500 -- (-538.470) [-540.507] (-540.526) (-545.307) * (-540.824) (-541.948) [-538.292] (-539.951) -- 0:00:40
295000 -- (-542.276) (-540.175) (-538.940) [-542.844] * (-540.587) (-541.167) (-543.260) [-541.528] -- 0:00:40
Average standard deviation of split frequencies: 0.010053
295500 -- (-540.363) (-543.663) [-540.467] (-544.287) * (-541.380) [-538.372] (-543.279) (-540.459) -- 0:00:40
296000 -- (-539.486) [-539.523] (-539.681) (-538.719) * (-540.499) (-542.252) (-540.119) [-541.701] -- 0:00:40
296500 -- (-539.970) (-544.884) (-544.771) [-539.528] * [-538.718] (-539.234) (-539.319) (-541.728) -- 0:00:40
297000 -- (-540.175) (-539.261) (-541.071) [-538.721] * (-540.378) [-542.114] (-540.233) (-539.940) -- 0:00:40
297500 -- [-539.381] (-539.423) (-543.062) (-542.861) * (-540.120) (-544.046) (-538.553) [-538.470] -- 0:00:40
298000 -- [-539.826] (-541.727) (-544.236) (-539.035) * (-539.533) (-540.658) (-539.235) [-540.933] -- 0:00:40
298500 -- (-539.536) [-540.240] (-538.871) (-543.615) * (-539.988) (-542.793) (-539.261) [-540.985] -- 0:00:39
299000 -- [-540.016] (-540.269) (-539.576) (-541.151) * [-539.003] (-541.639) (-539.058) (-539.425) -- 0:00:39
299500 -- [-538.044] (-538.343) (-541.015) (-540.517) * [-538.694] (-539.817) (-538.076) (-541.408) -- 0:00:39
300000 -- (-542.304) [-542.684] (-540.451) (-541.661) * (-539.722) (-541.992) [-538.656] (-544.207) -- 0:00:39
Average standard deviation of split frequencies: 0.009701
300500 -- (-541.318) (-542.009) (-539.964) [-543.542] * (-540.641) (-539.717) [-538.097] (-540.590) -- 0:00:39
301000 -- (-542.700) (-540.874) (-539.792) [-538.891] * (-540.302) (-538.306) [-543.737] (-545.753) -- 0:00:39
301500 -- (-540.649) [-539.797] (-539.732) (-539.308) * (-539.220) (-538.399) (-538.450) [-542.321] -- 0:00:39
302000 -- (-543.653) [-540.116] (-544.178) (-538.786) * (-541.798) (-538.441) [-544.964] (-540.304) -- 0:00:39
302500 -- (-541.065) (-541.590) (-542.991) [-539.303] * [-539.971] (-541.952) (-538.960) (-540.659) -- 0:00:39
303000 -- (-539.984) [-539.477] (-541.510) (-541.526) * (-539.969) (-540.759) [-543.686] (-538.632) -- 0:00:39
303500 -- (-539.118) [-538.821] (-538.535) (-541.088) * (-538.830) (-541.232) (-541.783) [-538.373] -- 0:00:41
304000 -- (-541.072) (-540.976) [-539.596] (-541.390) * [-538.333] (-538.071) (-539.634) (-544.464) -- 0:00:41
304500 -- (-541.626) [-542.615] (-540.784) (-541.115) * (-540.837) (-540.097) (-542.065) [-541.314] -- 0:00:41
305000 -- (-542.838) [-540.745] (-539.746) (-541.063) * (-539.098) (-542.756) [-538.565] (-544.692) -- 0:00:41
Average standard deviation of split frequencies: 0.010399
305500 -- (-539.377) (-538.803) [-542.892] (-541.715) * (-542.249) (-542.077) [-539.284] (-541.136) -- 0:00:40
306000 -- (-543.251) [-540.378] (-541.763) (-540.391) * (-542.756) (-542.124) [-542.045] (-538.694) -- 0:00:40
306500 -- [-538.408] (-542.076) (-544.184) (-539.325) * (-539.606) (-538.826) [-541.457] (-539.075) -- 0:00:40
307000 -- (-541.896) [-539.899] (-540.626) (-542.481) * (-540.387) (-540.684) [-540.620] (-538.521) -- 0:00:40
307500 -- (-538.954) (-540.059) [-545.307] (-538.754) * (-539.299) [-538.664] (-543.533) (-540.808) -- 0:00:40
308000 -- (-539.495) [-538.235] (-539.081) (-538.625) * (-542.724) [-540.202] (-545.857) (-541.030) -- 0:00:40
308500 -- (-540.090) (-539.679) [-538.016] (-540.119) * (-539.269) [-539.116] (-545.776) (-542.966) -- 0:00:40
309000 -- (-542.460) (-540.527) (-542.090) [-541.039] * [-539.139] (-545.566) (-542.604) (-541.232) -- 0:00:40
309500 -- [-539.103] (-541.876) (-541.032) (-538.721) * (-539.685) (-540.769) (-545.038) [-541.099] -- 0:00:40
310000 -- (-540.063) (-541.055) (-539.494) [-538.065] * [-538.559] (-545.886) (-540.845) (-541.004) -- 0:00:40
Average standard deviation of split frequencies: 0.010811
310500 -- (-539.826) (-538.766) (-541.242) [-544.803] * [-539.243] (-541.665) (-540.142) (-540.902) -- 0:00:39
311000 -- (-542.121) [-538.402] (-538.275) (-539.796) * (-538.963) (-541.358) (-540.157) [-538.557] -- 0:00:39
311500 -- (-546.338) [-541.943] (-539.126) (-541.525) * [-538.099] (-540.929) (-539.472) (-540.856) -- 0:00:39
312000 -- (-541.050) [-539.088] (-538.711) (-552.004) * [-538.637] (-545.945) (-540.877) (-540.471) -- 0:00:39
312500 -- (-538.901) [-540.807] (-538.093) (-544.235) * (-541.277) (-539.661) (-538.286) [-542.560] -- 0:00:39
313000 -- [-540.716] (-543.668) (-540.132) (-539.994) * (-539.578) (-551.321) [-538.687] (-546.354) -- 0:00:39
313500 -- (-538.940) (-538.327) (-539.138) [-539.943] * (-540.426) (-540.660) (-538.844) [-540.935] -- 0:00:39
314000 -- (-539.531) (-541.106) (-543.908) [-540.652] * (-540.105) (-539.219) [-539.488] (-541.269) -- 0:00:39
314500 -- [-539.028] (-543.783) (-545.214) (-540.246) * [-541.241] (-538.105) (-540.231) (-541.761) -- 0:00:39
315000 -- (-540.648) (-541.070) [-539.321] (-541.056) * (-540.937) (-545.673) [-541.348] (-541.775) -- 0:00:39
Average standard deviation of split frequencies: 0.011095
315500 -- (-542.435) (-539.313) [-539.458] (-542.173) * [-539.978] (-541.268) (-541.420) (-542.613) -- 0:00:39
316000 -- (-541.344) (-540.671) [-541.081] (-544.162) * [-540.590] (-542.034) (-539.354) (-541.688) -- 0:00:38
316500 -- (-538.944) [-539.780] (-537.780) (-539.478) * (-540.852) (-539.173) [-539.560] (-540.230) -- 0:00:38
317000 -- (-548.157) [-540.919] (-539.460) (-539.911) * (-542.249) (-541.751) (-539.218) [-539.186] -- 0:00:38
317500 -- (-543.350) [-540.523] (-545.602) (-541.000) * [-538.653] (-541.961) (-540.410) (-540.423) -- 0:00:38
318000 -- (-539.781) (-540.887) [-543.396] (-538.743) * (-540.529) (-539.808) [-538.693] (-540.540) -- 0:00:38
318500 -- (-540.353) (-545.290) [-539.069] (-545.727) * [-538.910] (-542.389) (-538.671) (-540.367) -- 0:00:38
319000 -- (-538.908) (-543.425) (-538.730) [-540.017] * [-539.067] (-539.192) (-539.488) (-540.351) -- 0:00:38
319500 -- (-548.894) (-542.272) (-541.190) [-538.131] * (-543.056) [-539.423] (-539.884) (-540.085) -- 0:00:38
320000 -- [-539.182] (-538.543) (-539.309) (-539.785) * (-544.202) [-538.474] (-539.092) (-538.620) -- 0:00:38
Average standard deviation of split frequencies: 0.013231
320500 -- (-541.084) (-539.484) [-542.863] (-538.853) * (-543.835) [-538.716] (-539.539) (-545.486) -- 0:00:40
321000 -- (-539.486) (-540.078) (-540.113) [-541.790] * (-543.448) (-540.971) [-540.583] (-539.450) -- 0:00:40
321500 -- (-539.099) (-541.867) (-542.311) [-539.538] * [-539.803] (-543.161) (-541.079) (-543.853) -- 0:00:40
322000 -- (-541.634) (-540.489) [-538.763] (-538.786) * (-541.022) [-539.740] (-539.762) (-538.889) -- 0:00:40
322500 -- (-541.200) (-543.135) (-540.222) [-539.519] * (-541.913) [-540.395] (-538.426) (-538.880) -- 0:00:39
323000 -- [-540.337] (-540.297) (-541.767) (-539.569) * [-540.565] (-540.408) (-540.432) (-539.538) -- 0:00:39
323500 -- [-539.807] (-542.342) (-540.800) (-542.534) * (-540.172) [-539.727] (-538.703) (-543.164) -- 0:00:39
324000 -- [-539.152] (-539.547) (-538.511) (-538.635) * (-540.740) (-542.374) (-538.240) [-539.297] -- 0:00:39
324500 -- [-538.989] (-538.409) (-540.813) (-540.222) * (-538.757) (-540.450) (-538.659) [-537.904] -- 0:00:39
325000 -- (-538.326) (-540.669) (-546.444) [-539.315] * (-538.405) (-542.818) [-546.210] (-539.295) -- 0:00:39
Average standard deviation of split frequencies: 0.013285
325500 -- [-538.141] (-538.909) (-539.778) (-542.876) * (-538.597) [-539.518] (-540.975) (-540.426) -- 0:00:39
326000 -- [-539.944] (-541.283) (-540.051) (-541.210) * (-539.915) [-539.386] (-543.972) (-542.302) -- 0:00:39
326500 -- [-541.228] (-540.721) (-538.853) (-538.568) * (-538.937) [-539.147] (-540.165) (-540.681) -- 0:00:39
327000 -- (-545.343) (-541.509) [-539.964] (-540.034) * (-539.868) (-538.262) [-540.904] (-538.978) -- 0:00:39
327500 -- (-540.143) [-541.429] (-538.734) (-540.157) * (-540.893) [-540.273] (-541.185) (-542.010) -- 0:00:39
328000 -- (-541.034) (-541.648) [-542.259] (-539.597) * (-540.874) (-539.949) (-538.888) [-539.637] -- 0:00:38
328500 -- (-542.743) (-544.077) (-540.966) [-539.693] * (-545.445) (-542.933) [-538.398] (-539.248) -- 0:00:38
329000 -- [-538.718] (-539.420) (-541.738) (-540.841) * (-539.951) (-543.402) (-538.862) [-543.047] -- 0:00:38
329500 -- (-538.458) (-540.177) (-541.336) [-540.288] * (-540.789) (-538.626) (-538.372) [-544.247] -- 0:00:38
330000 -- (-538.458) (-540.214) (-538.538) [-543.623] * (-540.740) [-538.585] (-540.014) (-541.317) -- 0:00:38
Average standard deviation of split frequencies: 0.013686
330500 -- (-538.729) (-545.001) (-543.858) [-542.282] * (-540.317) (-539.496) (-540.905) [-543.575] -- 0:00:38
331000 -- (-540.928) [-539.404] (-544.941) (-540.749) * (-540.290) [-538.560] (-539.467) (-543.512) -- 0:00:38
331500 -- (-540.518) [-538.351] (-538.220) (-542.152) * (-540.703) (-539.692) [-542.072] (-541.230) -- 0:00:38
332000 -- (-540.343) [-540.484] (-539.988) (-539.233) * (-540.133) (-538.798) (-540.514) [-542.277] -- 0:00:38
332500 -- (-542.217) (-538.066) (-541.408) [-538.516] * [-539.270] (-537.984) (-539.554) (-541.067) -- 0:00:38
333000 -- [-540.742] (-541.209) (-542.006) (-539.069) * (-539.880) [-540.974] (-538.570) (-542.303) -- 0:00:38
333500 -- (-539.480) (-544.146) [-540.611] (-538.368) * [-541.147] (-540.703) (-539.616) (-541.271) -- 0:00:37
334000 -- [-542.107] (-542.862) (-540.702) (-540.659) * (-545.635) (-540.830) (-538.296) [-540.098] -- 0:00:37
334500 -- (-538.187) (-541.297) (-540.222) [-540.364] * (-538.728) (-544.638) (-539.149) [-541.818] -- 0:00:37
335000 -- (-538.626) [-538.257] (-540.583) (-542.058) * (-543.553) (-539.386) (-539.824) [-539.718] -- 0:00:37
Average standard deviation of split frequencies: 0.013241
335500 -- (-539.166) (-538.857) (-543.124) [-540.278] * (-540.533) (-542.809) (-539.482) [-543.325] -- 0:00:37
336000 -- (-539.008) [-538.846] (-539.564) (-538.075) * (-540.895) (-540.158) [-540.142] (-541.326) -- 0:00:37
336500 -- (-538.849) (-539.130) [-538.826] (-539.875) * (-541.440) (-541.129) (-539.945) [-540.951] -- 0:00:37
337000 -- (-538.481) [-540.408] (-539.420) (-538.240) * (-542.147) (-539.695) (-541.818) [-540.536] -- 0:00:37
337500 -- [-538.845] (-539.339) (-539.590) (-540.481) * [-538.583] (-540.647) (-540.397) (-542.050) -- 0:00:37
338000 -- (-540.999) [-540.034] (-543.260) (-548.641) * (-540.565) [-543.698] (-542.851) (-539.461) -- 0:00:39
338500 -- (-542.023) (-539.996) [-540.673] (-540.594) * (-538.667) (-543.204) (-540.466) [-540.204] -- 0:00:39
339000 -- (-540.340) (-542.436) (-539.994) [-542.201] * (-539.441) (-539.646) (-544.551) [-538.913] -- 0:00:38
339500 -- (-542.525) (-548.701) [-538.933] (-540.886) * (-539.466) [-538.048] (-540.956) (-542.937) -- 0:00:38
340000 -- [-538.912] (-544.825) (-540.470) (-540.367) * [-540.756] (-540.097) (-542.932) (-540.436) -- 0:00:38
Average standard deviation of split frequencies: 0.013405
340500 -- (-540.802) (-544.493) [-540.662] (-543.309) * (-539.177) (-540.841) (-539.810) [-540.689] -- 0:00:38
341000 -- [-540.231] (-540.704) (-540.612) (-542.422) * (-543.658) (-540.309) (-538.970) [-540.568] -- 0:00:38
341500 -- [-541.562] (-539.947) (-542.265) (-539.769) * [-540.162] (-541.626) (-540.036) (-540.535) -- 0:00:38
342000 -- (-541.942) (-541.415) [-541.659] (-539.376) * (-542.538) (-545.453) [-539.379] (-542.182) -- 0:00:38
342500 -- (-539.398) (-541.403) [-540.362] (-539.996) * [-544.157] (-541.081) (-538.981) (-543.528) -- 0:00:38
343000 -- (-539.214) [-539.667] (-539.141) (-540.641) * (-541.156) (-540.191) [-540.090] (-541.884) -- 0:00:38
343500 -- (-542.915) (-540.670) [-540.631] (-539.380) * (-543.750) (-541.632) (-540.570) [-541.160] -- 0:00:38
344000 -- (-538.520) (-539.523) [-539.755] (-540.274) * (-541.602) (-540.241) [-539.251] (-540.171) -- 0:00:38
344500 -- [-541.186] (-539.232) (-543.718) (-542.829) * (-538.926) (-539.751) [-539.603] (-541.339) -- 0:00:38
345000 -- (-538.000) (-540.287) [-540.102] (-541.776) * [-541.648] (-541.728) (-538.677) (-539.945) -- 0:00:37
Average standard deviation of split frequencies: 0.013710
345500 -- (-539.334) (-538.894) [-540.844] (-538.751) * (-545.594) [-543.822] (-543.741) (-539.589) -- 0:00:37
346000 -- (-545.521) [-538.790] (-538.554) (-540.097) * [-543.169] (-540.316) (-541.136) (-540.397) -- 0:00:37
346500 -- (-545.988) (-539.774) [-541.388] (-539.707) * [-540.476] (-543.393) (-540.463) (-538.726) -- 0:00:37
347000 -- (-542.190) (-540.936) (-541.080) [-542.834] * [-539.590] (-540.983) (-541.965) (-538.424) -- 0:00:37
347500 -- [-539.331] (-540.247) (-539.899) (-541.872) * (-538.243) (-541.491) (-541.502) [-541.589] -- 0:00:37
348000 -- (-541.977) [-539.416] (-538.945) (-539.029) * [-538.606] (-539.337) (-542.633) (-538.629) -- 0:00:37
348500 -- (-539.460) (-540.366) (-540.245) [-539.911] * (-538.362) [-542.457] (-539.127) (-538.991) -- 0:00:37
349000 -- (-541.777) (-540.076) (-539.181) [-540.931] * (-539.672) (-539.616) [-539.627] (-542.079) -- 0:00:37
349500 -- (-541.957) (-538.843) (-539.125) [-545.136] * (-539.234) (-542.704) (-540.989) [-540.496] -- 0:00:37
350000 -- (-539.900) (-539.053) [-539.055] (-543.252) * (-541.542) (-545.586) [-540.368] (-538.307) -- 0:00:37
Average standard deviation of split frequencies: 0.013107
350500 -- (-541.403) [-542.339] (-539.780) (-541.911) * (-540.322) (-541.247) [-540.237] (-538.645) -- 0:00:37
351000 -- (-540.613) (-539.253) [-540.454] (-544.087) * (-542.088) (-539.716) (-538.963) [-538.448] -- 0:00:36
351500 -- (-539.628) (-538.939) [-538.072] (-545.287) * [-543.146] (-538.618) (-538.659) (-541.875) -- 0:00:36
352000 -- [-544.012] (-538.398) (-540.854) (-540.330) * (-538.969) [-537.998] (-540.970) (-539.314) -- 0:00:36
352500 -- (-538.496) [-538.678] (-543.650) (-540.075) * (-538.965) (-539.667) (-539.376) [-539.680] -- 0:00:36
353000 -- (-538.540) (-540.590) (-541.126) [-539.083] * (-538.558) (-539.949) (-539.420) [-538.712] -- 0:00:36
353500 -- [-539.347] (-539.014) (-540.177) (-539.296) * (-538.355) (-546.731) [-544.412] (-539.325) -- 0:00:36
354000 -- (-540.713) [-538.712] (-542.495) (-538.876) * [-539.849] (-542.041) (-543.062) (-541.382) -- 0:00:38
354500 -- (-539.428) [-539.728] (-540.152) (-540.470) * [-538.126] (-540.549) (-539.328) (-541.325) -- 0:00:38
355000 -- (-541.610) (-539.541) [-539.620] (-541.354) * (-538.457) (-540.894) (-541.516) [-540.974] -- 0:00:38
Average standard deviation of split frequencies: 0.013904
355500 -- (-541.217) [-544.664] (-540.331) (-538.173) * (-540.099) [-539.794] (-546.193) (-539.746) -- 0:00:38
356000 -- (-543.829) (-541.242) (-539.696) [-540.665] * [-539.980] (-540.021) (-538.308) (-542.712) -- 0:00:37
356500 -- (-540.006) (-541.220) (-540.007) [-539.864] * (-541.138) (-541.032) [-541.394] (-539.371) -- 0:00:37
357000 -- [-539.727] (-542.558) (-539.946) (-539.604) * (-539.856) (-542.479) [-541.432] (-543.277) -- 0:00:37
357500 -- (-539.058) (-539.326) (-541.210) [-540.643] * (-541.028) (-540.874) (-539.201) [-538.791] -- 0:00:37
358000 -- (-540.877) (-543.006) (-540.319) [-538.183] * (-545.047) (-542.348) (-538.462) [-538.310] -- 0:00:37
358500 -- [-541.351] (-541.177) (-543.785) (-540.426) * (-540.846) [-541.550] (-540.355) (-540.603) -- 0:00:37
359000 -- (-539.468) (-541.410) (-540.457) [-540.961] * (-542.481) [-540.173] (-542.331) (-540.404) -- 0:00:37
359500 -- (-539.096) (-539.576) [-537.912] (-538.951) * [-541.960] (-541.836) (-543.986) (-540.817) -- 0:00:37
360000 -- (-539.040) [-538.085] (-541.454) (-538.638) * (-542.395) (-540.974) [-543.916] (-539.454) -- 0:00:37
Average standard deviation of split frequencies: 0.014051
360500 -- [-540.714] (-538.209) (-540.555) (-539.441) * (-542.571) [-541.551] (-538.345) (-540.991) -- 0:00:37
361000 -- (-540.757) [-543.239] (-538.177) (-537.999) * (-539.417) (-540.047) (-539.478) [-539.336] -- 0:00:37
361500 -- (-539.891) (-544.749) [-540.964] (-538.445) * (-540.381) (-540.576) (-539.509) [-540.175] -- 0:00:37
362000 -- (-540.910) [-539.551] (-541.534) (-538.718) * (-543.760) [-539.296] (-540.967) (-538.775) -- 0:00:37
362500 -- (-542.204) (-539.047) (-538.106) [-539.719] * (-543.899) (-541.910) [-542.360] (-544.011) -- 0:00:36
363000 -- (-538.909) (-538.626) [-539.353] (-540.074) * [-542.237] (-539.097) (-541.512) (-541.144) -- 0:00:36
363500 -- [-541.639] (-538.741) (-539.101) (-543.766) * [-538.525] (-538.503) (-543.341) (-541.641) -- 0:00:36
364000 -- [-540.220] (-538.718) (-540.095) (-543.071) * (-545.032) (-538.151) [-543.748] (-539.160) -- 0:00:36
364500 -- (-538.724) (-539.786) [-538.921] (-543.095) * (-540.947) [-538.635] (-553.290) (-538.616) -- 0:00:36
365000 -- (-539.007) (-542.215) (-540.011) [-542.765] * [-538.678] (-541.396) (-541.201) (-539.987) -- 0:00:36
Average standard deviation of split frequencies: 0.014973
365500 -- (-539.100) (-540.646) [-538.122] (-542.514) * (-538.609) [-539.870] (-540.524) (-541.470) -- 0:00:36
366000 -- [-537.702] (-540.141) (-543.894) (-539.210) * [-539.331] (-539.817) (-539.422) (-538.389) -- 0:00:36
366500 -- (-538.217) (-541.229) (-542.452) [-538.428] * (-540.504) [-539.787] (-539.260) (-539.094) -- 0:00:36
367000 -- (-541.658) (-539.309) (-540.470) [-541.504] * (-539.091) (-543.454) [-541.270] (-540.669) -- 0:00:36
367500 -- (-546.272) (-539.285) [-540.134] (-538.769) * (-540.499) (-539.555) [-541.360] (-540.561) -- 0:00:36
368000 -- [-539.214] (-540.141) (-540.553) (-539.704) * (-540.225) (-538.975) (-538.248) [-539.096] -- 0:00:36
368500 -- (-541.860) (-538.562) [-542.053] (-544.199) * (-540.666) (-540.331) (-539.243) [-539.128] -- 0:00:37
369000 -- (-540.847) (-538.543) (-540.502) [-538.170] * (-540.557) (-541.431) [-539.109] (-541.664) -- 0:00:37
369500 -- [-540.419] (-539.740) (-540.877) (-540.023) * [-543.420] (-541.249) (-541.227) (-541.629) -- 0:00:37
370000 -- (-538.679) (-539.211) [-539.254] (-541.117) * (-540.799) (-540.265) [-541.164] (-539.658) -- 0:00:37
Average standard deviation of split frequencies: 0.015023
370500 -- (-540.704) [-540.707] (-538.818) (-538.831) * [-541.780] (-545.492) (-540.807) (-538.180) -- 0:00:37
371000 -- (-540.748) (-541.688) [-538.657] (-539.064) * (-543.791) (-543.985) (-542.988) [-539.474] -- 0:00:37
371500 -- (-541.198) (-546.133) (-538.375) [-538.841] * (-543.821) [-542.375] (-539.748) (-538.587) -- 0:00:37
372000 -- (-541.330) (-539.735) (-542.530) [-540.538] * [-542.785] (-541.654) (-540.335) (-539.912) -- 0:00:37
372500 -- (-539.936) (-541.188) (-540.703) [-540.522] * [-538.834] (-540.756) (-541.078) (-540.949) -- 0:00:37
373000 -- (-539.946) (-539.610) (-540.882) [-542.840] * [-538.716] (-540.601) (-540.640) (-539.739) -- 0:00:36
373500 -- (-540.647) (-541.414) [-540.058] (-539.483) * (-538.457) (-541.240) [-539.684] (-541.381) -- 0:00:36
374000 -- [-539.014] (-543.100) (-541.115) (-539.652) * (-538.520) (-541.135) (-543.728) [-539.716] -- 0:00:36
374500 -- (-540.344) (-539.326) [-541.015] (-540.395) * (-539.473) (-542.252) [-540.568] (-540.376) -- 0:00:36
375000 -- (-542.117) [-542.915] (-543.449) (-539.995) * (-541.416) (-541.385) (-542.063) [-540.927] -- 0:00:36
Average standard deviation of split frequencies: 0.014731
375500 -- [-545.196] (-541.205) (-541.522) (-538.933) * (-539.059) (-540.386) (-543.281) [-539.347] -- 0:00:36
376000 -- (-538.920) (-539.601) [-542.078] (-540.639) * (-538.693) [-539.143] (-543.604) (-543.037) -- 0:00:36
376500 -- (-538.324) [-539.865] (-538.433) (-540.833) * [-537.814] (-540.867) (-538.855) (-540.691) -- 0:00:36
377000 -- (-540.293) [-538.946] (-540.404) (-541.848) * [-541.235] (-540.844) (-547.337) (-539.702) -- 0:00:36
377500 -- (-538.112) [-537.917] (-543.011) (-540.376) * (-541.762) [-541.446] (-540.700) (-539.167) -- 0:00:36
378000 -- (-543.208) [-538.821] (-545.468) (-538.671) * (-538.613) (-541.897) (-541.715) [-541.800] -- 0:00:36
378500 -- (-538.381) (-542.866) (-546.015) [-539.240] * (-539.300) [-539.349] (-542.844) (-540.345) -- 0:00:36
379000 -- (-540.542) (-540.819) (-539.413) [-537.761] * (-539.812) (-539.723) [-539.220] (-539.091) -- 0:00:36
379500 -- (-541.247) (-543.474) [-538.603] (-539.366) * [-538.144] (-544.815) (-539.244) (-540.184) -- 0:00:35
380000 -- (-541.655) (-540.282) (-538.438) [-542.364] * [-539.570] (-540.455) (-537.946) (-540.506) -- 0:00:35
Average standard deviation of split frequencies: 0.014009
380500 -- (-540.027) [-539.035] (-540.043) (-541.074) * (-545.274) [-541.793] (-541.139) (-538.209) -- 0:00:35
381000 -- (-542.109) [-539.735] (-538.286) (-542.984) * (-546.544) [-542.247] (-539.702) (-540.442) -- 0:00:35
381500 -- (-540.218) (-540.077) [-538.440] (-539.509) * [-539.265] (-540.516) (-539.697) (-540.441) -- 0:00:35
382000 -- [-538.921] (-540.726) (-541.646) (-538.391) * (-541.237) [-543.293] (-539.708) (-539.565) -- 0:00:35
382500 -- [-538.776] (-538.504) (-539.496) (-539.271) * (-544.530) (-541.906) [-543.145] (-542.322) -- 0:00:35
383000 -- [-538.335] (-541.435) (-539.580) (-539.405) * (-539.143) [-538.293] (-538.945) (-541.398) -- 0:00:37
383500 -- (-539.298) (-540.563) [-541.020] (-538.250) * (-538.824) [-540.323] (-543.036) (-539.803) -- 0:00:36
384000 -- (-539.627) (-538.690) [-540.268] (-541.095) * (-539.217) [-539.764] (-538.650) (-540.546) -- 0:00:36
384500 -- [-539.332] (-539.276) (-540.440) (-541.423) * (-540.168) [-538.786] (-539.879) (-539.735) -- 0:00:36
385000 -- (-541.673) [-540.583] (-543.582) (-540.192) * (-542.326) [-538.288] (-541.570) (-539.952) -- 0:00:36
Average standard deviation of split frequencies: 0.014197
385500 -- (-540.796) [-538.268] (-545.865) (-542.646) * (-539.439) (-540.493) (-541.062) [-539.980] -- 0:00:36
386000 -- (-541.221) (-540.837) [-539.497] (-547.758) * (-537.841) (-541.515) [-540.577] (-538.958) -- 0:00:36
386500 -- (-541.123) (-537.927) (-540.669) [-539.906] * (-539.892) (-540.778) [-541.502] (-540.905) -- 0:00:36
387000 -- [-540.945] (-539.762) (-540.713) (-540.424) * [-541.738] (-541.417) (-538.510) (-539.693) -- 0:00:36
387500 -- (-538.069) [-539.582] (-538.678) (-540.175) * (-539.793) (-543.196) [-540.466] (-541.598) -- 0:00:36
388000 -- [-538.763] (-539.510) (-540.470) (-540.955) * (-540.003) (-538.922) (-539.465) [-542.436] -- 0:00:36
388500 -- (-538.432) [-540.218] (-542.763) (-541.856) * [-541.059] (-543.878) (-541.721) (-540.736) -- 0:00:36
389000 -- (-539.913) [-539.357] (-539.568) (-544.178) * (-538.839) [-538.424] (-541.838) (-543.338) -- 0:00:36
389500 -- [-540.460] (-539.546) (-543.715) (-539.516) * (-539.738) (-540.442) [-541.270] (-544.042) -- 0:00:36
390000 -- (-538.658) [-541.846] (-540.299) (-538.029) * (-539.088) (-539.794) [-541.418] (-539.206) -- 0:00:35
Average standard deviation of split frequencies: 0.014782
390500 -- (-539.595) (-539.296) (-538.538) [-538.310] * (-541.069) [-539.298] (-539.092) (-541.345) -- 0:00:35
391000 -- (-540.214) (-542.456) [-539.556] (-541.150) * (-543.299) (-540.711) (-541.290) [-540.140] -- 0:00:35
391500 -- [-539.948] (-541.232) (-537.932) (-545.112) * [-542.137] (-539.700) (-539.213) (-541.870) -- 0:00:35
392000 -- (-538.411) (-538.901) [-537.748] (-539.426) * [-538.866] (-538.930) (-542.101) (-541.094) -- 0:00:35
392500 -- (-539.666) (-538.380) [-539.724] (-547.469) * (-541.183) (-540.788) (-540.252) [-541.581] -- 0:00:35
393000 -- (-538.722) [-538.571] (-540.697) (-541.691) * (-546.998) (-538.934) [-540.271] (-540.758) -- 0:00:35
393500 -- (-541.404) [-540.114] (-541.195) (-539.959) * (-548.844) (-539.530) (-538.392) [-538.819] -- 0:00:35
394000 -- (-541.919) (-539.055) [-539.727] (-539.270) * (-550.166) (-539.204) [-539.119] (-538.840) -- 0:00:35
394500 -- [-540.476] (-538.265) (-540.052) (-540.341) * (-542.853) (-542.817) (-540.037) [-537.907] -- 0:00:35
395000 -- (-541.507) (-539.320) (-540.021) [-538.800] * (-543.972) (-539.349) (-540.684) [-541.163] -- 0:00:35
Average standard deviation of split frequencies: 0.014880
395500 -- [-540.338] (-539.071) (-542.029) (-538.604) * (-542.144) (-538.646) (-542.145) [-540.082] -- 0:00:35
396000 -- [-543.313] (-538.086) (-539.005) (-540.403) * (-539.371) (-539.866) (-541.622) [-538.892] -- 0:00:35
396500 -- (-540.906) (-539.828) (-538.802) [-539.067] * [-539.425] (-538.720) (-540.521) (-541.264) -- 0:00:35
397000 -- [-540.196] (-540.182) (-539.235) (-543.101) * [-539.589] (-537.815) (-538.273) (-541.200) -- 0:00:36
397500 -- (-543.559) [-537.969] (-538.481) (-542.142) * (-538.885) (-538.089) [-539.295] (-541.425) -- 0:00:36
398000 -- [-542.384] (-541.188) (-538.376) (-540.534) * (-540.775) (-539.424) [-538.210] (-541.526) -- 0:00:36
398500 -- (-538.651) (-540.999) [-538.385] (-538.818) * [-539.587] (-539.695) (-539.431) (-540.121) -- 0:00:36
399000 -- (-541.396) (-542.856) [-539.807] (-538.697) * (-544.652) [-538.999] (-542.341) (-543.584) -- 0:00:36
399500 -- (-539.788) (-539.801) [-542.472] (-538.933) * (-540.345) (-539.689) [-539.049] (-539.158) -- 0:00:36
400000 -- (-545.155) (-543.183) (-540.005) [-542.348] * [-540.663] (-538.903) (-541.939) (-539.035) -- 0:00:36
Average standard deviation of split frequencies: 0.014413
400500 -- (-541.289) (-540.505) [-540.873] (-542.837) * (-539.897) (-539.979) (-538.672) [-539.572] -- 0:00:35
401000 -- (-539.651) [-540.970] (-540.665) (-542.006) * (-541.247) (-538.782) (-544.456) [-540.636] -- 0:00:35
401500 -- (-540.960) (-541.189) [-539.944] (-538.438) * (-544.389) (-540.525) [-540.267] (-538.619) -- 0:00:35
402000 -- (-541.369) (-540.242) (-539.725) [-538.684] * (-542.738) (-538.906) [-539.638] (-539.518) -- 0:00:35
402500 -- (-538.916) (-538.601) (-544.339) [-538.999] * [-539.968] (-539.950) (-539.476) (-539.307) -- 0:00:35
403000 -- [-539.122] (-541.702) (-543.114) (-539.457) * (-538.847) (-541.430) [-540.335] (-540.564) -- 0:00:35
403500 -- [-539.420] (-541.355) (-538.962) (-538.448) * [-542.302] (-540.837) (-541.112) (-539.631) -- 0:00:35
404000 -- (-539.056) (-538.759) (-539.567) [-541.157] * [-539.888] (-539.311) (-539.185) (-542.228) -- 0:00:35
404500 -- (-539.705) (-544.561) [-541.623] (-541.622) * (-539.023) (-539.473) (-538.859) [-539.263] -- 0:00:35
405000 -- [-538.995] (-542.286) (-540.700) (-539.515) * (-539.557) (-538.769) (-538.836) [-541.675] -- 0:00:35
Average standard deviation of split frequencies: 0.014731
405500 -- (-545.630) (-539.320) (-538.753) [-543.269] * (-539.752) (-547.652) [-544.530] (-543.418) -- 0:00:35
406000 -- (-539.870) (-538.869) [-538.801] (-542.526) * (-541.825) (-540.425) (-541.485) [-538.193] -- 0:00:35
406500 -- (-540.915) (-540.562) (-538.194) [-539.096] * (-546.482) [-539.358] (-545.100) (-539.259) -- 0:00:35
407000 -- (-540.063) [-541.631] (-538.565) (-540.749) * (-541.933) (-543.040) (-544.466) [-538.744] -- 0:00:34
407500 -- (-539.707) [-541.976] (-539.478) (-541.182) * [-540.350] (-539.678) (-543.006) (-548.518) -- 0:00:34
408000 -- (-541.130) (-539.739) [-539.961] (-538.862) * [-540.787] (-540.785) (-540.751) (-540.863) -- 0:00:34
408500 -- [-540.075] (-542.644) (-543.600) (-538.889) * (-543.147) (-539.145) (-542.275) [-541.317] -- 0:00:34
409000 -- (-539.753) [-541.757] (-539.426) (-538.030) * (-539.550) (-538.977) [-540.649] (-540.835) -- 0:00:34
409500 -- (-539.411) (-545.803) (-539.824) [-537.981] * (-538.225) (-538.861) [-539.280] (-538.665) -- 0:00:34
410000 -- (-543.012) [-539.210] (-539.071) (-541.095) * (-538.942) (-540.681) (-540.645) [-539.031] -- 0:00:34
Average standard deviation of split frequencies: 0.014923
410500 -- (-540.380) (-542.084) (-545.650) [-539.322] * (-538.847) (-541.664) (-541.214) [-541.499] -- 0:00:34
411000 -- (-541.643) [-540.242] (-546.919) (-540.513) * (-538.571) (-545.229) [-538.908] (-545.169) -- 0:00:34
411500 -- (-540.928) (-545.121) [-540.584] (-540.655) * (-540.902) [-539.849] (-539.935) (-538.731) -- 0:00:34
412000 -- (-541.099) (-546.390) (-540.004) [-538.999] * (-538.696) (-538.324) (-544.026) [-538.666] -- 0:00:35
412500 -- [-540.739] (-539.861) (-540.833) (-541.399) * (-538.780) (-542.446) [-541.105] (-539.365) -- 0:00:35
413000 -- (-541.031) (-539.365) (-539.621) [-539.802] * (-538.579) (-541.985) (-539.784) [-539.978] -- 0:00:35
413500 -- (-539.205) (-539.912) [-541.785] (-541.226) * [-540.569] (-539.890) (-542.715) (-539.406) -- 0:00:35
414000 -- (-538.876) [-537.702] (-541.514) (-544.292) * [-538.408] (-538.212) (-539.447) (-539.664) -- 0:00:35
414500 -- [-540.388] (-539.590) (-540.778) (-539.473) * (-540.381) [-539.151] (-543.027) (-546.546) -- 0:00:35
415000 -- (-539.356) (-539.159) [-539.966] (-539.124) * (-540.745) [-539.266] (-542.647) (-541.081) -- 0:00:35
Average standard deviation of split frequencies: 0.014448
415500 -- (-542.841) (-543.794) (-538.325) [-539.835] * (-539.894) (-543.078) (-538.405) [-540.730] -- 0:00:35
416000 -- [-542.010] (-540.225) (-538.986) (-539.377) * (-543.456) (-541.407) [-538.504] (-540.330) -- 0:00:35
416500 -- (-538.746) (-540.105) [-539.129] (-544.924) * (-540.387) (-540.700) (-539.635) [-539.124] -- 0:00:35
417000 -- (-539.161) (-542.011) (-538.212) [-539.855] * (-538.907) [-540.568] (-539.355) (-541.975) -- 0:00:34
417500 -- (-540.106) (-538.073) [-543.262] (-540.434) * (-539.921) [-539.951] (-539.019) (-540.883) -- 0:00:34
418000 -- [-537.889] (-538.081) (-543.133) (-539.795) * [-542.670] (-540.239) (-538.424) (-539.417) -- 0:00:34
418500 -- (-542.407) (-538.424) (-540.302) [-540.202] * [-540.284] (-541.625) (-540.910) (-538.831) -- 0:00:34
419000 -- [-539.987] (-539.008) (-539.327) (-540.821) * (-540.756) (-542.750) (-541.295) [-538.702] -- 0:00:34
419500 -- (-540.728) (-540.060) [-540.221] (-541.096) * [-539.641] (-542.484) (-540.899) (-538.740) -- 0:00:34
420000 -- (-539.899) (-537.883) (-540.191) [-538.335] * (-540.036) [-546.835] (-543.910) (-539.926) -- 0:00:34
Average standard deviation of split frequencies: 0.014848
420500 -- (-539.922) [-539.061] (-541.026) (-539.338) * [-541.365] (-540.572) (-545.725) (-541.189) -- 0:00:34
421000 -- (-539.205) (-541.948) (-540.422) [-538.435] * (-540.129) [-537.964] (-542.629) (-539.863) -- 0:00:34
421500 -- [-541.680] (-539.887) (-542.167) (-538.447) * (-539.085) (-538.080) [-539.115] (-538.487) -- 0:00:34
422000 -- [-538.989] (-539.413) (-539.144) (-538.263) * (-538.326) (-538.641) (-541.182) [-538.471] -- 0:00:34
422500 -- (-540.747) [-538.321] (-539.185) (-539.351) * (-550.346) (-543.690) (-539.791) [-539.838] -- 0:00:34
423000 -- [-542.153] (-542.596) (-540.593) (-542.279) * (-540.729) (-540.771) [-542.630] (-539.668) -- 0:00:34
423500 -- [-539.509] (-539.731) (-539.306) (-543.562) * (-540.247) (-540.225) [-538.623] (-539.526) -- 0:00:34
424000 -- (-539.377) [-539.740] (-541.066) (-539.240) * (-538.110) [-541.806] (-539.196) (-539.934) -- 0:00:33
424500 -- (-542.954) (-541.499) (-542.403) [-538.158] * [-540.530] (-538.637) (-540.178) (-538.565) -- 0:00:33
425000 -- (-539.517) [-539.903] (-541.360) (-540.291) * (-544.762) (-541.149) (-542.396) [-538.666] -- 0:00:33
Average standard deviation of split frequencies: 0.015561
425500 -- (-540.403) (-540.023) (-538.720) [-542.977] * (-545.962) [-542.948] (-542.038) (-539.099) -- 0:00:33
426000 -- (-538.666) (-539.973) (-542.307) [-542.889] * (-539.241) (-542.305) (-539.200) [-541.777] -- 0:00:33
426500 -- (-540.157) (-545.568) (-540.586) [-539.003] * (-540.699) (-544.487) (-542.981) [-540.263] -- 0:00:34
427000 -- (-540.024) (-545.729) (-539.060) [-538.377] * [-540.824] (-541.086) (-543.079) (-543.253) -- 0:00:34
427500 -- (-538.482) (-542.316) (-540.024) [-538.541] * (-540.631) [-537.937] (-538.912) (-542.258) -- 0:00:34
428000 -- (-539.421) [-538.783] (-538.767) (-538.490) * (-540.696) (-538.864) [-540.580] (-539.142) -- 0:00:34
428500 -- [-540.279] (-542.110) (-540.808) (-539.195) * [-539.797] (-542.324) (-538.592) (-540.142) -- 0:00:34
429000 -- (-539.868) [-550.126] (-541.143) (-542.392) * (-540.287) [-545.943] (-541.599) (-538.975) -- 0:00:34
429500 -- [-538.628] (-540.207) (-546.180) (-539.374) * [-541.297] (-543.554) (-546.022) (-544.024) -- 0:00:34
430000 -- (-540.082) [-539.318] (-540.249) (-540.773) * (-542.016) (-540.887) (-540.944) [-539.974] -- 0:00:34
Average standard deviation of split frequencies: 0.015530
430500 -- [-538.763] (-538.749) (-537.929) (-539.639) * (-540.421) (-539.766) [-539.775] (-544.506) -- 0:00:34
431000 -- [-540.430] (-541.433) (-538.622) (-541.422) * (-541.800) (-538.841) [-538.687] (-542.299) -- 0:00:34
431500 -- (-539.336) (-544.802) (-539.737) [-541.578] * [-537.718] (-541.250) (-539.268) (-539.666) -- 0:00:34
432000 -- (-539.493) (-539.443) [-539.997] (-542.766) * [-540.058] (-544.773) (-540.459) (-540.503) -- 0:00:34
432500 -- (-540.246) [-540.558] (-540.167) (-540.822) * [-538.858] (-544.804) (-541.478) (-541.218) -- 0:00:34
433000 -- (-538.139) [-545.298] (-543.299) (-541.521) * (-538.731) (-539.373) (-539.385) [-541.013] -- 0:00:34
433500 -- [-539.265] (-538.703) (-541.767) (-537.678) * (-540.638) (-542.208) [-546.911] (-540.031) -- 0:00:33
434000 -- [-538.197] (-538.852) (-538.925) (-539.933) * [-541.653] (-539.950) (-542.513) (-542.458) -- 0:00:33
434500 -- (-538.714) (-538.620) (-539.499) [-538.450] * (-540.477) [-539.066] (-541.235) (-541.569) -- 0:00:33
435000 -- (-538.623) (-540.086) (-540.999) [-538.394] * [-539.625] (-537.901) (-541.268) (-542.380) -- 0:00:33
Average standard deviation of split frequencies: 0.015137
435500 -- (-538.520) [-539.855] (-538.463) (-539.414) * (-539.082) (-541.816) (-540.902) [-542.655] -- 0:00:33
436000 -- (-538.322) [-541.786] (-539.767) (-541.048) * (-538.257) (-539.902) (-542.659) [-540.961] -- 0:00:33
436500 -- (-538.583) [-539.513] (-541.255) (-540.752) * [-541.633] (-545.084) (-539.747) (-544.481) -- 0:00:33
437000 -- (-543.100) (-542.989) [-540.872] (-538.762) * (-539.950) (-544.395) [-539.221] (-539.299) -- 0:00:33
437500 -- [-539.590] (-543.355) (-540.053) (-541.110) * (-539.077) (-540.790) [-541.125] (-539.755) -- 0:00:33
438000 -- (-543.492) [-542.665] (-539.086) (-539.528) * (-539.681) (-539.255) (-538.626) [-539.390] -- 0:00:33
438500 -- (-541.119) (-543.189) [-539.213] (-539.900) * [-539.111] (-539.696) (-539.664) (-540.317) -- 0:00:33
439000 -- [-541.393] (-539.259) (-540.319) (-542.967) * (-539.780) [-539.286] (-539.656) (-539.108) -- 0:00:33
439500 -- (-539.607) [-540.122] (-539.774) (-542.193) * [-541.332] (-541.440) (-542.420) (-540.970) -- 0:00:33
440000 -- (-541.521) [-538.408] (-541.526) (-540.230) * (-540.670) (-539.459) [-541.437] (-539.095) -- 0:00:33
Average standard deviation of split frequencies: 0.015244
440500 -- (-539.443) (-538.229) (-539.873) [-540.389] * (-538.589) [-539.371] (-538.891) (-541.357) -- 0:00:33
441000 -- (-542.460) (-540.387) (-539.378) [-538.454] * [-538.841] (-539.789) (-538.814) (-539.756) -- 0:00:32
441500 -- [-539.719] (-539.387) (-538.147) (-544.420) * (-541.922) [-538.705] (-539.777) (-542.066) -- 0:00:32
442000 -- (-539.123) (-540.066) (-538.745) [-543.468] * [-539.952] (-540.641) (-538.106) (-542.159) -- 0:00:32
442500 -- [-542.806] (-538.446) (-540.075) (-539.614) * (-544.257) (-538.923) (-542.395) [-539.944] -- 0:00:32
443000 -- (-540.820) (-539.666) [-539.679] (-538.249) * (-544.780) (-540.220) (-538.977) [-539.663] -- 0:00:32
443500 -- (-540.167) [-540.894] (-540.509) (-539.805) * (-544.024) [-542.076] (-539.809) (-541.020) -- 0:00:32
444000 -- (-541.769) (-540.983) [-538.357] (-541.699) * (-539.789) (-538.398) [-542.227] (-540.432) -- 0:00:33
444500 -- (-539.829) [-539.131] (-546.567) (-539.220) * (-538.614) (-539.867) [-540.621] (-539.595) -- 0:00:33
445000 -- (-543.493) (-541.837) [-542.042] (-543.356) * (-538.434) (-542.162) [-540.483] (-540.910) -- 0:00:33
Average standard deviation of split frequencies: 0.015854
445500 -- [-538.306] (-538.519) (-540.209) (-539.320) * (-538.436) (-541.969) [-540.597] (-542.002) -- 0:00:33
446000 -- (-540.441) (-542.221) (-538.444) [-540.079] * (-542.045) (-542.320) (-540.214) [-541.846] -- 0:00:33
446500 -- (-541.112) (-539.750) [-538.341] (-539.060) * (-541.412) (-540.957) [-539.935] (-538.456) -- 0:00:33
447000 -- (-543.470) (-540.920) (-545.783) [-539.898] * (-539.905) (-543.328) [-542.788] (-539.519) -- 0:00:33
447500 -- (-542.824) (-540.396) [-542.030] (-550.402) * (-538.853) [-540.134] (-542.817) (-538.413) -- 0:00:33
448000 -- (-538.602) (-541.233) [-540.197] (-545.307) * [-538.724] (-538.628) (-541.628) (-539.832) -- 0:00:33
448500 -- (-539.687) (-542.303) [-540.573] (-542.470) * (-539.201) (-538.441) (-539.502) [-538.862] -- 0:00:33
449000 -- [-539.676] (-540.025) (-539.301) (-539.813) * (-540.205) (-541.979) [-542.218] (-539.524) -- 0:00:33
449500 -- (-541.066) (-540.950) (-540.351) [-538.952] * (-540.889) (-542.090) (-542.111) [-541.169] -- 0:00:33
450000 -- [-541.991] (-542.946) (-541.250) (-538.909) * (-540.728) [-539.032] (-539.418) (-544.831) -- 0:00:33
Average standard deviation of split frequencies: 0.015875
450500 -- (-540.444) (-540.866) [-540.474] (-538.189) * (-540.052) (-540.164) (-538.712) [-538.963] -- 0:00:32
451000 -- (-538.959) (-542.823) [-540.459] (-541.816) * (-544.902) (-540.118) [-538.233] (-539.334) -- 0:00:32
451500 -- (-539.115) [-540.578] (-539.550) (-540.737) * (-540.290) (-538.873) [-538.350] (-538.055) -- 0:00:32
452000 -- (-545.644) (-541.296) [-540.244] (-541.838) * (-540.651) (-541.828) [-539.435] (-538.627) -- 0:00:32
452500 -- (-543.290) (-539.581) [-540.389] (-540.830) * (-540.794) (-541.919) [-538.515] (-540.655) -- 0:00:32
453000 -- (-539.319) (-541.501) [-540.660] (-538.804) * (-540.208) (-539.520) [-538.958] (-539.914) -- 0:00:32
453500 -- (-543.143) [-543.430] (-538.159) (-538.281) * (-539.165) [-540.349] (-542.483) (-541.986) -- 0:00:32
454000 -- (-543.026) [-542.573] (-543.464) (-539.193) * (-539.767) [-538.922] (-543.754) (-542.345) -- 0:00:32
454500 -- (-538.576) [-538.422] (-547.924) (-540.937) * (-542.056) (-539.766) [-539.701] (-541.293) -- 0:00:32
455000 -- (-540.975) (-539.951) [-539.369] (-540.148) * (-540.413) (-540.753) [-539.630] (-542.636) -- 0:00:32
Average standard deviation of split frequencies: 0.016054
455500 -- (-540.545) (-540.333) (-542.746) [-540.374] * [-539.185] (-539.830) (-545.252) (-539.936) -- 0:00:32
456000 -- (-538.491) (-540.265) [-539.088] (-539.254) * [-540.517] (-537.980) (-543.169) (-544.340) -- 0:00:32
456500 -- (-540.596) (-539.644) [-540.433] (-542.430) * (-538.679) (-539.314) (-543.172) [-539.035] -- 0:00:32
457000 -- [-538.974] (-544.156) (-543.568) (-539.102) * (-538.530) [-538.835] (-538.507) (-538.964) -- 0:00:32
457500 -- (-540.820) (-538.890) (-539.192) [-540.670] * [-540.279] (-540.145) (-542.875) (-541.590) -- 0:00:32
458000 -- (-543.744) (-539.868) [-538.932] (-543.656) * [-540.690] (-539.442) (-543.759) (-541.912) -- 0:00:31
458500 -- (-544.431) (-545.240) (-538.933) [-538.491] * [-538.396] (-540.165) (-548.634) (-540.423) -- 0:00:31
459000 -- [-538.368] (-542.978) (-538.284) (-545.042) * (-546.780) (-540.504) (-543.407) [-540.906] -- 0:00:31
459500 -- (-539.601) (-538.560) (-543.316) [-544.013] * [-542.171] (-544.111) (-542.799) (-541.924) -- 0:00:31
460000 -- (-540.001) [-540.044] (-539.552) (-543.157) * (-539.556) (-540.605) (-541.151) [-540.569] -- 0:00:31
Average standard deviation of split frequencies: 0.015771
460500 -- (-538.482) (-542.203) (-540.795) [-540.233] * (-541.208) (-538.462) [-544.660] (-540.825) -- 0:00:31
461000 -- (-539.341) (-540.776) (-539.489) [-538.906] * [-539.436] (-540.958) (-543.459) (-539.062) -- 0:00:32
461500 -- [-540.975] (-538.800) (-538.949) (-538.935) * (-540.936) (-539.157) (-544.840) [-541.143] -- 0:00:32
462000 -- (-541.262) (-539.611) (-538.546) [-538.445] * [-540.620] (-539.266) (-539.958) (-541.823) -- 0:00:32
462500 -- (-540.725) (-539.599) [-539.239] (-539.038) * [-543.661] (-541.217) (-541.500) (-540.192) -- 0:00:32
463000 -- (-538.695) [-540.243] (-541.997) (-541.798) * [-539.451] (-540.605) (-538.847) (-539.278) -- 0:00:32
463500 -- (-540.470) (-538.323) [-542.400] (-539.580) * [-539.967] (-539.556) (-540.942) (-539.394) -- 0:00:32
464000 -- (-544.560) (-544.005) [-539.778] (-542.416) * (-539.150) [-538.995] (-539.809) (-538.663) -- 0:00:32
464500 -- [-540.346] (-539.036) (-542.142) (-540.465) * (-537.839) (-540.546) [-547.118] (-538.173) -- 0:00:32
465000 -- [-538.465] (-540.030) (-540.153) (-541.766) * (-541.353) (-538.819) (-545.447) [-538.729] -- 0:00:32
Average standard deviation of split frequencies: 0.015948
465500 -- (-537.885) [-539.787] (-540.174) (-542.411) * (-538.417) (-538.381) [-539.184] (-539.326) -- 0:00:32
466000 -- (-537.884) [-539.425] (-543.650) (-538.424) * (-541.444) (-544.463) [-539.200] (-540.244) -- 0:00:32
466500 -- [-541.603] (-538.596) (-542.945) (-540.326) * (-541.685) [-537.955] (-540.071) (-539.892) -- 0:00:32
467000 -- [-538.970] (-540.763) (-540.066) (-539.384) * (-542.115) (-539.270) (-543.270) [-539.179] -- 0:00:31
467500 -- [-539.955] (-541.429) (-539.319) (-540.267) * (-541.168) [-539.246] (-542.026) (-539.593) -- 0:00:31
468000 -- [-540.227] (-539.541) (-542.234) (-538.907) * (-543.887) [-540.751] (-538.571) (-538.248) -- 0:00:31
468500 -- (-538.876) [-542.182] (-539.135) (-541.742) * (-541.081) (-539.561) (-539.811) [-538.393] -- 0:00:31
469000 -- (-539.946) [-539.584] (-538.414) (-541.481) * [-538.553] (-540.944) (-541.060) (-542.680) -- 0:00:31
469500 -- [-539.026] (-539.016) (-539.735) (-539.351) * (-540.244) (-540.840) (-539.309) [-542.697] -- 0:00:31
470000 -- [-539.877] (-539.832) (-541.077) (-543.435) * (-541.590) [-537.978] (-543.576) (-543.872) -- 0:00:31
Average standard deviation of split frequencies: 0.015377
470500 -- (-538.301) (-538.145) (-538.916) [-542.096] * [-538.956] (-540.033) (-539.815) (-544.653) -- 0:00:31
471000 -- (-539.418) (-538.717) (-540.858) [-540.850] * (-538.854) [-541.099] (-542.280) (-544.601) -- 0:00:31
471500 -- (-540.516) [-538.283] (-541.478) (-538.887) * (-540.985) [-541.639] (-539.843) (-548.574) -- 0:00:31
472000 -- (-541.730) [-538.860] (-539.893) (-543.942) * (-540.891) (-538.780) [-543.051] (-542.514) -- 0:00:31
472500 -- [-542.831] (-539.768) (-541.903) (-543.365) * (-542.438) (-538.498) (-541.737) [-541.977] -- 0:00:31
473000 -- [-538.543] (-538.894) (-540.935) (-543.503) * (-543.135) (-539.432) (-545.347) [-540.776] -- 0:00:31
473500 -- (-539.200) [-540.017] (-538.731) (-541.952) * (-540.495) (-540.371) [-541.031] (-540.128) -- 0:00:31
474000 -- (-538.514) (-539.362) [-541.427] (-541.472) * (-538.797) (-538.932) [-538.517] (-540.719) -- 0:00:31
474500 -- [-540.117] (-538.891) (-541.991) (-539.935) * (-542.123) (-540.899) (-540.111) [-538.716] -- 0:00:31
475000 -- [-543.368] (-538.875) (-540.076) (-539.891) * (-542.462) [-540.679] (-539.991) (-538.955) -- 0:00:30
Average standard deviation of split frequencies: 0.015379
475500 -- [-539.437] (-542.429) (-538.848) (-540.831) * (-538.471) (-541.711) (-541.539) [-539.371] -- 0:00:30
476000 -- (-542.195) (-541.881) [-539.353] (-541.862) * (-538.946) [-539.996] (-542.463) (-538.854) -- 0:00:30
476500 -- [-539.216] (-539.036) (-538.862) (-541.516) * (-541.153) (-540.724) [-541.335] (-540.133) -- 0:00:30
477000 -- [-542.275] (-540.725) (-541.047) (-544.474) * (-540.253) [-539.021] (-539.841) (-544.346) -- 0:00:30
477500 -- (-541.266) (-539.923) [-540.842] (-540.033) * (-540.600) (-540.711) [-542.803] (-539.231) -- 0:00:30
478000 -- [-539.188] (-541.832) (-539.424) (-538.566) * (-539.343) (-539.576) (-540.236) [-538.083] -- 0:00:31
478500 -- (-538.973) (-540.053) [-539.627] (-540.600) * (-540.545) (-542.346) [-539.747] (-538.844) -- 0:00:31
479000 -- [-540.288] (-539.206) (-540.045) (-539.153) * [-540.513] (-541.863) (-539.536) (-539.238) -- 0:00:31
479500 -- [-539.141] (-540.511) (-541.645) (-541.735) * (-539.667) (-543.144) (-539.663) [-542.631] -- 0:00:31
480000 -- (-538.450) (-542.270) (-541.533) [-539.461] * (-540.188) (-541.982) [-539.790] (-544.608) -- 0:00:31
Average standard deviation of split frequencies: 0.014999
480500 -- (-538.659) (-539.986) [-540.254] (-541.693) * (-538.591) (-540.904) (-538.744) [-541.151] -- 0:00:31
481000 -- (-538.929) (-540.014) [-539.528] (-538.858) * (-538.004) (-538.997) (-539.079) [-541.565] -- 0:00:31
481500 -- [-540.994] (-539.057) (-538.565) (-539.197) * (-538.415) [-540.335] (-538.701) (-541.806) -- 0:00:31
482000 -- (-540.247) (-539.988) [-539.007] (-542.970) * (-541.981) (-541.450) [-538.802] (-540.070) -- 0:00:31
482500 -- [-540.087] (-539.683) (-539.298) (-544.144) * (-540.751) [-539.274] (-538.906) (-540.760) -- 0:00:31
483000 -- (-541.137) [-538.953] (-540.340) (-543.461) * (-539.127) (-540.150) [-542.775] (-541.434) -- 0:00:31
483500 -- (-538.579) (-540.053) [-540.248] (-538.820) * (-539.305) [-538.445] (-538.877) (-540.569) -- 0:00:30
484000 -- (-541.037) (-539.856) [-538.984] (-547.753) * (-542.209) [-540.088] (-539.557) (-540.344) -- 0:00:30
484500 -- (-541.624) (-540.042) (-540.289) [-539.460] * (-541.142) (-538.674) (-543.866) [-539.109] -- 0:00:30
485000 -- (-542.537) (-539.250) (-541.318) [-540.996] * (-539.975) (-539.783) [-539.168] (-539.113) -- 0:00:30
Average standard deviation of split frequencies: 0.015462
485500 -- [-539.985] (-542.271) (-540.619) (-545.398) * (-538.683) (-539.288) (-539.163) [-539.369] -- 0:00:30
486000 -- [-540.579] (-540.473) (-537.806) (-541.515) * [-540.290] (-540.542) (-538.535) (-538.850) -- 0:00:30
486500 -- (-541.983) [-538.232] (-542.427) (-544.065) * (-539.910) (-539.884) (-539.791) [-538.143] -- 0:00:30
487000 -- (-540.061) (-541.098) [-540.070] (-545.170) * (-543.084) [-541.731] (-539.450) (-544.252) -- 0:00:30
487500 -- (-539.331) (-540.633) (-540.224) [-541.620] * (-542.715) [-540.422] (-544.427) (-541.846) -- 0:00:30
488000 -- (-540.292) [-539.142] (-544.141) (-538.978) * [-541.309] (-541.840) (-543.400) (-542.222) -- 0:00:30
488500 -- (-539.508) (-544.278) [-541.974] (-538.759) * (-538.908) (-541.549) (-540.791) [-538.599] -- 0:00:30
489000 -- (-538.918) [-538.783] (-542.496) (-542.657) * (-539.609) (-541.729) (-539.427) [-539.574] -- 0:00:30
489500 -- (-538.283) (-537.893) (-538.614) [-540.140] * (-542.145) (-540.032) (-544.426) [-542.155] -- 0:00:30
490000 -- (-540.958) (-541.212) [-540.196] (-542.660) * (-539.569) [-540.091] (-540.191) (-539.789) -- 0:00:30
Average standard deviation of split frequencies: 0.015259
490500 -- [-541.237] (-542.006) (-540.629) (-538.525) * (-540.708) [-541.690] (-543.335) (-539.243) -- 0:00:30
491000 -- (-540.172) (-540.716) (-540.430) [-538.156] * (-538.124) (-544.817) (-542.403) [-539.027] -- 0:00:30
491500 -- (-538.597) [-540.709] (-539.570) (-538.502) * (-539.771) [-540.266] (-540.368) (-540.693) -- 0:00:30
492000 -- (-545.652) (-541.261) [-542.062] (-540.763) * (-539.383) (-540.474) (-541.561) [-541.074] -- 0:00:29
492500 -- (-540.620) [-540.548] (-542.031) (-545.045) * (-541.900) (-542.771) [-541.442] (-539.830) -- 0:00:29
493000 -- (-541.626) (-540.432) [-539.508] (-538.000) * (-541.123) (-540.049) (-539.288) [-539.656] -- 0:00:29
493500 -- [-543.396] (-543.576) (-541.164) (-540.313) * (-542.404) [-541.572] (-538.839) (-542.112) -- 0:00:29
494000 -- (-541.351) (-538.622) [-541.670] (-539.685) * (-545.490) (-544.224) [-541.514] (-541.558) -- 0:00:29
494500 -- (-541.469) [-540.320] (-540.340) (-539.687) * [-542.627] (-541.766) (-542.596) (-539.706) -- 0:00:29
495000 -- (-544.368) (-541.484) (-540.127) [-539.103] * (-540.384) (-539.086) [-540.178] (-543.187) -- 0:00:29
Average standard deviation of split frequencies: 0.014703
495500 -- (-540.738) (-543.310) (-540.691) [-542.165] * (-547.458) (-538.516) (-542.476) [-540.876] -- 0:00:30
496000 -- (-539.322) [-541.618] (-539.381) (-540.424) * (-540.039) (-538.803) [-542.569] (-545.350) -- 0:00:30
496500 -- (-539.506) [-540.052] (-538.469) (-544.213) * (-540.455) (-538.268) [-540.603] (-543.939) -- 0:00:30
497000 -- (-538.531) [-539.445] (-539.805) (-538.638) * (-540.639) (-538.015) [-541.850] (-539.024) -- 0:00:30
497500 -- (-539.431) (-541.911) [-543.608] (-539.459) * (-539.057) (-538.406) (-541.220) [-540.103] -- 0:00:30
498000 -- [-538.544] (-539.264) (-540.916) (-541.963) * (-538.928) [-538.377] (-541.499) (-539.139) -- 0:00:30
498500 -- (-538.975) [-539.765] (-539.203) (-541.065) * [-539.827] (-538.903) (-540.357) (-541.673) -- 0:00:30
499000 -- (-540.436) (-542.232) [-540.013] (-540.051) * (-539.386) (-539.938) [-541.357] (-540.602) -- 0:00:30
499500 -- (-538.836) (-539.854) [-541.193] (-542.234) * (-538.981) [-540.010] (-541.170) (-539.688) -- 0:00:30
500000 -- [-539.490] (-539.124) (-544.172) (-547.453) * (-539.622) (-541.796) (-538.670) [-538.494] -- 0:00:30
Average standard deviation of split frequencies: 0.014788
500500 -- (-538.845) [-540.377] (-540.169) (-541.322) * (-539.112) (-540.118) [-542.828] (-539.477) -- 0:00:29
501000 -- [-541.409] (-538.443) (-540.427) (-538.700) * (-539.849) (-538.914) (-540.243) [-540.110] -- 0:00:29
501500 -- (-542.843) (-543.629) (-540.259) [-538.148] * (-538.960) (-538.532) (-540.080) [-543.260] -- 0:00:29
502000 -- (-544.282) [-539.769] (-540.258) (-539.128) * [-538.261] (-541.214) (-540.668) (-540.993) -- 0:00:29
502500 -- (-540.174) (-538.787) [-538.519] (-539.589) * (-543.885) (-538.639) [-538.377] (-541.106) -- 0:00:29
503000 -- [-539.691] (-542.939) (-540.442) (-540.398) * (-544.265) (-539.405) [-539.011] (-542.345) -- 0:00:29
503500 -- (-539.026) (-541.314) [-542.195] (-544.925) * (-542.826) [-540.834] (-539.690) (-547.606) -- 0:00:29
504000 -- (-538.236) [-541.228] (-541.755) (-541.518) * (-540.437) (-540.292) [-538.763] (-541.465) -- 0:00:29
504500 -- (-538.579) (-538.762) [-539.295] (-545.000) * [-537.971] (-543.141) (-540.996) (-542.193) -- 0:00:29
505000 -- [-541.753] (-539.034) (-539.780) (-540.313) * (-538.539) (-539.218) (-541.492) [-539.924] -- 0:00:29
Average standard deviation of split frequencies: 0.014577
505500 -- (-543.664) [-540.983] (-540.407) (-539.247) * (-541.916) (-541.426) (-539.812) [-538.973] -- 0:00:29
506000 -- (-539.812) [-539.112] (-539.447) (-538.203) * (-539.339) (-540.961) [-541.493] (-539.402) -- 0:00:29
506500 -- (-539.882) [-538.787] (-542.616) (-540.226) * [-538.846] (-540.888) (-538.313) (-540.895) -- 0:00:29
507000 -- (-545.007) (-542.112) (-539.019) [-540.522] * [-538.952] (-540.011) (-540.440) (-539.776) -- 0:00:29
507500 -- [-538.651] (-541.623) (-542.412) (-542.261) * (-538.841) (-542.040) [-539.819] (-540.988) -- 0:00:29
508000 -- (-540.018) (-539.010) [-541.303] (-541.835) * [-540.746] (-541.730) (-542.064) (-539.520) -- 0:00:29
508500 -- (-539.421) (-538.403) (-539.679) [-538.759] * (-539.527) (-545.860) [-544.309] (-539.862) -- 0:00:28
509000 -- (-539.676) (-539.719) [-538.640] (-542.823) * (-538.638) [-540.769] (-543.546) (-541.591) -- 0:00:28
509500 -- (-539.791) (-538.225) (-541.086) [-540.086] * (-540.702) [-543.847] (-540.415) (-542.505) -- 0:00:28
510000 -- (-545.504) (-542.440) [-539.585] (-538.581) * (-540.674) (-540.549) (-538.928) [-538.756] -- 0:00:28
Average standard deviation of split frequencies: 0.014390
510500 -- [-539.036] (-541.696) (-542.938) (-542.446) * [-539.524] (-542.542) (-538.065) (-539.202) -- 0:00:28
511000 -- (-539.862) (-542.393) (-541.072) [-539.427] * [-542.069] (-539.307) (-539.486) (-540.764) -- 0:00:28
511500 -- [-539.246] (-545.989) (-538.211) (-539.243) * [-540.736] (-540.944) (-539.752) (-540.589) -- 0:00:29
512000 -- (-542.075) (-541.056) (-542.863) [-541.354] * (-540.170) [-539.053] (-539.792) (-539.417) -- 0:00:29
512500 -- [-543.454] (-540.412) (-539.669) (-540.669) * (-546.421) [-538.751] (-545.493) (-539.775) -- 0:00:29
513000 -- [-542.333] (-538.747) (-539.459) (-541.480) * (-541.879) (-539.625) (-545.350) [-541.680] -- 0:00:29
513500 -- [-544.909] (-541.540) (-540.595) (-540.734) * [-540.430] (-539.412) (-540.608) (-540.163) -- 0:00:29
514000 -- (-541.976) (-539.903) (-544.528) [-540.011] * (-540.881) (-540.826) (-539.450) [-539.051] -- 0:00:29
514500 -- [-538.986] (-539.818) (-540.495) (-540.811) * (-543.978) [-540.312] (-538.380) (-541.455) -- 0:00:29
515000 -- (-543.105) [-539.706] (-540.088) (-543.707) * (-540.969) (-539.696) [-540.053] (-543.857) -- 0:00:29
Average standard deviation of split frequencies: 0.014563
515500 -- [-538.839] (-538.830) (-540.526) (-540.486) * (-543.803) (-539.678) (-539.938) [-540.158] -- 0:00:29
516000 -- (-543.050) (-541.239) (-539.315) [-539.415] * (-540.077) (-538.323) [-540.278] (-542.990) -- 0:00:29
516500 -- (-538.891) (-548.000) (-540.811) [-539.292] * [-538.696] (-538.703) (-540.459) (-540.246) -- 0:00:29
517000 -- (-538.129) (-539.826) (-541.755) [-538.909] * (-538.951) (-538.441) (-538.505) [-540.912] -- 0:00:28
517500 -- [-539.231] (-542.172) (-539.150) (-540.735) * [-540.817] (-544.346) (-539.392) (-540.558) -- 0:00:28
518000 -- [-540.331] (-541.695) (-538.312) (-539.032) * [-541.277] (-538.399) (-543.103) (-539.815) -- 0:00:28
518500 -- (-543.195) [-539.445] (-541.155) (-542.783) * (-541.132) (-540.331) (-541.132) [-540.544] -- 0:00:28
519000 -- [-540.791] (-541.116) (-540.639) (-542.686) * [-539.922] (-545.053) (-541.238) (-539.145) -- 0:00:28
519500 -- (-539.725) (-539.218) (-541.150) [-539.597] * (-540.650) (-538.855) (-542.392) [-539.550] -- 0:00:28
520000 -- (-539.288) [-538.208] (-539.727) (-540.053) * (-539.919) (-538.749) [-539.510] (-539.233) -- 0:00:28
Average standard deviation of split frequencies: 0.014373
520500 -- [-539.201] (-538.786) (-539.360) (-538.681) * (-539.648) (-538.723) (-539.848) [-540.037] -- 0:00:28
521000 -- (-544.146) (-539.863) (-539.661) [-539.587] * (-540.176) (-539.624) [-538.971] (-539.267) -- 0:00:28
521500 -- (-539.307) [-539.754] (-541.477) (-538.733) * (-543.553) [-539.022] (-541.013) (-541.303) -- 0:00:28
522000 -- (-541.204) [-539.780] (-544.142) (-537.852) * (-543.330) (-540.868) [-544.486] (-542.987) -- 0:00:28
522500 -- (-541.240) (-541.268) (-544.532) [-538.580] * (-541.449) [-540.629] (-541.069) (-546.120) -- 0:00:28
523000 -- (-539.510) [-540.457] (-544.372) (-541.836) * [-538.200] (-539.683) (-541.746) (-539.399) -- 0:00:28
523500 -- (-538.823) (-539.516) (-540.295) [-545.484] * [-538.893] (-538.639) (-540.042) (-538.733) -- 0:00:28
524000 -- [-540.556] (-539.156) (-539.983) (-539.302) * (-539.568) [-539.382] (-538.840) (-540.359) -- 0:00:28
524500 -- (-540.493) (-542.355) (-541.875) [-540.742] * (-538.190) (-538.190) [-538.941] (-540.449) -- 0:00:28
525000 -- [-540.255] (-540.397) (-539.419) (-539.052) * [-539.493] (-539.840) (-539.556) (-539.784) -- 0:00:28
Average standard deviation of split frequencies: 0.013622
525500 -- [-540.289] (-541.045) (-539.390) (-538.567) * (-539.786) [-538.447] (-540.940) (-540.404) -- 0:00:27
526000 -- (-545.186) (-540.208) [-538.826] (-543.716) * [-539.856] (-538.591) (-541.870) (-541.903) -- 0:00:27
526500 -- (-540.637) (-539.217) (-540.494) [-539.310] * [-539.835] (-540.444) (-543.858) (-543.033) -- 0:00:27
527000 -- (-539.254) (-540.792) [-538.933] (-539.480) * (-538.956) (-540.122) [-538.965] (-543.423) -- 0:00:27
527500 -- (-539.864) (-538.864) (-539.083) [-539.492] * (-539.936) [-542.182] (-538.710) (-539.553) -- 0:00:27
528000 -- (-542.689) (-539.183) [-538.545] (-541.947) * (-538.133) (-540.289) (-542.924) [-540.324] -- 0:00:27
528500 -- (-539.044) (-539.832) (-540.434) [-541.379] * (-539.243) [-541.892] (-539.392) (-540.457) -- 0:00:28
529000 -- (-538.808) (-539.867) (-540.107) [-540.454] * (-538.377) [-539.958] (-539.252) (-542.406) -- 0:00:28
529500 -- (-540.879) [-542.377] (-539.751) (-542.498) * (-538.399) [-539.737] (-539.689) (-541.524) -- 0:00:28
530000 -- (-540.461) (-539.324) [-538.453] (-544.659) * (-538.863) [-539.540] (-540.422) (-541.315) -- 0:00:28
Average standard deviation of split frequencies: 0.013562
530500 -- [-539.872] (-539.947) (-540.555) (-540.936) * (-544.273) (-541.304) [-538.886] (-539.224) -- 0:00:28
531000 -- (-540.530) (-538.932) (-539.302) [-539.904] * (-540.610) (-540.018) [-542.133] (-539.526) -- 0:00:28
531500 -- [-541.941] (-543.065) (-539.551) (-541.462) * (-541.795) (-538.473) (-541.856) [-539.147] -- 0:00:28
532000 -- (-539.918) (-542.911) [-541.165] (-540.092) * (-540.473) (-539.944) [-540.103] (-544.353) -- 0:00:28
532500 -- [-540.138] (-539.973) (-540.043) (-539.104) * (-540.326) (-541.393) (-544.215) [-538.895] -- 0:00:28
533000 -- (-540.431) (-542.791) [-542.691] (-542.355) * (-539.667) (-540.632) [-539.017] (-544.183) -- 0:00:28
533500 -- (-540.283) (-539.219) [-539.020] (-538.044) * (-539.161) (-543.331) (-540.613) [-538.448] -- 0:00:27
534000 -- [-540.514] (-538.528) (-544.316) (-538.740) * (-543.097) (-544.502) [-539.277] (-544.159) -- 0:00:27
534500 -- [-542.076] (-540.295) (-538.682) (-538.868) * (-539.737) (-539.835) (-539.598) [-543.464] -- 0:00:27
535000 -- [-542.394] (-540.535) (-539.443) (-538.726) * (-542.396) [-538.948] (-541.424) (-542.841) -- 0:00:27
Average standard deviation of split frequencies: 0.013016
535500 -- [-538.978] (-540.002) (-538.720) (-543.227) * [-541.192] (-542.682) (-539.958) (-541.469) -- 0:00:27
536000 -- [-538.912] (-538.106) (-541.233) (-542.924) * [-538.154] (-549.333) (-538.867) (-541.239) -- 0:00:27
536500 -- (-540.454) [-541.674] (-541.058) (-545.241) * (-539.517) [-541.765] (-538.116) (-539.493) -- 0:00:27
537000 -- (-541.915) [-538.402] (-539.793) (-540.052) * (-541.957) (-539.956) (-539.068) [-538.159] -- 0:00:27
537500 -- [-541.521] (-538.134) (-539.072) (-538.235) * (-541.980) (-541.973) (-542.509) [-540.401] -- 0:00:27
538000 -- [-539.572] (-538.247) (-540.498) (-540.107) * [-539.247] (-538.685) (-539.111) (-539.392) -- 0:00:27
538500 -- (-539.260) (-539.585) [-541.866] (-541.333) * (-541.715) (-540.998) (-546.779) [-539.312] -- 0:00:27
539000 -- [-540.856] (-540.255) (-539.648) (-539.848) * (-540.942) (-542.917) [-541.548] (-540.439) -- 0:00:27
539500 -- [-540.573] (-538.660) (-538.637) (-538.303) * [-539.021] (-540.874) (-539.248) (-539.514) -- 0:00:27
540000 -- (-539.737) (-538.583) (-539.330) [-538.690] * (-540.086) (-540.669) (-539.232) [-540.658] -- 0:00:27
Average standard deviation of split frequencies: 0.012323
540500 -- (-540.357) (-539.475) (-538.684) [-541.022] * (-538.715) (-538.709) [-541.125] (-540.948) -- 0:00:27
541000 -- (-539.375) (-542.027) [-540.557] (-541.120) * [-538.983] (-542.791) (-539.200) (-538.333) -- 0:00:27
541500 -- (-537.991) (-541.913) [-539.542] (-538.806) * (-539.960) (-540.513) [-540.389] (-550.648) -- 0:00:27
542000 -- (-537.991) (-538.713) (-538.404) [-542.909] * [-540.622] (-541.623) (-539.619) (-542.220) -- 0:00:27
542500 -- (-541.237) [-544.025] (-542.317) (-539.446) * (-544.285) (-542.426) [-539.425] (-541.136) -- 0:00:26
543000 -- (-538.930) [-540.190] (-540.987) (-543.327) * [-539.016] (-540.271) (-540.013) (-540.926) -- 0:00:26
543500 -- (-539.006) [-541.714] (-540.549) (-543.176) * [-540.390] (-540.127) (-543.731) (-540.646) -- 0:00:26
544000 -- (-541.047) (-539.747) [-542.974] (-541.877) * (-543.852) (-539.598) [-538.770] (-542.834) -- 0:00:26
544500 -- [-538.970] (-539.784) (-538.957) (-539.957) * (-539.550) [-539.063] (-543.639) (-539.757) -- 0:00:26
545000 -- [-543.273] (-540.306) (-541.409) (-539.562) * (-538.727) (-539.281) [-538.669] (-540.141) -- 0:00:26
Average standard deviation of split frequencies: 0.012893
545500 -- (-543.220) [-537.744] (-539.507) (-541.300) * (-539.192) [-539.855] (-539.033) (-539.705) -- 0:00:26
546000 -- (-540.022) (-537.787) (-540.860) [-538.136] * (-538.439) [-543.700] (-546.582) (-541.683) -- 0:00:27
546500 -- (-539.709) (-537.783) [-538.466] (-540.494) * [-538.555] (-538.660) (-538.819) (-543.032) -- 0:00:27
547000 -- (-538.889) [-537.757] (-540.071) (-540.155) * (-541.969) (-539.803) (-540.691) [-541.521] -- 0:00:27
547500 -- (-538.824) (-540.380) (-541.074) [-540.462] * [-539.217] (-538.907) (-539.283) (-543.329) -- 0:00:27
548000 -- [-539.836] (-538.387) (-541.872) (-542.110) * (-539.505) [-540.963] (-538.704) (-541.150) -- 0:00:27
548500 -- [-540.167] (-539.958) (-543.898) (-540.762) * (-540.837) (-540.123) [-538.735] (-541.934) -- 0:00:27
549000 -- (-540.220) [-540.974] (-539.430) (-541.408) * (-540.871) [-538.826] (-540.999) (-539.509) -- 0:00:27
549500 -- (-540.709) (-540.574) (-539.096) [-541.584] * (-542.823) (-539.204) [-540.448] (-540.365) -- 0:00:27
550000 -- (-539.652) (-541.419) (-540.887) [-539.770] * (-539.428) (-540.131) [-541.008] (-539.080) -- 0:00:27
Average standard deviation of split frequencies: 0.012384
550500 -- [-538.396] (-539.988) (-539.468) (-541.814) * (-541.452) (-539.601) (-538.953) [-539.713] -- 0:00:26
551000 -- (-540.212) [-541.198] (-543.618) (-539.176) * (-538.096) (-538.333) [-538.252] (-539.497) -- 0:00:26
551500 -- (-539.285) [-543.509] (-542.227) (-538.577) * (-540.486) (-540.991) (-540.134) [-538.586] -- 0:00:26
552000 -- [-538.667] (-540.223) (-542.027) (-538.742) * (-539.475) [-538.616] (-540.466) (-540.572) -- 0:00:26
552500 -- (-541.334) [-538.506] (-545.862) (-541.172) * (-541.286) (-540.616) (-543.893) [-540.066] -- 0:00:26
553000 -- [-542.671] (-538.769) (-541.467) (-542.939) * (-539.712) (-540.377) [-539.986] (-538.709) -- 0:00:26
553500 -- (-546.009) (-542.485) [-538.617] (-539.551) * (-539.092) (-541.576) [-540.131] (-538.900) -- 0:00:26
554000 -- (-545.023) (-540.163) [-539.371] (-541.988) * (-539.147) (-539.418) [-538.024] (-540.396) -- 0:00:26
554500 -- [-538.688] (-538.969) (-540.833) (-538.802) * [-539.388] (-543.581) (-537.991) (-540.392) -- 0:00:26
555000 -- [-538.574] (-544.079) (-539.102) (-539.870) * (-538.453) [-540.266] (-539.862) (-539.678) -- 0:00:26
Average standard deviation of split frequencies: 0.012322
555500 -- (-538.208) (-539.589) [-539.441] (-539.721) * [-539.599] (-541.480) (-538.318) (-539.673) -- 0:00:26
556000 -- (-540.116) [-539.534] (-539.812) (-539.640) * (-543.130) (-539.663) (-538.976) [-538.726] -- 0:00:26
556500 -- (-539.776) [-540.914] (-540.144) (-543.969) * (-539.548) (-542.867) (-541.740) [-539.337] -- 0:00:26
557000 -- (-541.898) (-542.917) (-539.682) [-538.897] * (-541.392) [-540.582] (-544.923) (-541.383) -- 0:00:26
557500 -- (-544.434) (-542.387) (-544.193) [-540.127] * (-539.555) (-539.499) (-545.134) [-542.782] -- 0:00:26
558000 -- [-540.959] (-540.915) (-539.203) (-539.321) * (-540.180) (-539.935) (-551.080) [-541.781] -- 0:00:26
558500 -- (-539.343) (-541.057) [-539.905] (-538.249) * (-539.041) [-538.283] (-549.117) (-544.146) -- 0:00:26
559000 -- (-545.538) [-541.757] (-542.539) (-539.896) * (-539.309) (-541.149) (-546.032) [-540.971] -- 0:00:26
559500 -- (-541.755) [-548.800] (-540.501) (-539.401) * (-542.928) (-539.817) [-546.083] (-539.642) -- 0:00:25
560000 -- (-539.322) [-538.967] (-543.945) (-541.032) * (-543.848) (-538.645) (-539.830) [-542.353] -- 0:00:25
Average standard deviation of split frequencies: 0.012163
560500 -- (-539.440) [-541.913] (-539.594) (-537.953) * (-538.565) (-539.229) [-539.780] (-539.758) -- 0:00:25
561000 -- [-541.160] (-543.999) (-542.922) (-538.411) * [-542.457] (-538.484) (-539.905) (-539.022) -- 0:00:25
561500 -- (-542.368) (-543.000) [-541.523] (-538.995) * (-540.058) (-540.897) [-540.426] (-543.035) -- 0:00:25
562000 -- [-539.839] (-539.694) (-540.797) (-541.425) * [-541.125] (-539.328) (-540.027) (-539.941) -- 0:00:25
562500 -- (-541.997) [-539.618] (-544.527) (-541.814) * (-540.305) [-538.718] (-542.913) (-541.823) -- 0:00:25
563000 -- (-542.355) [-541.200] (-538.379) (-539.521) * (-541.385) (-538.828) (-540.077) [-539.233] -- 0:00:26
563500 -- (-538.508) (-539.377) [-540.075] (-538.063) * [-542.381] (-537.947) (-539.225) (-544.082) -- 0:00:26
564000 -- (-538.187) (-537.996) (-539.203) [-538.312] * (-543.538) (-541.447) [-538.715] (-540.142) -- 0:00:26
564500 -- [-537.962] (-544.794) (-551.227) (-538.543) * (-538.681) (-541.195) [-538.656] (-542.304) -- 0:00:26
565000 -- [-538.039] (-544.643) (-542.014) (-541.428) * (-541.436) [-541.850] (-539.872) (-540.731) -- 0:00:26
Average standard deviation of split frequencies: 0.012549
565500 -- (-538.875) (-542.533) (-540.498) [-539.047] * (-539.291) [-538.096] (-540.884) (-538.817) -- 0:00:26
566000 -- (-538.976) (-540.010) [-539.715] (-538.554) * (-538.796) [-540.656] (-538.982) (-540.846) -- 0:00:26
566500 -- [-541.250] (-541.195) (-540.588) (-539.675) * (-539.291) [-543.023] (-543.534) (-549.129) -- 0:00:26
567000 -- (-544.682) [-539.766] (-540.248) (-542.364) * [-539.970] (-541.619) (-539.630) (-543.425) -- 0:00:25
567500 -- (-540.163) (-539.280) [-539.245] (-542.347) * [-538.947] (-541.573) (-542.120) (-538.754) -- 0:00:25
568000 -- (-539.745) (-539.156) [-539.548] (-543.264) * (-538.754) [-540.994] (-540.060) (-538.417) -- 0:00:25
568500 -- (-540.089) [-538.731] (-544.361) (-544.577) * (-539.410) (-539.797) [-539.458] (-538.316) -- 0:00:25
569000 -- [-540.553] (-540.476) (-546.056) (-538.531) * (-538.498) (-546.060) (-540.431) [-539.673] -- 0:00:25
569500 -- [-540.934] (-539.978) (-539.238) (-539.100) * (-539.980) (-543.090) [-544.096] (-538.493) -- 0:00:25
570000 -- (-538.032) (-540.154) [-540.150] (-540.678) * [-542.921] (-538.678) (-540.928) (-538.992) -- 0:00:25
Average standard deviation of split frequencies: 0.012226
570500 -- (-542.435) [-538.577] (-540.349) (-541.644) * (-540.342) [-539.006] (-539.528) (-539.827) -- 0:00:25
571000 -- (-542.684) (-539.533) (-540.671) [-540.719] * (-539.993) (-541.186) (-541.027) [-537.831] -- 0:00:25
571500 -- (-540.697) (-539.892) (-541.058) [-540.217] * (-541.957) (-538.054) (-541.620) [-537.831] -- 0:00:25
572000 -- (-542.041) [-540.520] (-538.348) (-538.537) * (-539.543) [-539.134] (-539.588) (-540.470) -- 0:00:25
572500 -- (-541.298) (-539.359) (-539.195) [-543.674] * [-539.743] (-540.752) (-538.924) (-542.213) -- 0:00:25
573000 -- (-540.914) (-538.082) [-539.442] (-544.407) * (-540.489) [-540.476] (-538.243) (-540.859) -- 0:00:25
573500 -- [-540.877] (-538.003) (-541.270) (-539.972) * [-538.633] (-538.780) (-540.325) (-542.403) -- 0:00:25
574000 -- (-538.558) [-538.631] (-540.983) (-543.076) * [-538.578] (-542.227) (-538.482) (-539.321) -- 0:00:25
574500 -- [-541.688] (-541.949) (-538.715) (-540.436) * (-538.871) (-539.366) (-538.973) [-538.483] -- 0:00:25
575000 -- (-539.918) (-540.487) (-539.377) [-540.425] * (-539.913) (-538.570) [-539.150] (-542.495) -- 0:00:25
Average standard deviation of split frequencies: 0.011894
575500 -- [-540.359] (-538.367) (-540.472) (-541.807) * [-538.616] (-538.128) (-539.091) (-538.820) -- 0:00:25
576000 -- (-543.993) (-539.459) [-547.601] (-538.803) * (-541.585) [-539.288] (-538.698) (-540.047) -- 0:00:25
576500 -- (-541.171) (-540.154) (-544.364) [-538.361] * (-540.941) (-538.942) [-540.092] (-541.719) -- 0:00:24
577000 -- [-539.460] (-541.861) (-540.633) (-539.056) * [-538.457] (-543.827) (-542.340) (-539.689) -- 0:00:24
577500 -- (-542.431) [-539.794] (-538.805) (-540.212) * (-539.554) (-541.314) [-539.363] (-538.010) -- 0:00:24
578000 -- (-539.516) [-538.566] (-538.910) (-540.223) * [-539.085] (-540.566) (-538.563) (-539.693) -- 0:00:24
578500 -- (-541.529) [-538.350] (-539.248) (-539.370) * (-538.353) (-539.522) (-539.422) [-539.390] -- 0:00:24
579000 -- [-538.410] (-539.447) (-538.780) (-540.361) * (-538.403) (-539.957) (-538.739) [-543.043] -- 0:00:24
579500 -- (-537.959) (-539.495) (-539.100) [-538.648] * [-538.681] (-539.528) (-538.700) (-540.201) -- 0:00:24
580000 -- [-541.487] (-538.599) (-541.570) (-540.280) * (-538.312) [-537.946] (-541.485) (-540.340) -- 0:00:25
Average standard deviation of split frequencies: 0.011312
580500 -- [-539.049] (-538.611) (-539.429) (-539.751) * (-542.380) (-543.343) (-541.352) [-539.511] -- 0:00:25
581000 -- [-538.751] (-541.876) (-539.670) (-539.209) * (-541.684) [-542.443] (-539.376) (-538.802) -- 0:00:25
581500 -- (-538.175) [-541.449] (-538.901) (-538.528) * [-539.824] (-542.063) (-538.136) (-540.791) -- 0:00:25
582000 -- (-542.284) (-540.133) (-539.947) [-538.304] * [-542.134] (-539.424) (-540.325) (-541.479) -- 0:00:25
582500 -- (-546.134) (-540.841) [-539.434] (-538.355) * (-539.319) (-538.752) [-540.757] (-540.785) -- 0:00:25
583000 -- [-539.893] (-540.633) (-540.549) (-540.582) * (-539.432) (-539.248) (-538.827) [-539.727] -- 0:00:25
583500 -- (-538.892) [-538.239] (-541.155) (-539.036) * (-538.578) [-542.012] (-539.291) (-540.359) -- 0:00:24
584000 -- (-539.928) [-540.066] (-541.254) (-539.000) * (-539.724) (-539.326) [-540.830] (-539.165) -- 0:00:24
584500 -- (-538.226) (-540.697) [-538.950] (-538.075) * (-540.868) (-538.767) [-542.298] (-538.989) -- 0:00:24
585000 -- (-539.629) (-542.909) (-541.433) [-540.896] * (-539.998) [-539.031] (-539.486) (-538.968) -- 0:00:24
Average standard deviation of split frequencies: 0.010297
585500 -- (-541.657) (-541.027) [-540.553] (-540.286) * (-543.860) [-540.452] (-540.158) (-540.792) -- 0:00:24
586000 -- (-543.358) (-539.132) (-539.310) [-538.116] * (-544.488) [-538.317] (-544.397) (-541.435) -- 0:00:24
586500 -- [-542.165] (-540.921) (-539.493) (-538.222) * (-553.084) (-542.412) (-541.097) [-543.647] -- 0:00:24
587000 -- (-540.875) (-543.211) [-539.013] (-540.187) * (-539.213) (-538.063) (-541.533) [-540.261] -- 0:00:24
587500 -- [-539.694] (-542.764) (-542.328) (-542.484) * (-541.551) [-540.381] (-542.185) (-541.573) -- 0:00:24
588000 -- (-542.587) [-539.835] (-539.226) (-540.575) * (-540.491) (-540.253) [-542.968] (-538.953) -- 0:00:24
588500 -- [-541.351] (-540.333) (-540.868) (-542.041) * (-539.549) [-538.701] (-540.650) (-544.485) -- 0:00:24
589000 -- (-543.024) (-539.592) [-542.036] (-541.901) * [-537.874] (-539.247) (-542.411) (-543.767) -- 0:00:24
589500 -- (-540.015) (-540.175) (-539.855) [-541.860] * (-539.405) [-538.416] (-542.844) (-540.041) -- 0:00:24
590000 -- [-540.110] (-540.265) (-541.476) (-540.173) * (-537.955) (-540.903) (-539.923) [-540.970] -- 0:00:24
Average standard deviation of split frequencies: 0.010162
590500 -- (-539.092) (-539.319) [-540.452] (-539.152) * [-537.996] (-538.619) (-545.268) (-538.873) -- 0:00:24
591000 -- (-540.794) [-542.492] (-540.842) (-540.888) * [-537.942] (-541.162) (-544.774) (-539.773) -- 0:00:24
591500 -- (-538.566) (-539.564) [-541.395] (-543.266) * (-539.015) (-540.132) (-541.024) [-540.325] -- 0:00:24
592000 -- (-539.955) (-538.971) (-539.586) [-541.638] * (-539.986) (-542.345) (-539.535) [-540.204] -- 0:00:24
592500 -- [-540.470] (-540.664) (-539.342) (-541.772) * [-540.589] (-543.259) (-543.142) (-540.358) -- 0:00:24
593000 -- (-540.186) (-539.144) (-540.025) [-539.419] * [-538.533] (-547.841) (-541.273) (-540.874) -- 0:00:24
593500 -- (-539.268) [-539.521] (-538.031) (-544.791) * (-538.323) (-548.057) (-541.037) [-538.808] -- 0:00:23
594000 -- (-539.047) (-541.625) (-539.410) [-539.841] * (-540.136) [-543.180] (-539.459) (-538.694) -- 0:00:23
594500 -- (-538.791) [-538.158] (-539.525) (-542.082) * (-541.894) (-538.900) (-539.606) [-538.600] -- 0:00:23
595000 -- [-538.775] (-542.528) (-538.685) (-539.144) * (-541.746) (-538.313) (-541.068) [-537.966] -- 0:00:23
Average standard deviation of split frequencies: 0.009860
595500 -- (-540.677) (-540.583) (-539.785) [-541.572] * (-543.312) (-543.438) [-539.991] (-539.430) -- 0:00:23
596000 -- [-538.698] (-539.020) (-542.369) (-538.265) * (-545.941) [-541.253] (-538.386) (-539.087) -- 0:00:23
596500 -- [-538.563] (-542.196) (-539.291) (-538.536) * (-544.859) [-540.814] (-538.497) (-541.333) -- 0:00:23
597000 -- (-539.248) (-539.417) (-541.670) [-539.035] * (-538.413) (-540.614) [-540.001] (-542.298) -- 0:00:24
597500 -- [-542.979] (-541.833) (-539.195) (-542.882) * (-544.776) [-538.324] (-544.010) (-541.216) -- 0:00:24
598000 -- (-538.902) [-539.916] (-542.153) (-541.154) * (-540.310) (-538.687) (-540.656) [-540.602] -- 0:00:24
598500 -- (-539.813) (-539.727) (-541.623) [-543.978] * (-538.561) [-538.712] (-538.497) (-540.647) -- 0:00:24
599000 -- (-539.386) [-544.042] (-539.864) (-540.757) * (-539.674) [-539.863] (-538.883) (-538.809) -- 0:00:24
599500 -- (-538.919) (-539.156) [-539.203] (-542.213) * (-539.008) (-539.473) (-539.256) [-540.206] -- 0:00:24
600000 -- (-539.675) (-539.260) [-543.542] (-542.816) * (-538.285) [-542.209] (-540.159) (-540.022) -- 0:00:24
Average standard deviation of split frequencies: 0.010569
600500 -- (-541.723) (-538.222) [-538.125] (-539.914) * (-538.701) (-539.392) [-541.479] (-547.058) -- 0:00:23
601000 -- (-539.521) [-538.486] (-541.905) (-538.415) * (-540.370) (-539.533) [-541.103] (-541.801) -- 0:00:23
601500 -- (-541.047) [-540.383] (-538.373) (-540.614) * [-538.494] (-538.160) (-537.945) (-541.224) -- 0:00:23
602000 -- (-538.244) [-539.427] (-543.641) (-538.557) * (-539.440) (-539.357) (-539.289) [-541.219] -- 0:00:23
602500 -- (-538.955) (-542.690) [-540.365] (-544.346) * (-539.185) [-540.929] (-539.236) (-540.621) -- 0:00:23
603000 -- (-539.538) [-538.232] (-540.174) (-538.696) * (-540.461) (-541.839) [-544.415] (-540.982) -- 0:00:23
603500 -- (-542.594) [-538.555] (-542.007) (-538.598) * (-540.862) (-543.294) [-540.155] (-540.854) -- 0:00:23
604000 -- (-541.992) [-538.867] (-540.014) (-541.478) * (-540.488) [-539.956] (-539.920) (-539.521) -- 0:00:23
604500 -- [-538.793] (-538.407) (-539.610) (-539.188) * (-542.384) (-538.869) (-540.089) [-540.231] -- 0:00:23
605000 -- (-541.789) (-541.223) [-541.776] (-538.347) * [-539.110] (-538.401) (-540.071) (-538.740) -- 0:00:23
Average standard deviation of split frequencies: 0.009750
605500 -- (-543.677) [-538.432] (-539.871) (-538.716) * (-538.451) [-542.146] (-546.775) (-538.748) -- 0:00:23
606000 -- [-542.222] (-541.728) (-543.572) (-543.647) * [-538.429] (-541.365) (-545.665) (-539.589) -- 0:00:23
606500 -- (-538.686) [-540.062] (-542.044) (-540.180) * [-539.160] (-543.348) (-541.456) (-538.843) -- 0:00:23
607000 -- [-538.684] (-538.133) (-539.566) (-544.547) * [-538.693] (-540.013) (-539.622) (-539.595) -- 0:00:23
607500 -- [-538.452] (-539.050) (-539.061) (-547.619) * (-542.492) [-541.604] (-539.481) (-543.382) -- 0:00:23
608000 -- (-542.991) (-539.051) [-541.564] (-540.520) * [-541.188] (-540.126) (-543.717) (-540.065) -- 0:00:23
608500 -- (-538.027) [-539.591] (-542.226) (-539.216) * (-542.182) (-541.385) (-542.105) [-539.712] -- 0:00:23
609000 -- (-537.866) (-540.688) [-540.331] (-538.884) * (-539.737) [-543.404] (-541.357) (-541.870) -- 0:00:23
609500 -- (-538.615) (-540.716) [-539.120] (-539.528) * (-544.705) (-538.888) (-541.699) [-540.989] -- 0:00:23
610000 -- (-538.685) (-538.993) [-539.591] (-540.816) * (-540.470) [-538.010] (-542.056) (-543.927) -- 0:00:23
Average standard deviation of split frequencies: 0.009624
610500 -- (-538.388) [-539.305] (-539.334) (-539.523) * (-541.977) (-538.591) [-540.675] (-539.726) -- 0:00:22
611000 -- (-541.653) [-539.100] (-542.559) (-541.529) * (-538.414) (-540.688) [-540.294] (-539.636) -- 0:00:22
611500 -- (-540.584) (-539.046) (-541.373) [-539.985] * (-540.275) (-538.258) (-538.914) [-541.901] -- 0:00:22
612000 -- (-542.126) (-542.597) [-539.799] (-539.040) * [-547.067] (-538.860) (-538.971) (-542.378) -- 0:00:22
612500 -- [-540.514] (-539.600) (-538.181) (-539.505) * (-545.644) [-541.762] (-538.173) (-538.344) -- 0:00:22
613000 -- (-539.781) (-539.597) [-545.659] (-539.118) * (-542.348) (-544.269) (-541.287) [-539.843] -- 0:00:22
613500 -- (-541.086) (-538.770) (-541.001) [-538.578] * [-538.250] (-539.928) (-539.480) (-538.486) -- 0:00:22
614000 -- (-538.901) (-543.145) [-540.844] (-539.119) * (-539.084) (-541.709) (-544.007) [-538.630] -- 0:00:22
614500 -- (-539.766) (-545.488) [-540.326] (-541.419) * [-538.959] (-546.100) (-543.755) (-539.164) -- 0:00:23
615000 -- [-542.623] (-539.054) (-542.902) (-539.189) * (-541.164) [-541.334] (-541.212) (-541.127) -- 0:00:23
Average standard deviation of split frequencies: 0.009591
615500 -- (-540.767) (-540.530) (-540.249) [-541.275] * [-539.407] (-546.105) (-538.099) (-539.067) -- 0:00:23
616000 -- (-539.514) [-539.165] (-540.007) (-543.407) * (-539.169) (-540.643) [-537.798] (-538.248) -- 0:00:23
616500 -- [-542.153] (-539.530) (-540.366) (-540.906) * [-538.752] (-543.419) (-539.226) (-538.453) -- 0:00:23
617000 -- [-538.754] (-539.239) (-540.951) (-539.531) * (-538.445) [-539.271] (-538.570) (-538.301) -- 0:00:22
617500 -- (-538.441) [-540.670] (-545.763) (-540.346) * (-540.456) (-540.996) [-538.193] (-539.148) -- 0:00:22
618000 -- (-541.458) [-539.028] (-539.362) (-539.547) * (-538.676) (-542.843) [-540.445] (-541.419) -- 0:00:22
618500 -- (-541.973) (-542.200) [-538.969] (-540.519) * (-539.965) (-541.588) (-542.324) [-539.391] -- 0:00:22
619000 -- [-542.561] (-543.302) (-542.985) (-543.290) * (-541.857) (-538.361) [-538.202] (-543.484) -- 0:00:22
619500 -- [-541.552] (-539.954) (-542.689) (-539.572) * (-540.381) [-539.255] (-541.274) (-538.747) -- 0:00:22
620000 -- (-540.378) (-540.106) [-540.357] (-542.396) * (-539.638) (-540.216) (-543.969) [-539.823] -- 0:00:22
Average standard deviation of split frequencies: 0.009469
620500 -- (-544.245) [-537.837] (-539.850) (-541.337) * (-540.744) [-538.746] (-543.176) (-540.569) -- 0:00:22
621000 -- (-540.236) [-540.601] (-540.213) (-540.577) * (-538.375) (-541.865) [-540.168] (-539.510) -- 0:00:22
621500 -- (-544.340) (-539.175) (-539.690) [-539.859] * (-538.099) (-540.261) [-540.182] (-542.291) -- 0:00:22
622000 -- (-544.070) (-538.936) [-545.623] (-539.207) * (-541.289) [-541.270] (-544.224) (-540.412) -- 0:00:22
622500 -- (-539.117) [-540.568] (-538.052) (-538.916) * (-538.684) (-541.289) (-538.479) [-538.867] -- 0:00:22
623000 -- (-538.802) [-540.366] (-538.061) (-540.573) * [-540.071] (-539.368) (-539.456) (-541.017) -- 0:00:22
623500 -- (-539.016) (-542.998) (-543.802) [-541.989] * (-538.959) (-548.521) (-540.081) [-539.405] -- 0:00:22
624000 -- [-541.738] (-542.843) (-542.908) (-539.033) * [-540.230] (-540.985) (-542.116) (-544.868) -- 0:00:22
624500 -- [-538.910] (-544.571) (-541.080) (-539.876) * (-540.534) (-546.468) (-541.012) [-539.106] -- 0:00:22
625000 -- (-539.325) [-539.802] (-541.904) (-540.027) * [-538.996] (-539.399) (-541.339) (-542.583) -- 0:00:22
Average standard deviation of split frequencies: 0.009037
625500 -- (-543.543) (-538.131) (-547.858) [-538.968] * [-539.016] (-541.127) (-543.714) (-541.105) -- 0:00:22
626000 -- [-540.433] (-542.317) (-541.005) (-538.961) * (-537.976) (-539.865) [-540.773] (-546.600) -- 0:00:22
626500 -- (-542.218) (-539.360) [-540.692] (-541.703) * (-538.367) (-540.648) [-537.881] (-540.291) -- 0:00:22
627000 -- (-541.346) [-538.525] (-538.708) (-539.735) * [-538.682] (-539.780) (-540.029) (-538.819) -- 0:00:22
627500 -- [-539.266] (-541.129) (-539.594) (-541.005) * (-537.980) [-541.020] (-538.061) (-541.726) -- 0:00:21
628000 -- (-544.820) (-538.937) [-538.303] (-540.364) * (-538.074) (-538.619) (-538.584) [-539.937] -- 0:00:21
628500 -- (-542.529) (-539.200) [-538.358] (-541.116) * (-538.208) (-539.035) [-541.536] (-543.794) -- 0:00:21
629000 -- (-544.407) (-540.947) [-538.301] (-540.403) * (-539.284) [-539.118] (-547.192) (-540.356) -- 0:00:21
629500 -- (-542.268) [-539.992] (-540.380) (-539.871) * (-537.955) (-538.811) [-546.350] (-540.708) -- 0:00:21
630000 -- (-540.948) (-538.376) (-539.807) [-538.972] * (-538.344) (-540.179) (-539.647) [-539.073] -- 0:00:21
Average standard deviation of split frequencies: 0.008870
630500 -- (-540.108) [-539.237] (-538.093) (-538.012) * (-538.104) (-539.522) [-540.898] (-540.812) -- 0:00:21
631000 -- (-539.814) (-541.401) [-538.352] (-538.676) * [-543.015] (-539.254) (-539.671) (-540.218) -- 0:00:21
631500 -- [-540.655] (-538.992) (-542.676) (-537.988) * (-538.224) (-541.799) (-539.442) [-541.450] -- 0:00:21
632000 -- (-541.031) [-541.995] (-541.550) (-541.869) * (-538.079) (-540.176) [-543.073] (-540.502) -- 0:00:22
632500 -- [-539.041] (-542.708) (-540.578) (-539.024) * (-539.407) [-538.112] (-541.198) (-540.946) -- 0:00:22
633000 -- (-538.526) (-542.840) (-540.577) [-538.423] * (-542.002) [-544.422] (-538.878) (-539.368) -- 0:00:22
633500 -- (-537.814) (-542.490) (-543.960) [-539.005] * (-539.634) [-541.026] (-538.868) (-538.195) -- 0:00:21
634000 -- [-540.284] (-538.553) (-541.575) (-539.834) * (-540.804) [-540.946] (-540.432) (-538.106) -- 0:00:21
634500 -- [-539.336] (-540.297) (-538.930) (-539.688) * (-541.749) [-539.201] (-539.677) (-537.769) -- 0:00:21
635000 -- (-543.095) [-539.014] (-539.241) (-538.363) * [-539.806] (-539.893) (-538.574) (-539.806) -- 0:00:21
Average standard deviation of split frequencies: 0.009092
635500 -- (-543.667) (-539.397) (-542.664) [-539.903] * [-541.066] (-541.032) (-538.468) (-540.185) -- 0:00:21
636000 -- (-538.514) (-539.813) (-540.613) [-538.524] * (-542.091) (-539.570) [-539.018] (-542.767) -- 0:00:21
636500 -- (-542.437) (-539.897) (-539.282) [-538.981] * (-543.257) (-540.202) [-539.104] (-540.565) -- 0:00:21
637000 -- (-541.977) [-537.872] (-538.969) (-538.973) * (-545.381) (-540.852) (-538.365) [-539.259] -- 0:00:21
637500 -- (-542.639) (-537.818) (-541.717) [-538.323] * [-546.161] (-546.448) (-539.385) (-540.597) -- 0:00:21
638000 -- (-539.145) (-539.223) [-538.449] (-538.936) * (-540.450) (-539.884) (-541.938) [-539.247] -- 0:00:21
638500 -- (-539.846) [-540.687] (-540.070) (-538.568) * [-538.002] (-543.277) (-543.230) (-539.906) -- 0:00:21
639000 -- [-540.263] (-541.065) (-539.120) (-539.561) * (-546.085) [-542.985] (-539.839) (-545.962) -- 0:00:21
639500 -- [-539.897] (-543.279) (-538.899) (-541.221) * (-539.420) (-543.425) (-541.347) [-538.977] -- 0:00:21
640000 -- (-540.152) (-541.188) [-540.912] (-539.428) * (-539.139) (-539.393) [-543.204] (-542.919) -- 0:00:21
Average standard deviation of split frequencies: 0.008928
640500 -- (-540.376) [-539.560] (-540.309) (-539.514) * (-546.325) [-539.994] (-541.578) (-539.494) -- 0:00:21
641000 -- [-540.089] (-540.033) (-538.496) (-539.123) * (-541.698) [-539.774] (-539.923) (-542.492) -- 0:00:21
641500 -- [-538.747] (-545.107) (-542.325) (-543.096) * (-544.292) (-541.809) (-541.184) [-541.489] -- 0:00:21
642000 -- (-537.786) (-539.964) (-539.561) [-539.940] * [-539.017] (-542.380) (-541.986) (-540.098) -- 0:00:21
642500 -- (-538.455) [-537.850] (-538.783) (-542.649) * [-539.968] (-538.756) (-538.273) (-540.402) -- 0:00:21
643000 -- (-538.103) (-539.893) [-540.186] (-539.753) * (-538.679) (-541.315) [-541.435] (-551.712) -- 0:00:21
643500 -- (-539.248) [-541.037] (-539.724) (-542.389) * (-540.340) [-543.657] (-541.878) (-540.450) -- 0:00:21
644000 -- (-540.865) (-539.154) (-541.683) [-540.353] * (-539.765) (-542.135) [-543.015] (-540.972) -- 0:00:21
644500 -- [-541.463] (-542.605) (-539.325) (-540.969) * (-539.017) (-543.671) [-539.112] (-539.197) -- 0:00:20
645000 -- (-538.347) (-539.334) [-541.168] (-541.691) * (-540.910) [-537.997] (-539.752) (-539.172) -- 0:00:20
Average standard deviation of split frequencies: 0.008951
645500 -- (-538.497) (-539.659) [-539.510] (-540.015) * (-541.981) [-538.969] (-540.482) (-539.348) -- 0:00:20
646000 -- (-538.395) (-539.576) (-542.749) [-540.210] * [-539.830] (-540.723) (-539.742) (-539.021) -- 0:00:20
646500 -- (-539.353) (-539.783) [-543.406] (-540.192) * (-538.619) (-540.453) (-539.007) [-539.608] -- 0:00:20
647000 -- (-540.260) (-543.863) (-538.810) [-540.589] * [-538.892] (-542.826) (-538.590) (-539.920) -- 0:00:20
647500 -- [-539.023] (-544.200) (-538.724) (-548.668) * (-537.827) (-541.538) [-540.636] (-539.677) -- 0:00:20
648000 -- [-539.604] (-539.296) (-540.389) (-541.740) * [-542.546] (-539.943) (-540.746) (-538.962) -- 0:00:20
648500 -- (-542.540) [-539.145] (-540.550) (-539.305) * [-541.266] (-538.950) (-540.333) (-544.357) -- 0:00:20
649000 -- (-539.351) [-538.887] (-540.999) (-539.712) * (-544.881) [-539.895] (-539.998) (-542.865) -- 0:00:21
649500 -- (-539.934) (-540.134) [-540.950] (-542.667) * (-541.731) (-542.911) (-539.646) [-540.075] -- 0:00:21
650000 -- (-539.192) (-539.343) [-540.027] (-540.642) * (-539.140) [-540.497] (-538.656) (-539.348) -- 0:00:21
Average standard deviation of split frequencies: 0.008597
650500 -- (-544.325) [-539.074] (-539.249) (-541.282) * [-538.047] (-540.213) (-540.121) (-543.384) -- 0:00:20
651000 -- (-544.718) (-541.539) [-539.848] (-539.837) * [-538.826] (-542.686) (-539.955) (-542.040) -- 0:00:20
651500 -- [-543.134] (-541.664) (-538.840) (-538.237) * (-538.354) (-542.540) (-540.539) [-539.357] -- 0:00:20
652000 -- (-538.326) [-539.573] (-538.005) (-538.449) * (-539.437) [-542.770] (-544.587) (-540.313) -- 0:00:20
652500 -- (-542.228) [-542.024] (-541.043) (-538.570) * (-543.524) (-540.582) (-542.991) [-541.173] -- 0:00:20
653000 -- [-539.277] (-540.272) (-539.159) (-539.944) * (-541.201) (-542.299) [-544.990] (-544.649) -- 0:00:20
653500 -- (-539.806) [-538.893] (-539.645) (-540.631) * (-541.555) [-539.757] (-540.416) (-540.449) -- 0:00:20
654000 -- (-539.136) (-539.013) (-543.500) [-539.344] * (-538.751) (-539.546) (-539.835) [-538.148] -- 0:00:20
654500 -- (-540.809) (-541.702) [-538.531] (-542.147) * (-540.794) [-540.851] (-540.684) (-540.875) -- 0:00:20
655000 -- (-539.756) [-539.307] (-539.109) (-542.435) * (-542.603) (-539.800) [-540.445] (-540.961) -- 0:00:20
Average standard deviation of split frequencies: 0.009150
655500 -- (-539.014) (-542.693) (-541.971) [-539.555] * (-539.994) (-539.360) (-540.792) [-539.779] -- 0:00:20
656000 -- (-540.159) (-538.869) (-541.700) [-538.997] * [-542.085] (-538.647) (-540.487) (-540.129) -- 0:00:20
656500 -- [-539.193] (-541.884) (-540.827) (-539.668) * (-541.770) (-538.767) (-538.938) [-540.634] -- 0:00:20
657000 -- (-539.906) (-541.527) [-540.544] (-539.036) * (-541.253) (-541.442) [-539.402] (-541.007) -- 0:00:20
657500 -- (-541.944) (-538.271) [-543.788] (-541.885) * (-538.884) (-541.210) [-542.754] (-541.988) -- 0:00:20
658000 -- (-540.756) (-540.134) [-538.360] (-539.254) * [-538.887] (-538.630) (-540.521) (-538.947) -- 0:00:20
658500 -- (-542.018) (-538.674) (-539.457) [-540.425] * (-538.485) [-541.274] (-540.603) (-541.080) -- 0:00:20
659000 -- (-538.899) (-545.094) [-542.016] (-541.475) * (-540.635) [-538.222] (-539.522) (-539.442) -- 0:00:20
659500 -- [-541.129] (-542.787) (-540.521) (-540.055) * (-545.191) [-538.358] (-541.844) (-541.533) -- 0:00:20
660000 -- (-538.764) [-538.635] (-539.646) (-545.531) * (-538.612) [-538.835] (-539.685) (-539.279) -- 0:00:20
Average standard deviation of split frequencies: 0.008895
660500 -- (-541.470) [-539.149] (-541.462) (-541.276) * (-539.336) [-539.382] (-539.326) (-538.223) -- 0:00:20
661000 -- [-541.645] (-540.003) (-544.082) (-540.705) * (-540.751) [-539.514] (-541.221) (-539.365) -- 0:00:20
661500 -- (-544.455) (-538.958) [-540.350] (-539.020) * [-538.770] (-537.973) (-543.031) (-540.654) -- 0:00:19
662000 -- (-540.912) (-541.680) (-541.941) [-539.444] * [-538.048] (-537.893) (-541.562) (-538.462) -- 0:00:19
662500 -- (-542.194) [-539.670] (-539.619) (-539.753) * (-540.861) [-539.557] (-540.826) (-540.104) -- 0:00:19
663000 -- (-538.371) (-540.930) (-543.479) [-540.279] * (-539.021) [-539.734] (-538.978) (-539.616) -- 0:00:19
663500 -- (-542.844) [-539.807] (-541.078) (-540.922) * (-539.294) (-539.603) (-543.861) [-539.622] -- 0:00:19
664000 -- (-539.957) (-539.209) (-542.490) [-538.164] * (-540.374) (-541.265) (-542.503) [-538.611] -- 0:00:19
664500 -- (-545.349) (-540.013) [-540.510] (-538.864) * (-540.584) (-542.260) [-539.811] (-538.845) -- 0:00:19
665000 -- (-540.196) [-539.624] (-542.618) (-537.956) * [-540.996] (-543.115) (-539.243) (-540.175) -- 0:00:19
Average standard deviation of split frequencies: 0.008730
665500 -- (-541.211) (-540.461) (-540.983) [-538.998] * (-540.279) (-538.911) (-540.786) [-541.797] -- 0:00:19
666000 -- (-540.812) (-539.011) (-542.221) [-539.770] * (-539.325) (-539.226) [-538.662] (-539.354) -- 0:00:20
666500 -- [-538.187] (-539.054) (-539.985) (-541.349) * (-539.315) (-540.117) (-541.443) [-540.602] -- 0:00:20
667000 -- (-538.317) [-538.857] (-541.150) (-538.922) * (-540.510) (-541.271) [-539.769] (-542.154) -- 0:00:19
667500 -- [-540.351] (-540.994) (-541.793) (-539.020) * [-540.603] (-541.375) (-541.487) (-543.172) -- 0:00:19
668000 -- (-538.522) (-540.305) (-542.149) [-543.772] * (-539.603) [-539.491] (-539.315) (-538.754) -- 0:00:19
668500 -- (-539.442) (-538.610) [-539.264] (-540.334) * (-541.806) (-538.825) (-539.118) [-538.910] -- 0:00:19
669000 -- (-539.236) (-543.956) (-538.751) [-539.616] * (-538.842) (-539.938) (-538.671) [-540.310] -- 0:00:19
669500 -- (-538.965) (-541.828) (-540.450) [-538.409] * (-540.601) [-546.561] (-539.146) (-541.154) -- 0:00:19
670000 -- (-539.731) (-541.317) (-540.623) [-537.942] * [-539.807] (-539.466) (-542.651) (-541.114) -- 0:00:19
Average standard deviation of split frequencies: 0.009138
670500 -- [-538.635] (-544.253) (-541.897) (-542.584) * (-541.709) [-538.018] (-541.459) (-546.228) -- 0:00:19
671000 -- (-539.031) (-540.891) [-541.325] (-541.022) * (-538.900) (-539.078) (-541.736) [-544.471] -- 0:00:19
671500 -- [-538.668] (-541.629) (-539.858) (-539.672) * (-541.801) (-539.410) (-541.509) [-542.876] -- 0:00:19
672000 -- (-539.094) (-538.664) [-539.380] (-538.977) * (-541.002) (-542.164) (-538.486) [-539.827] -- 0:00:19
672500 -- [-539.086] (-540.736) (-540.795) (-538.979) * (-540.266) (-541.335) (-539.175) [-538.278] -- 0:00:19
673000 -- (-538.901) [-540.628] (-539.900) (-538.835) * (-539.716) [-539.873] (-539.480) (-538.319) -- 0:00:19
673500 -- [-539.058] (-538.202) (-540.108) (-539.145) * (-541.125) (-540.691) [-537.966] (-540.682) -- 0:00:19
674000 -- (-542.182) (-539.549) [-541.089] (-546.615) * (-540.667) [-543.113] (-541.351) (-541.085) -- 0:00:19
674500 -- (-539.652) (-539.916) (-540.967) [-542.845] * (-538.269) (-541.858) [-541.397] (-541.894) -- 0:00:19
675000 -- (-538.683) (-539.847) [-542.013] (-543.130) * (-540.901) [-539.304] (-539.783) (-539.508) -- 0:00:19
Average standard deviation of split frequencies: 0.008647
675500 -- (-543.043) (-541.444) [-539.646] (-539.760) * (-540.971) (-537.755) [-541.046] (-540.155) -- 0:00:19
676000 -- [-540.931] (-541.998) (-538.018) (-541.550) * (-542.363) [-539.356] (-538.962) (-538.783) -- 0:00:19
676500 -- (-540.370) [-539.376] (-539.514) (-541.642) * (-541.844) (-539.775) (-538.764) [-539.389] -- 0:00:19
677000 -- (-541.062) [-538.960] (-542.882) (-543.512) * [-540.850] (-539.738) (-538.396) (-538.513) -- 0:00:19
677500 -- (-540.399) [-539.165] (-540.548) (-544.267) * (-538.927) [-540.603] (-540.837) (-538.567) -- 0:00:19
678000 -- (-541.968) (-542.782) [-540.152] (-539.930) * [-540.648] (-539.274) (-539.838) (-539.742) -- 0:00:18
678500 -- (-539.842) (-541.934) (-541.818) [-539.356] * (-544.513) (-538.655) [-539.439] (-541.534) -- 0:00:18
679000 -- (-538.388) [-538.440] (-539.970) (-539.355) * [-539.821] (-539.758) (-538.380) (-540.215) -- 0:00:18
679500 -- [-537.827] (-540.058) (-538.764) (-538.615) * (-539.950) [-538.440] (-542.467) (-543.899) -- 0:00:18
680000 -- [-541.312] (-539.596) (-543.076) (-543.355) * (-541.497) (-537.910) (-543.130) [-540.061] -- 0:00:18
Average standard deviation of split frequencies: 0.008542
680500 -- (-539.654) [-538.733] (-539.166) (-541.738) * (-539.565) (-541.504) (-540.086) [-539.380] -- 0:00:18
681000 -- [-540.621] (-540.284) (-538.084) (-544.041) * (-539.142) (-540.565) (-538.935) [-538.181] -- 0:00:18
681500 -- (-540.373) (-543.774) (-539.464) [-541.536] * (-539.142) [-540.151] (-538.181) (-543.648) -- 0:00:18
682000 -- (-539.080) (-543.352) [-538.873] (-539.177) * (-543.546) (-540.134) (-543.591) [-540.755] -- 0:00:18
682500 -- (-538.624) (-540.884) [-540.518] (-538.865) * (-538.722) (-541.331) (-538.976) [-539.239] -- 0:00:18
683000 -- (-541.132) [-542.739] (-538.789) (-542.119) * (-539.077) (-539.751) (-542.443) [-540.239] -- 0:00:19
683500 -- (-541.688) (-539.534) (-539.300) [-539.841] * [-539.902] (-541.809) (-538.370) (-541.377) -- 0:00:18
684000 -- (-543.308) (-539.260) [-539.410] (-539.891) * (-539.714) [-539.804] (-539.855) (-540.533) -- 0:00:18
684500 -- (-540.155) [-540.439] (-539.915) (-542.866) * (-540.724) (-539.802) [-539.233] (-539.467) -- 0:00:18
685000 -- (-542.128) (-538.364) (-538.960) [-540.573] * (-539.764) [-539.771] (-540.902) (-543.082) -- 0:00:18
Average standard deviation of split frequencies: 0.009254
685500 -- (-539.705) [-538.555] (-539.035) (-543.438) * (-544.600) (-541.794) [-539.657] (-542.589) -- 0:00:18
686000 -- (-543.223) (-538.424) (-540.419) [-541.802] * (-538.339) [-542.362] (-538.899) (-541.293) -- 0:00:18
686500 -- (-539.648) (-539.644) [-538.185] (-545.568) * (-538.577) (-539.688) (-539.134) [-540.792] -- 0:00:18
687000 -- (-537.934) (-539.796) (-538.410) [-540.363] * (-539.823) [-541.029] (-542.051) (-543.105) -- 0:00:18
687500 -- [-539.430] (-539.716) (-539.927) (-540.927) * (-541.299) [-539.417] (-538.405) (-543.064) -- 0:00:18
688000 -- (-540.506) [-540.324] (-541.504) (-540.343) * (-541.298) (-539.897) [-539.039] (-545.025) -- 0:00:18
688500 -- [-538.314] (-537.920) (-539.851) (-538.476) * (-539.927) (-542.832) (-538.328) [-540.074] -- 0:00:18
689000 -- (-538.436) (-539.973) (-538.187) [-541.857] * (-540.523) [-542.759] (-539.245) (-538.932) -- 0:00:18
689500 -- (-542.887) (-539.101) [-538.388] (-540.641) * (-540.270) (-538.417) (-538.928) [-538.069] -- 0:00:18
690000 -- (-539.258) [-538.843] (-541.921) (-541.905) * (-538.048) [-538.488] (-538.604) (-539.518) -- 0:00:18
Average standard deviation of split frequencies: 0.008554
690500 -- (-545.979) (-541.394) (-541.234) [-539.656] * (-540.724) [-541.338] (-539.891) (-538.746) -- 0:00:18
691000 -- (-542.103) [-539.168] (-540.574) (-538.455) * (-537.798) (-541.622) (-540.351) [-538.762] -- 0:00:18
691500 -- (-547.615) [-538.647] (-542.862) (-538.657) * (-538.246) (-542.163) (-539.878) [-539.910] -- 0:00:18
692000 -- (-542.928) [-538.508] (-537.958) (-538.788) * (-545.564) (-542.411) (-538.512) [-537.766] -- 0:00:18
692500 -- (-538.673) (-540.545) (-538.586) [-539.225] * (-541.893) (-538.567) (-538.525) [-538.451] -- 0:00:18
693000 -- (-538.927) (-539.232) (-538.260) [-539.644] * (-539.941) (-540.111) [-538.875] (-542.427) -- 0:00:18
693500 -- (-540.544) (-539.052) (-538.690) [-540.205] * (-545.171) (-538.691) [-543.101] (-538.849) -- 0:00:18
694000 -- (-540.595) [-539.783] (-538.846) (-540.381) * (-541.226) (-542.931) [-541.171] (-540.669) -- 0:00:18
694500 -- [-538.480] (-539.103) (-541.337) (-540.483) * (-540.625) (-541.321) [-540.327] (-538.483) -- 0:00:18
695000 -- (-538.444) [-540.006] (-543.839) (-543.152) * (-541.307) [-539.628] (-539.872) (-541.076) -- 0:00:17
Average standard deviation of split frequencies: 0.008805
695500 -- (-538.866) (-538.920) [-539.344] (-542.348) * [-539.267] (-545.054) (-541.082) (-539.372) -- 0:00:17
696000 -- (-538.904) (-539.650) [-538.776] (-540.782) * (-544.804) (-539.063) [-538.125] (-541.931) -- 0:00:17
696500 -- (-543.550) (-539.594) (-538.353) [-538.583] * (-539.922) (-539.869) [-540.683] (-541.449) -- 0:00:17
697000 -- (-539.462) (-543.172) [-540.196] (-541.274) * (-540.250) (-539.516) [-544.181] (-540.589) -- 0:00:17
697500 -- (-539.252) [-543.473] (-538.761) (-540.061) * (-539.273) (-540.250) [-541.214] (-539.963) -- 0:00:17
698000 -- (-540.850) (-540.577) (-539.247) [-540.976] * [-539.876] (-538.746) (-539.113) (-541.982) -- 0:00:17
698500 -- (-538.816) [-541.036] (-541.703) (-541.994) * (-538.282) (-541.027) [-538.035] (-543.524) -- 0:00:17
699000 -- (-539.332) (-540.087) (-542.276) [-539.853] * [-538.758] (-539.355) (-540.839) (-538.972) -- 0:00:17
699500 -- (-539.842) [-541.112] (-539.008) (-538.351) * (-538.135) [-539.907] (-540.909) (-541.249) -- 0:00:17
700000 -- (-542.445) (-541.902) [-538.504] (-538.750) * (-539.500) (-540.875) (-541.396) [-539.343] -- 0:00:17
Average standard deviation of split frequencies: 0.009554
700500 -- [-541.722] (-540.087) (-543.175) (-538.811) * (-541.769) (-539.519) (-541.237) [-538.690] -- 0:00:17
701000 -- (-539.907) (-538.827) [-541.706] (-538.989) * (-541.275) [-538.816] (-540.501) (-545.239) -- 0:00:17
701500 -- (-539.564) (-543.235) (-538.030) [-539.695] * (-544.046) [-537.910] (-540.208) (-543.891) -- 0:00:17
702000 -- [-539.300] (-540.108) (-538.162) (-538.751) * (-540.676) (-538.270) (-538.602) [-539.919] -- 0:00:17
702500 -- (-538.707) (-542.611) [-538.369] (-540.678) * (-543.758) (-541.294) (-537.956) [-543.007] -- 0:00:17
703000 -- [-538.580] (-539.825) (-538.745) (-539.567) * (-539.203) (-541.162) (-543.541) [-540.170] -- 0:00:17
703500 -- (-539.281) (-540.073) [-538.543] (-541.197) * (-539.202) (-542.372) [-538.752] (-540.139) -- 0:00:17
704000 -- (-539.724) (-541.430) [-543.412] (-541.174) * (-539.941) (-542.500) [-544.034] (-539.662) -- 0:00:17
704500 -- [-540.661] (-543.117) (-540.353) (-539.124) * [-539.928] (-544.139) (-540.121) (-539.835) -- 0:00:17
705000 -- (-539.420) (-538.869) (-539.464) [-539.194] * (-540.182) (-543.140) [-540.515] (-539.437) -- 0:00:17
Average standard deviation of split frequencies: 0.009704
705500 -- (-541.832) (-539.535) (-538.087) [-539.407] * [-540.063] (-539.765) (-540.144) (-543.351) -- 0:00:17
706000 -- (-539.178) [-538.651] (-540.846) (-537.846) * (-540.110) (-543.011) (-538.796) [-540.203] -- 0:00:17
706500 -- (-541.573) (-539.765) [-540.187] (-540.738) * [-540.777] (-546.537) (-540.280) (-540.350) -- 0:00:17
707000 -- (-539.571) [-541.650] (-540.377) (-538.979) * (-539.738) [-540.115] (-541.856) (-539.783) -- 0:00:17
707500 -- [-542.409] (-539.392) (-539.403) (-539.632) * (-539.113) (-539.493) (-545.288) [-538.961] -- 0:00:17
708000 -- (-540.991) [-539.573] (-541.276) (-538.996) * (-540.982) (-540.436) [-545.376] (-539.850) -- 0:00:17
708500 -- (-538.159) (-539.864) [-539.002] (-540.734) * [-538.371] (-545.937) (-541.033) (-539.959) -- 0:00:17
709000 -- (-542.646) (-539.490) (-541.105) [-544.616] * (-540.408) [-539.933] (-540.632) (-542.532) -- 0:00:17
709500 -- [-544.596] (-540.207) (-540.147) (-541.658) * (-538.221) (-539.181) [-539.733] (-540.165) -- 0:00:17
710000 -- (-538.445) (-540.621) [-539.450] (-543.458) * [-538.137] (-539.989) (-538.023) (-538.731) -- 0:00:17
Average standard deviation of split frequencies: 0.009065
710500 -- (-539.804) [-539.303] (-539.654) (-540.251) * (-538.535) (-540.196) (-539.556) [-541.222] -- 0:00:17
711000 -- (-542.167) (-539.179) [-538.248] (-540.243) * (-540.626) [-540.075] (-539.856) (-540.152) -- 0:00:17
711500 -- (-543.650) (-538.705) (-539.710) [-539.329] * (-541.383) (-541.764) [-540.944] (-540.916) -- 0:00:17
712000 -- (-538.773) (-539.953) (-540.701) [-538.040] * (-542.088) [-539.402] (-538.195) (-539.289) -- 0:00:16
712500 -- [-539.391] (-540.585) (-542.522) (-538.207) * (-538.943) (-539.777) [-537.886] (-540.591) -- 0:00:16
713000 -- (-541.265) (-539.524) [-539.715] (-538.944) * (-539.851) (-539.918) (-537.721) [-539.331] -- 0:00:16
713500 -- (-542.169) [-540.111] (-540.099) (-542.462) * (-542.863) [-539.918] (-538.049) (-539.068) -- 0:00:16
714000 -- (-540.351) (-540.179) [-539.720] (-540.261) * [-538.283] (-539.934) (-538.310) (-539.646) -- 0:00:16
714500 -- (-541.251) (-538.658) (-539.292) [-538.154] * [-540.641] (-543.506) (-540.649) (-542.792) -- 0:00:16
715000 -- [-540.826] (-539.812) (-540.432) (-539.696) * [-540.727] (-543.785) (-538.350) (-539.137) -- 0:00:16
Average standard deviation of split frequencies: 0.008778
715500 -- (-541.967) [-538.794] (-541.915) (-540.801) * [-539.458] (-545.126) (-538.816) (-542.229) -- 0:00:16
716000 -- [-539.761] (-540.661) (-541.442) (-538.655) * [-538.099] (-539.303) (-539.712) (-540.746) -- 0:00:16
716500 -- (-540.245) (-542.844) (-540.897) [-540.227] * [-538.480] (-538.803) (-540.149) (-543.475) -- 0:00:16
717000 -- [-540.685] (-539.280) (-538.908) (-538.848) * (-539.057) [-538.277] (-542.096) (-539.995) -- 0:00:16
717500 -- [-539.724] (-539.208) (-541.181) (-541.572) * (-539.508) [-538.419] (-541.485) (-538.275) -- 0:00:16
718000 -- (-539.717) [-542.762] (-542.520) (-540.381) * (-540.558) (-539.116) [-542.308] (-541.740) -- 0:00:16
718500 -- (-542.125) (-538.520) [-542.395] (-540.986) * [-539.373] (-539.372) (-540.677) (-540.897) -- 0:00:16
719000 -- [-541.194] (-540.155) (-538.865) (-544.185) * (-540.847) (-540.272) (-540.924) [-538.891] -- 0:00:16
719500 -- (-539.040) [-540.640] (-539.967) (-538.907) * (-538.951) (-539.963) (-541.423) [-537.990] -- 0:00:16
720000 -- [-541.490] (-540.164) (-540.624) (-540.357) * (-538.891) (-538.326) (-539.555) [-540.436] -- 0:00:16
Average standard deviation of split frequencies: 0.008634
720500 -- (-539.070) (-541.624) (-539.736) [-538.830] * (-540.176) [-539.707] (-538.089) (-539.979) -- 0:00:16
721000 -- (-539.849) [-545.485] (-541.192) (-542.266) * (-543.955) [-541.750] (-539.593) (-541.622) -- 0:00:16
721500 -- (-539.583) (-538.544) [-540.517] (-542.111) * (-539.801) [-538.582] (-539.175) (-538.884) -- 0:00:16
722000 -- (-540.905) (-542.161) [-539.913] (-538.260) * (-543.096) (-538.540) (-540.092) [-541.518] -- 0:00:16
722500 -- (-539.159) (-538.914) [-538.236] (-538.729) * (-540.285) (-538.501) (-539.214) [-540.204] -- 0:00:16
723000 -- (-540.835) [-539.405] (-538.161) (-538.892) * (-541.752) (-539.121) (-541.135) [-542.930] -- 0:00:16
723500 -- [-539.933] (-538.989) (-537.891) (-539.055) * (-538.486) (-538.242) [-538.561] (-541.133) -- 0:00:16
724000 -- (-538.644) (-542.696) (-539.850) [-539.092] * (-539.438) (-544.581) (-538.340) [-542.843] -- 0:00:16
724500 -- [-540.186] (-538.714) (-539.186) (-542.833) * (-539.964) [-540.622] (-541.969) (-542.526) -- 0:00:16
725000 -- (-538.760) [-538.655] (-541.984) (-540.655) * (-541.715) [-538.229] (-538.939) (-539.371) -- 0:00:16
Average standard deviation of split frequencies: 0.008744
725500 -- (-538.819) (-539.329) (-540.759) [-540.442] * (-540.960) (-539.558) (-541.493) [-540.415] -- 0:00:16
726000 -- [-538.732] (-538.896) (-540.624) (-538.871) * (-541.571) [-539.392] (-539.435) (-541.134) -- 0:00:16
726500 -- (-540.865) (-540.328) (-539.015) [-540.428] * (-538.498) (-537.974) [-538.960] (-538.556) -- 0:00:16
727000 -- (-541.062) (-539.248) (-540.084) [-542.646] * (-538.195) [-538.440] (-539.865) (-541.481) -- 0:00:16
727500 -- [-542.280] (-538.911) (-542.974) (-539.880) * (-542.123) (-539.091) (-542.907) [-540.725] -- 0:00:16
728000 -- (-541.394) (-539.750) [-539.819] (-539.723) * (-541.667) [-540.038] (-545.245) (-540.878) -- 0:00:16
728500 -- (-537.969) (-538.482) (-539.099) [-540.002] * (-539.329) (-538.605) (-542.033) [-542.555] -- 0:00:16
729000 -- (-541.242) (-541.385) [-542.317] (-539.104) * (-539.518) (-539.894) (-543.495) [-538.273] -- 0:00:15
729500 -- (-541.918) (-539.297) (-541.621) [-538.300] * (-539.316) [-542.509] (-539.391) (-539.827) -- 0:00:15
730000 -- (-543.930) [-538.613] (-541.150) (-539.734) * (-539.096) (-542.481) [-539.339] (-539.147) -- 0:00:15
Average standard deviation of split frequencies: 0.008602
730500 -- (-540.006) (-540.099) (-540.267) [-539.448] * (-539.696) (-540.948) (-539.852) [-540.462] -- 0:00:15
731000 -- (-540.140) [-540.741] (-539.748) (-538.675) * (-539.674) [-538.412] (-541.005) (-548.633) -- 0:00:15
731500 -- (-539.657) (-539.072) (-543.504) [-538.443] * (-540.063) (-538.650) [-540.021] (-544.212) -- 0:00:15
732000 -- [-538.956] (-538.520) (-539.895) (-538.975) * (-539.026) [-539.767] (-541.443) (-538.939) -- 0:00:15
732500 -- (-538.359) (-538.468) (-541.336) [-539.070] * (-540.624) (-543.988) [-541.976] (-539.664) -- 0:00:15
733000 -- [-539.380] (-539.868) (-540.698) (-543.659) * [-541.024] (-539.655) (-541.570) (-539.114) -- 0:00:15
733500 -- [-538.681] (-540.361) (-541.016) (-543.792) * (-540.438) (-539.610) (-542.168) [-538.262] -- 0:00:15
734000 -- (-538.746) (-539.958) [-542.236] (-539.448) * (-539.006) [-539.664] (-539.663) (-538.550) -- 0:00:15
734500 -- [-541.173] (-541.129) (-543.666) (-540.545) * (-542.158) [-542.576] (-542.387) (-541.841) -- 0:00:15
735000 -- (-540.819) [-541.094] (-541.290) (-540.927) * (-539.647) (-539.112) [-542.443] (-538.827) -- 0:00:15
Average standard deviation of split frequencies: 0.008497
735500 -- [-539.692] (-538.414) (-544.817) (-538.423) * (-540.016) (-538.072) (-539.750) [-539.899] -- 0:00:15
736000 -- [-538.569] (-539.488) (-542.952) (-545.240) * (-539.024) (-541.798) (-541.450) [-538.206] -- 0:00:15
736500 -- (-539.522) [-539.382] (-540.237) (-539.213) * (-539.407) [-540.428] (-539.880) (-543.992) -- 0:00:15
737000 -- [-540.056] (-544.036) (-539.403) (-538.934) * (-541.771) (-538.377) (-542.770) [-540.162] -- 0:00:15
737500 -- (-539.973) (-543.617) (-540.107) [-539.623] * (-538.890) (-539.122) (-543.123) [-539.868] -- 0:00:15
738000 -- (-540.552) [-539.354] (-542.878) (-540.845) * (-542.048) (-538.318) (-543.860) [-539.917] -- 0:00:15
738500 -- (-539.383) (-539.416) (-540.716) [-539.018] * [-541.921] (-539.204) (-541.047) (-541.676) -- 0:00:15
739000 -- [-539.029] (-540.601) (-541.358) (-540.222) * (-540.157) [-539.107] (-543.764) (-542.100) -- 0:00:15
739500 -- (-545.312) (-538.057) (-539.500) [-542.074] * [-541.719] (-538.601) (-538.639) (-540.151) -- 0:00:15
740000 -- (-539.301) [-540.671] (-541.657) (-541.534) * (-539.835) (-541.690) (-538.007) [-538.530] -- 0:00:15
Average standard deviation of split frequencies: 0.008529
740500 -- (-538.300) [-539.545] (-540.411) (-539.446) * (-541.173) (-539.344) (-541.257) [-541.441] -- 0:00:15
741000 -- (-538.071) [-537.774] (-539.662) (-538.298) * [-538.160] (-541.056) (-543.243) (-539.772) -- 0:00:15
741500 -- [-539.046] (-540.660) (-540.656) (-539.500) * [-538.516] (-542.073) (-541.722) (-538.974) -- 0:00:15
742000 -- (-539.303) [-539.453] (-540.061) (-539.125) * (-539.602) (-539.682) (-541.345) [-538.718] -- 0:00:15
742500 -- (-540.113) (-540.231) [-539.598] (-538.768) * (-538.498) [-539.182] (-539.289) (-537.916) -- 0:00:15
743000 -- [-537.964] (-543.439) (-538.296) (-542.247) * [-539.816] (-540.601) (-539.243) (-537.989) -- 0:00:15
743500 -- (-539.704) (-538.228) [-539.556] (-540.357) * (-539.830) [-538.372] (-538.607) (-538.511) -- 0:00:15
744000 -- (-538.186) [-539.247] (-537.979) (-540.523) * (-538.853) [-538.128] (-538.607) (-539.145) -- 0:00:15
744500 -- (-538.886) [-541.263] (-542.032) (-540.105) * (-541.907) (-538.619) (-538.345) [-540.242] -- 0:00:15
745000 -- (-540.882) [-542.293] (-542.142) (-542.173) * [-540.620] (-540.992) (-544.064) (-539.485) -- 0:00:15
Average standard deviation of split frequencies: 0.008762
745500 -- (-540.610) [-539.017] (-544.474) (-539.287) * [-539.656] (-539.693) (-539.490) (-539.130) -- 0:00:15
746000 -- (-544.018) (-538.488) (-538.785) [-539.999] * (-542.364) (-547.279) [-539.002] (-540.378) -- 0:00:14
746500 -- (-548.038) (-539.159) (-542.265) [-539.456] * (-544.759) (-545.510) (-538.409) [-542.228] -- 0:00:14
747000 -- (-548.896) [-540.830] (-539.742) (-539.285) * (-541.919) [-541.878] (-538.616) (-541.596) -- 0:00:14
747500 -- (-541.282) (-538.219) [-540.670] (-541.370) * (-538.950) [-541.454] (-538.329) (-539.734) -- 0:00:14
748000 -- [-540.017] (-538.368) (-540.286) (-539.475) * [-538.380] (-539.897) (-542.284) (-540.065) -- 0:00:14
748500 -- (-539.821) [-539.503] (-540.236) (-539.409) * (-543.136) (-538.130) [-547.588] (-539.669) -- 0:00:14
749000 -- [-542.416] (-540.076) (-539.159) (-541.996) * [-544.221] (-538.542) (-543.897) (-539.620) -- 0:00:14
749500 -- [-541.267] (-541.649) (-541.626) (-541.747) * [-540.743] (-540.219) (-541.806) (-538.825) -- 0:00:14
750000 -- (-540.935) (-541.297) (-539.663) [-539.532] * (-543.643) (-539.543) (-540.528) [-537.918] -- 0:00:14
Average standard deviation of split frequencies: 0.008541
750500 -- (-543.849) (-541.477) [-539.082] (-538.724) * (-541.773) [-540.892] (-540.507) (-538.477) -- 0:00:14
751000 -- (-544.677) (-539.343) (-538.850) [-538.811] * (-538.771) (-539.312) (-539.077) [-539.194] -- 0:00:14
751500 -- (-539.609) (-538.804) (-541.919) [-540.621] * (-541.168) (-539.740) (-539.368) [-540.169] -- 0:00:14
752000 -- (-540.375) (-540.150) (-542.836) [-541.682] * (-541.621) (-538.834) [-539.809] (-539.345) -- 0:00:14
752500 -- (-549.358) (-539.467) [-538.433] (-541.083) * (-541.343) [-538.275] (-540.866) (-541.568) -- 0:00:14
753000 -- (-544.925) [-539.740] (-541.231) (-539.664) * (-540.419) (-545.366) [-540.753] (-545.579) -- 0:00:14
753500 -- [-538.883] (-540.443) (-539.819) (-539.429) * (-540.806) (-538.812) (-538.161) [-544.663] -- 0:00:14
754000 -- (-538.777) (-538.437) (-539.419) [-539.504] * (-539.860) (-538.924) [-538.064] (-546.363) -- 0:00:14
754500 -- (-540.211) (-540.110) (-540.649) [-539.185] * [-539.125] (-538.389) (-545.181) (-541.209) -- 0:00:14
755000 -- (-539.226) [-540.637] (-542.650) (-539.560) * (-540.098) (-541.781) [-541.542] (-540.417) -- 0:00:14
Average standard deviation of split frequencies: 0.008854
755500 -- (-540.881) (-538.469) [-541.174] (-542.876) * [-538.576] (-540.730) (-540.657) (-539.632) -- 0:00:14
756000 -- [-540.009] (-539.357) (-539.764) (-539.972) * (-538.720) [-540.964] (-540.121) (-539.869) -- 0:00:14
756500 -- (-541.611) [-538.167] (-539.479) (-541.311) * [-538.233] (-539.773) (-541.169) (-540.062) -- 0:00:14
757000 -- (-543.279) (-546.732) [-541.753] (-540.066) * (-539.570) [-542.348] (-541.970) (-540.922) -- 0:00:14
757500 -- [-540.864] (-540.234) (-538.947) (-539.592) * (-538.597) [-543.011] (-539.350) (-539.589) -- 0:00:14
758000 -- (-540.158) [-540.025] (-540.913) (-539.797) * [-539.504] (-541.479) (-541.030) (-539.664) -- 0:00:14
758500 -- (-538.300) (-541.316) (-538.964) [-539.458] * (-540.036) (-543.113) [-541.106] (-540.388) -- 0:00:14
759000 -- [-539.712] (-540.031) (-542.492) (-543.131) * [-541.914] (-538.294) (-538.592) (-541.420) -- 0:00:14
759500 -- (-539.510) [-543.477] (-540.946) (-542.105) * [-539.710] (-539.865) (-540.848) (-540.338) -- 0:00:14
760000 -- (-539.163) (-540.286) (-542.706) [-537.965] * (-540.094) (-539.622) (-542.175) [-540.259] -- 0:00:14
Average standard deviation of split frequencies: 0.008470
760500 -- (-539.724) (-542.233) [-540.291] (-539.767) * (-539.726) [-538.537] (-540.579) (-538.946) -- 0:00:14
761000 -- (-539.298) (-539.689) [-541.754] (-539.916) * (-542.422) (-538.695) [-538.494] (-539.770) -- 0:00:14
761500 -- [-542.706] (-542.775) (-538.705) (-539.939) * (-539.039) (-538.644) (-540.728) [-539.276] -- 0:00:14
762000 -- [-541.382] (-541.543) (-543.002) (-539.749) * (-542.099) (-541.613) (-547.579) [-538.617] -- 0:00:14
762500 -- [-539.675] (-538.775) (-546.140) (-540.104) * (-540.840) (-540.879) [-538.806] (-540.139) -- 0:00:14
763000 -- [-539.189] (-540.283) (-542.921) (-539.133) * (-539.900) (-539.560) [-539.600] (-539.713) -- 0:00:13
763500 -- [-538.778] (-540.268) (-538.665) (-539.581) * (-538.576) (-541.102) [-539.965] (-538.918) -- 0:00:13
764000 -- (-541.092) (-538.612) (-540.163) [-538.295] * [-540.102] (-540.870) (-540.309) (-540.378) -- 0:00:13
764500 -- (-539.883) (-542.005) [-540.158] (-539.749) * [-538.195] (-540.248) (-544.570) (-541.897) -- 0:00:13
765000 -- (-541.199) (-542.130) [-540.317] (-540.758) * (-539.900) (-539.705) (-538.386) [-540.744] -- 0:00:13
Average standard deviation of split frequencies: 0.008193
765500 -- [-539.831] (-540.665) (-540.113) (-540.238) * (-540.673) (-541.084) [-538.352] (-540.152) -- 0:00:13
766000 -- (-541.001) (-546.312) [-539.127] (-539.034) * (-538.366) (-542.134) (-540.832) [-543.408] -- 0:00:13
766500 -- [-539.234] (-542.670) (-540.219) (-540.095) * (-539.482) [-543.143] (-540.254) (-539.672) -- 0:00:13
767000 -- (-540.091) [-543.900] (-542.726) (-539.666) * [-541.665] (-541.888) (-539.447) (-540.574) -- 0:00:13
767500 -- [-539.321] (-540.631) (-544.541) (-538.850) * [-540.723] (-538.326) (-539.838) (-538.934) -- 0:00:13
768000 -- [-539.548] (-542.698) (-540.552) (-538.786) * (-541.059) (-543.851) (-541.242) [-539.253] -- 0:00:13
768500 -- [-538.109] (-540.282) (-542.544) (-540.865) * (-539.609) [-541.539] (-538.556) (-538.435) -- 0:00:13
769000 -- (-538.148) (-540.136) [-541.270] (-539.575) * (-538.459) (-539.513) (-543.490) [-539.450] -- 0:00:13
769500 -- (-539.344) (-539.775) [-540.214] (-541.571) * (-541.764) (-541.047) [-543.018] (-539.268) -- 0:00:13
770000 -- (-542.668) (-539.031) (-541.050) [-541.292] * (-539.980) (-543.707) (-539.740) [-540.923] -- 0:00:13
Average standard deviation of split frequencies: 0.007531
770500 -- (-538.682) (-538.925) [-541.419] (-540.643) * (-540.313) (-541.666) (-540.376) [-539.457] -- 0:00:13
771000 -- (-538.988) (-537.782) [-539.104] (-539.509) * [-539.096] (-539.759) (-539.749) (-540.830) -- 0:00:13
771500 -- [-538.600] (-540.937) (-538.146) (-539.610) * (-539.151) (-538.458) [-538.978] (-538.214) -- 0:00:13
772000 -- [-540.784] (-540.105) (-540.531) (-541.254) * [-539.038] (-540.063) (-541.746) (-539.146) -- 0:00:13
772500 -- [-540.137] (-539.493) (-540.780) (-544.409) * (-540.832) [-539.937] (-539.185) (-537.959) -- 0:00:13
773000 -- (-542.992) (-540.555) (-539.511) [-543.536] * (-545.217) [-539.635] (-538.378) (-540.190) -- 0:00:13
773500 -- [-538.046] (-540.183) (-541.050) (-542.286) * [-539.388] (-541.692) (-540.094) (-542.163) -- 0:00:13
774000 -- [-539.049] (-539.197) (-539.832) (-540.229) * (-540.784) (-539.898) (-539.441) [-541.008] -- 0:00:13
774500 -- (-538.369) (-540.838) [-539.802] (-544.192) * (-539.801) (-540.928) (-539.843) [-543.216] -- 0:00:13
775000 -- (-539.491) [-538.565] (-539.593) (-539.119) * (-539.429) [-540.246] (-537.913) (-539.973) -- 0:00:13
Average standard deviation of split frequencies: 0.007707
775500 -- (-537.887) (-542.517) [-541.811] (-539.775) * [-539.150] (-539.505) (-539.053) (-540.996) -- 0:00:13
776000 -- (-538.265) (-540.335) [-545.529] (-541.225) * (-541.011) (-542.669) (-538.623) [-538.270] -- 0:00:13
776500 -- [-541.213] (-539.812) (-545.915) (-541.256) * [-538.550] (-538.748) (-538.879) (-540.263) -- 0:00:13
777000 -- (-538.746) (-537.962) (-540.789) [-539.931] * (-542.371) [-539.383] (-553.434) (-539.709) -- 0:00:13
777500 -- (-538.767) (-539.900) [-538.103] (-542.005) * (-539.067) (-541.245) (-544.288) [-539.205] -- 0:00:13
778000 -- (-540.254) (-538.675) [-539.058] (-540.775) * [-538.363] (-539.745) (-542.983) (-537.769) -- 0:00:13
778500 -- (-540.374) (-539.689) [-538.471] (-539.450) * (-538.329) (-539.967) (-538.449) [-538.772] -- 0:00:13
779000 -- (-538.157) [-539.533] (-538.629) (-540.155) * (-538.989) [-539.189] (-539.426) (-539.789) -- 0:00:13
779500 -- (-539.405) (-543.115) (-542.513) [-538.973] * (-538.857) (-540.961) (-539.504) [-542.053] -- 0:00:13
780000 -- (-539.057) (-539.374) (-545.506) [-540.709] * (-544.130) [-540.582] (-539.408) (-543.343) -- 0:00:12
Average standard deviation of split frequencies: 0.007850
780500 -- (-540.692) [-539.821] (-540.047) (-543.237) * (-541.046) [-541.800] (-541.246) (-538.870) -- 0:00:12
781000 -- (-539.777) (-539.778) (-539.924) [-540.981] * [-539.664] (-538.852) (-541.032) (-542.132) -- 0:00:12
781500 -- (-540.794) [-542.239] (-540.559) (-540.359) * (-540.441) [-541.688] (-538.486) (-541.806) -- 0:00:12
782000 -- (-539.965) (-540.527) (-538.228) [-539.769] * (-540.870) [-541.618] (-539.003) (-538.882) -- 0:00:12
782500 -- (-540.283) (-540.583) (-540.379) [-542.443] * [-540.260] (-543.532) (-538.087) (-539.500) -- 0:00:12
783000 -- (-540.883) [-538.216] (-540.592) (-542.268) * (-538.057) (-539.524) (-538.142) [-539.887] -- 0:00:12
783500 -- (-540.051) (-539.389) [-538.368] (-539.734) * (-541.978) (-539.472) (-539.434) [-539.508] -- 0:00:12
784000 -- (-538.655) (-538.462) [-540.880] (-540.776) * (-538.344) [-539.540] (-539.070) (-540.701) -- 0:00:12
784500 -- (-547.751) [-538.940] (-538.125) (-539.472) * (-541.958) (-540.442) (-539.618) [-539.434] -- 0:00:12
785000 -- (-541.650) (-542.095) [-543.567] (-540.339) * [-539.254] (-541.123) (-540.720) (-538.428) -- 0:00:12
Average standard deviation of split frequencies: 0.008172
785500 -- (-539.329) [-538.414] (-547.221) (-540.000) * (-540.318) (-539.892) [-540.381] (-539.637) -- 0:00:12
786000 -- (-539.931) (-539.605) (-541.033) [-540.433] * (-540.990) [-539.810] (-539.992) (-539.012) -- 0:00:12
786500 -- (-540.910) [-538.865] (-539.193) (-538.360) * [-541.776] (-538.659) (-540.825) (-538.370) -- 0:00:12
787000 -- (-540.566) [-538.871] (-539.222) (-540.250) * (-539.242) [-539.597] (-548.548) (-538.622) -- 0:00:12
787500 -- (-538.773) [-539.863] (-540.315) (-538.291) * [-540.162] (-543.078) (-543.907) (-539.482) -- 0:00:12
788000 -- (-538.229) (-542.405) (-546.020) [-538.845] * (-539.393) (-541.535) (-543.192) [-539.054] -- 0:00:12
788500 -- (-542.403) (-539.075) [-539.361] (-538.903) * (-542.560) (-539.627) (-540.713) [-539.708] -- 0:00:12
789000 -- (-540.172) (-538.699) (-540.173) [-538.421] * (-541.805) (-540.048) [-539.409] (-541.053) -- 0:00:12
789500 -- [-540.510] (-539.079) (-542.228) (-539.084) * [-540.182] (-540.657) (-543.314) (-544.062) -- 0:00:12
790000 -- (-540.721) (-539.239) [-539.562] (-538.523) * (-545.267) (-540.024) [-543.456] (-538.499) -- 0:00:12
Average standard deviation of split frequencies: 0.008347
790500 -- (-539.331) [-539.992] (-542.237) (-544.519) * [-539.913] (-540.535) (-539.740) (-540.992) -- 0:00:12
791000 -- (-544.110) (-540.717) (-547.328) [-542.412] * (-544.864) [-538.338] (-537.985) (-539.436) -- 0:00:12
791500 -- [-539.302] (-539.633) (-539.461) (-544.917) * [-538.777] (-538.153) (-542.086) (-538.927) -- 0:00:12
792000 -- [-538.705] (-544.479) (-542.157) (-541.071) * (-539.950) [-541.910] (-540.637) (-539.248) -- 0:00:12
792500 -- (-539.699) (-546.010) (-538.835) [-540.556] * (-540.230) (-538.817) [-539.051] (-540.874) -- 0:00:12
793000 -- [-541.712] (-539.719) (-538.389) (-542.759) * [-541.708] (-545.642) (-542.921) (-541.748) -- 0:00:12
793500 -- (-540.928) (-546.449) (-539.758) [-540.740] * (-541.898) (-541.363) [-538.787] (-540.547) -- 0:00:12
794000 -- (-541.119) (-540.276) [-541.644] (-538.533) * (-539.504) (-539.108) [-539.060] (-544.610) -- 0:00:12
794500 -- (-541.070) [-540.838] (-540.139) (-542.502) * (-540.506) (-540.407) [-540.269] (-540.699) -- 0:00:12
795000 -- (-539.008) (-541.107) (-541.273) [-539.903] * (-539.350) [-540.455] (-540.050) (-540.515) -- 0:00:12
Average standard deviation of split frequencies: 0.008765
795500 -- (-542.296) (-539.415) [-544.200] (-546.962) * [-539.436] (-539.691) (-540.884) (-540.863) -- 0:00:12
796000 -- (-542.984) (-540.671) [-538.819] (-546.468) * (-546.303) (-539.454) (-542.903) [-539.900] -- 0:00:12
796500 -- (-540.282) (-540.173) (-539.181) [-542.147] * (-545.244) [-540.228] (-539.092) (-539.766) -- 0:00:12
797000 -- [-539.276] (-545.230) (-544.166) (-540.457) * (-540.251) (-540.290) (-539.471) [-539.863] -- 0:00:11
797500 -- [-538.517] (-540.019) (-544.553) (-539.497) * [-538.229] (-538.315) (-539.367) (-542.001) -- 0:00:11
798000 -- (-539.823) (-538.382) (-546.265) [-539.804] * (-538.948) (-539.354) (-539.216) [-541.290] -- 0:00:11
798500 -- [-541.930] (-540.204) (-542.775) (-541.976) * (-542.319) [-541.123] (-541.249) (-539.647) -- 0:00:11
799000 -- (-538.825) (-539.649) [-540.537] (-542.259) * (-539.567) (-538.839) [-539.172] (-541.161) -- 0:00:11
799500 -- (-542.428) [-539.153] (-539.537) (-546.218) * (-538.834) (-544.567) [-538.255] (-542.454) -- 0:00:11
800000 -- (-540.414) [-539.798] (-539.344) (-539.523) * (-540.333) (-539.027) [-541.705] (-538.886) -- 0:00:11
Average standard deviation of split frequencies: 0.009263
800500 -- (-542.090) [-540.855] (-538.888) (-539.076) * (-539.992) (-544.182) [-539.942] (-540.399) -- 0:00:11
801000 -- (-540.352) [-539.159] (-538.888) (-538.612) * (-539.359) (-540.552) (-538.689) [-538.514] -- 0:00:11
801500 -- [-540.425] (-538.620) (-542.152) (-546.465) * [-541.810] (-540.841) (-540.323) (-538.875) -- 0:00:11
802000 -- (-538.515) [-538.579] (-538.596) (-539.782) * (-540.660) [-538.827] (-541.482) (-538.552) -- 0:00:11
802500 -- [-538.094] (-540.017) (-538.469) (-541.707) * (-538.238) (-540.316) [-541.123] (-541.965) -- 0:00:11
803000 -- (-539.489) [-541.000] (-541.334) (-538.602) * (-538.922) [-545.749] (-546.930) (-541.124) -- 0:00:11
803500 -- (-540.127) [-539.070] (-543.014) (-540.096) * [-539.052] (-539.733) (-542.586) (-541.379) -- 0:00:11
804000 -- (-539.632) (-540.318) [-539.704] (-540.286) * (-542.309) [-538.875] (-542.579) (-539.011) -- 0:00:11
804500 -- (-543.468) (-541.581) (-539.296) [-538.868] * [-540.112] (-540.824) (-539.842) (-541.453) -- 0:00:11
805000 -- (-543.297) (-543.933) [-538.632] (-538.409) * (-542.332) (-540.234) [-539.096] (-538.741) -- 0:00:11
Average standard deviation of split frequencies: 0.009085
805500 -- (-543.461) (-541.148) [-539.089] (-538.821) * (-538.346) (-549.510) (-539.056) [-538.502] -- 0:00:11
806000 -- (-543.083) [-539.513] (-538.242) (-539.138) * (-538.308) (-540.630) (-540.031) [-540.840] -- 0:00:11
806500 -- (-541.179) [-539.741] (-538.655) (-539.310) * (-540.063) [-540.925] (-542.434) (-539.476) -- 0:00:11
807000 -- [-541.325] (-541.976) (-538.431) (-539.781) * (-545.578) [-538.995] (-539.592) (-539.342) -- 0:00:11
807500 -- [-538.879] (-541.536) (-544.002) (-539.867) * (-538.880) (-541.127) [-539.276] (-540.263) -- 0:00:11
808000 -- (-541.500) [-542.391] (-544.041) (-539.299) * (-543.340) (-541.318) (-542.050) [-540.654] -- 0:00:11
808500 -- (-541.561) (-540.275) [-540.462] (-541.752) * [-544.755] (-540.128) (-538.670) (-539.823) -- 0:00:11
809000 -- (-542.116) (-538.711) [-539.542] (-541.008) * (-538.031) [-540.357] (-542.414) (-538.573) -- 0:00:11
809500 -- (-541.703) (-538.751) [-541.194] (-538.514) * (-538.205) (-543.883) (-543.964) [-542.030] -- 0:00:11
810000 -- (-538.853) (-540.508) [-540.729] (-538.690) * (-538.922) [-540.544] (-544.227) (-539.527) -- 0:00:11
Average standard deviation of split frequencies: 0.009227
810500 -- (-543.879) [-540.557] (-538.582) (-539.061) * (-538.780) (-538.330) [-540.141] (-540.002) -- 0:00:11
811000 -- (-540.217) (-539.181) [-538.663] (-540.454) * (-542.437) [-539.573] (-542.174) (-539.076) -- 0:00:11
811500 -- [-541.784] (-538.479) (-538.709) (-540.810) * (-542.880) (-539.030) (-540.864) [-538.805] -- 0:00:11
812000 -- (-539.443) (-539.166) (-538.353) [-540.863] * [-539.986] (-542.978) (-539.624) (-538.527) -- 0:00:11
812500 -- (-540.594) [-539.757] (-539.269) (-543.184) * [-538.255] (-540.484) (-539.166) (-539.523) -- 0:00:11
813000 -- (-539.276) (-540.826) (-540.496) [-542.882] * (-543.404) (-539.580) [-541.603] (-542.101) -- 0:00:11
813500 -- [-539.243] (-544.879) (-539.219) (-540.643) * (-539.416) (-540.907) (-543.194) [-540.441] -- 0:00:11
814000 -- (-539.386) (-538.694) [-541.548] (-545.433) * (-542.515) (-538.444) [-538.852] (-541.022) -- 0:00:10
814500 -- (-538.898) (-539.219) (-540.701) [-540.591] * [-538.970] (-539.102) (-539.221) (-541.793) -- 0:00:10
815000 -- [-538.245] (-539.618) (-540.701) (-540.778) * (-539.068) (-538.784) [-538.920] (-541.008) -- 0:00:10
Average standard deviation of split frequencies: 0.009051
815500 -- [-538.102] (-539.257) (-539.302) (-540.130) * (-542.145) (-540.563) [-540.603] (-541.251) -- 0:00:10
816000 -- (-537.864) (-541.550) [-537.927] (-540.975) * (-542.713) (-539.280) [-539.284] (-543.020) -- 0:00:10
816500 -- [-538.465] (-542.057) (-538.878) (-540.793) * (-542.016) [-539.588] (-538.729) (-542.321) -- 0:00:10
817000 -- (-539.061) [-542.069] (-538.372) (-540.542) * [-541.992] (-540.318) (-543.230) (-539.261) -- 0:00:10
817500 -- [-542.245] (-539.877) (-539.849) (-543.591) * (-542.693) (-542.343) (-537.978) [-542.120] -- 0:00:10
818000 -- [-539.098] (-539.398) (-545.618) (-539.244) * (-538.178) (-544.185) (-540.931) [-538.576] -- 0:00:10
818500 -- (-538.356) (-541.510) (-539.094) [-540.949] * (-538.125) (-540.606) (-543.447) [-541.549] -- 0:00:10
819000 -- (-538.990) (-538.311) (-540.834) [-541.094] * (-538.522) (-538.764) [-538.601] (-542.206) -- 0:00:10
819500 -- (-539.573) [-541.158] (-540.069) (-539.055) * (-538.512) [-540.446] (-541.818) (-542.163) -- 0:00:10
820000 -- (-541.703) [-541.293] (-538.409) (-544.958) * (-541.596) (-540.160) (-542.585) [-540.875] -- 0:00:10
Average standard deviation of split frequencies: 0.008999
820500 -- (-538.516) [-538.537] (-539.097) (-543.932) * (-539.468) (-539.267) [-543.172] (-542.292) -- 0:00:10
821000 -- (-539.047) (-538.355) [-541.139] (-538.990) * (-542.398) (-539.618) [-539.804] (-540.592) -- 0:00:10
821500 -- (-539.529) [-541.274] (-538.053) (-539.865) * (-542.683) (-540.741) [-540.023] (-540.254) -- 0:00:10
822000 -- [-539.140] (-538.661) (-538.075) (-538.800) * [-541.328] (-542.326) (-539.361) (-543.556) -- 0:00:10
822500 -- (-540.736) (-538.933) (-537.892) [-544.168] * (-538.408) [-538.485] (-543.952) (-546.224) -- 0:00:10
823000 -- (-539.146) [-538.184] (-539.243) (-539.136) * (-542.978) [-538.280] (-540.174) (-544.669) -- 0:00:10
823500 -- (-541.381) (-539.275) [-539.012] (-539.071) * (-540.043) [-539.430] (-540.772) (-539.345) -- 0:00:10
824000 -- (-540.951) (-539.705) (-538.112) [-542.673] * (-540.222) [-539.122] (-541.286) (-543.824) -- 0:00:10
824500 -- [-539.120] (-538.385) (-541.713) (-540.559) * (-542.567) [-538.885] (-542.460) (-539.772) -- 0:00:10
825000 -- (-538.526) (-538.379) [-538.062] (-538.432) * (-541.590) (-540.288) (-541.332) [-538.446] -- 0:00:10
Average standard deviation of split frequencies: 0.009626
825500 -- [-538.492] (-538.875) (-543.847) (-539.548) * [-539.374] (-540.418) (-540.644) (-542.829) -- 0:00:10
826000 -- (-542.348) (-538.836) (-541.767) [-539.820] * (-538.699) (-540.986) [-543.338] (-541.021) -- 0:00:10
826500 -- (-539.508) (-540.729) (-544.553) [-539.336] * (-538.513) (-539.498) (-540.901) [-538.758] -- 0:00:10
827000 -- (-543.177) (-538.403) (-544.536) [-539.591] * (-539.452) [-538.943] (-541.643) (-539.337) -- 0:00:10
827500 -- (-539.075) (-539.217) [-540.554] (-541.200) * (-540.332) (-550.904) (-539.852) [-538.191] -- 0:00:10
828000 -- (-538.865) (-539.268) (-542.523) [-541.110] * (-541.521) (-542.859) [-538.003] (-538.131) -- 0:00:10
828500 -- [-540.654] (-543.182) (-540.152) (-540.887) * (-539.935) [-540.099] (-539.031) (-539.766) -- 0:00:10
829000 -- (-539.665) (-539.306) [-541.237] (-540.758) * (-539.053) (-544.061) [-538.138] (-539.378) -- 0:00:10
829500 -- (-539.150) (-539.093) (-541.164) [-537.973] * (-538.314) [-541.948] (-541.005) (-542.790) -- 0:00:10
830000 -- (-538.329) (-544.225) [-541.953] (-538.499) * (-538.284) (-539.471) (-540.565) [-539.981] -- 0:00:10
Average standard deviation of split frequencies: 0.010253
830500 -- (-541.105) (-539.792) [-537.873] (-542.974) * (-542.987) (-543.252) (-541.877) [-539.454] -- 0:00:10
831000 -- (-539.204) (-539.167) (-540.316) [-538.948] * (-544.495) (-541.944) (-538.677) [-539.724] -- 0:00:09
831500 -- (-541.426) (-539.049) [-539.351] (-540.980) * [-541.734] (-540.096) (-539.327) (-540.289) -- 0:00:09
832000 -- (-540.606) (-538.403) [-539.669] (-540.052) * (-539.217) [-540.187] (-539.544) (-540.378) -- 0:00:09
832500 -- [-540.319] (-542.119) (-541.775) (-543.947) * (-539.718) [-542.378] (-539.563) (-539.621) -- 0:00:09
833000 -- (-545.483) [-540.792] (-543.506) (-539.457) * (-540.255) (-541.985) [-540.988] (-541.929) -- 0:00:09
833500 -- (-543.153) (-539.266) [-543.348] (-539.584) * (-541.158) (-543.430) (-542.214) [-541.539] -- 0:00:09
834000 -- (-539.930) [-539.339] (-540.994) (-539.601) * [-543.846] (-539.727) (-539.914) (-539.122) -- 0:00:09
834500 -- (-540.389) [-538.739] (-540.206) (-542.412) * (-543.756) (-543.771) (-544.006) [-549.062] -- 0:00:09
835000 -- (-541.938) (-541.281) (-541.327) [-541.134] * (-540.874) (-540.493) (-540.511) [-539.910] -- 0:00:09
Average standard deviation of split frequencies: 0.010338
835500 -- (-542.152) [-538.736] (-540.594) (-541.975) * (-539.101) [-540.101] (-538.615) (-542.005) -- 0:00:09
836000 -- (-540.721) (-538.112) (-541.662) [-540.708] * (-538.739) (-539.755) (-543.642) [-539.371] -- 0:00:09
836500 -- (-541.504) (-540.004) [-540.378] (-545.074) * (-539.698) (-538.616) (-538.244) [-538.338] -- 0:00:09
837000 -- (-538.586) (-542.854) [-538.756] (-539.470) * (-538.076) (-542.887) [-538.504] (-539.496) -- 0:00:09
837500 -- (-538.540) (-544.780) [-539.242] (-541.633) * (-541.525) (-539.673) [-542.034] (-539.339) -- 0:00:09
838000 -- (-540.260) (-545.050) (-538.321) [-544.744] * (-542.799) (-541.571) (-541.398) [-539.531] -- 0:00:09
838500 -- (-544.161) (-539.508) [-539.284] (-540.229) * (-542.146) [-538.892] (-540.366) (-541.241) -- 0:00:09
839000 -- [-540.334] (-539.934) (-539.509) (-538.898) * (-538.675) [-538.320] (-539.789) (-540.302) -- 0:00:09
839500 -- (-542.194) (-538.714) (-542.963) [-539.194] * (-538.503) (-547.764) [-539.779] (-541.662) -- 0:00:09
840000 -- (-539.574) (-538.794) (-539.793) [-538.460] * [-539.450] (-540.523) (-540.716) (-542.243) -- 0:00:09
Average standard deviation of split frequencies: 0.010131
840500 -- [-537.907] (-538.011) (-540.348) (-538.464) * (-540.410) (-543.187) [-542.911] (-542.374) -- 0:00:09
841000 -- (-540.441) (-541.320) (-538.472) [-539.492] * (-538.206) [-540.192] (-541.231) (-539.892) -- 0:00:09
841500 -- (-537.814) [-540.218] (-541.077) (-540.260) * (-543.676) (-538.588) [-540.007] (-540.920) -- 0:00:09
842000 -- (-543.064) [-539.462] (-541.019) (-542.053) * (-540.449) (-538.439) (-538.630) [-539.126] -- 0:00:09
842500 -- [-539.745] (-539.495) (-541.576) (-539.279) * (-539.314) (-540.920) (-540.161) [-541.300] -- 0:00:09
843000 -- (-539.738) (-541.572) [-538.581] (-538.672) * [-540.974] (-541.254) (-544.010) (-541.009) -- 0:00:09
843500 -- [-540.288] (-539.275) (-539.936) (-540.290) * (-539.206) (-543.401) (-542.811) [-538.302] -- 0:00:09
844000 -- (-542.666) (-539.504) (-542.366) [-540.933] * (-540.104) (-542.115) (-542.047) [-538.096] -- 0:00:09
844500 -- (-543.155) (-540.014) [-539.997] (-539.126) * [-540.121] (-541.152) (-540.136) (-540.602) -- 0:00:09
845000 -- (-545.358) [-537.942] (-540.254) (-539.655) * [-538.384] (-538.031) (-540.655) (-545.559) -- 0:00:09
Average standard deviation of split frequencies: 0.010141
845500 -- (-540.179) (-539.752) (-540.596) [-538.258] * (-539.012) (-539.347) [-537.822] (-548.090) -- 0:00:09
846000 -- (-540.350) (-539.940) (-538.939) [-538.831] * (-539.431) (-542.776) [-541.302] (-540.381) -- 0:00:09
846500 -- [-539.940] (-538.768) (-539.264) (-539.433) * [-544.824] (-540.234) (-539.160) (-542.423) -- 0:00:09
847000 -- (-537.966) (-542.704) (-544.005) [-539.669] * (-542.548) (-538.629) [-542.389] (-539.962) -- 0:00:09
847500 -- (-538.415) (-541.545) [-540.781] (-541.834) * (-546.747) (-540.907) [-540.168] (-539.872) -- 0:00:08
848000 -- (-538.976) (-541.977) [-538.830] (-540.874) * (-541.243) (-540.964) (-541.002) [-538.109] -- 0:00:08
848500 -- (-540.863) (-542.738) (-540.121) [-541.267] * [-540.291] (-537.890) (-540.025) (-538.291) -- 0:00:08
849000 -- (-540.976) (-540.713) (-540.844) [-538.572] * (-539.991) (-539.097) (-539.047) [-539.184] -- 0:00:08
849500 -- (-541.527) (-540.641) (-542.924) [-540.387] * [-539.536] (-542.977) (-540.748) (-542.256) -- 0:00:08
850000 -- [-540.010] (-542.400) (-543.729) (-541.316) * [-540.675] (-539.026) (-541.469) (-541.777) -- 0:00:08
Average standard deviation of split frequencies: 0.010123
850500 -- (-537.834) (-539.094) [-540.157] (-540.988) * (-543.891) (-539.194) [-538.544] (-541.382) -- 0:00:08
851000 -- (-539.857) [-538.578] (-538.868) (-539.035) * (-542.113) (-540.824) (-539.983) [-538.378] -- 0:00:08
851500 -- [-541.531] (-540.530) (-540.566) (-542.827) * [-539.327] (-541.427) (-539.655) (-538.382) -- 0:00:08
852000 -- (-540.302) [-538.191] (-542.934) (-544.633) * (-540.053) (-539.112) (-543.329) [-540.400] -- 0:00:08
852500 -- (-540.867) (-537.940) (-540.404) [-538.969] * (-541.638) [-543.030] (-548.674) (-539.981) -- 0:00:08
853000 -- (-540.915) (-538.672) [-541.461] (-539.059) * (-539.284) (-541.447) (-553.081) [-541.149] -- 0:00:08
853500 -- (-541.610) (-539.242) (-541.060) [-539.615] * (-541.471) (-539.636) (-540.305) [-538.044] -- 0:00:08
854000 -- (-538.441) [-538.706] (-539.644) (-541.377) * (-543.097) [-542.150] (-540.108) (-540.144) -- 0:00:08
854500 -- [-538.899] (-539.056) (-539.330) (-541.786) * [-541.045] (-541.313) (-538.884) (-539.221) -- 0:00:08
855000 -- (-539.027) (-540.911) [-539.962] (-539.455) * (-540.684) (-539.531) (-538.351) [-540.090] -- 0:00:08
Average standard deviation of split frequencies: 0.010096
855500 -- (-539.043) (-544.175) (-539.297) [-539.216] * [-540.560] (-543.122) (-537.973) (-539.375) -- 0:00:08
856000 -- (-539.157) (-540.366) (-541.149) [-540.618] * (-539.344) (-541.448) (-541.404) [-539.408] -- 0:00:08
856500 -- (-541.410) [-538.111] (-541.028) (-545.218) * [-542.539] (-543.036) (-542.462) (-538.170) -- 0:00:08
857000 -- (-539.185) (-540.618) (-546.056) [-542.178] * [-544.226] (-540.649) (-539.976) (-540.371) -- 0:00:08
857500 -- [-538.409] (-543.131) (-541.180) (-539.830) * [-542.374] (-539.531) (-539.096) (-539.750) -- 0:00:08
858000 -- (-545.209) (-541.736) [-545.871] (-538.669) * [-541.681] (-539.035) (-539.997) (-541.370) -- 0:00:08
858500 -- (-541.282) (-544.039) (-539.493) [-539.907] * (-541.463) [-539.680] (-539.849) (-541.282) -- 0:00:08
859000 -- (-540.448) (-543.266) (-538.984) [-539.751] * (-540.141) (-543.488) (-539.125) [-540.144] -- 0:00:08
859500 -- [-540.201] (-539.454) (-538.835) (-539.712) * [-539.222] (-545.091) (-539.104) (-539.132) -- 0:00:08
860000 -- (-542.264) (-539.023) [-541.948] (-539.683) * [-538.535] (-546.054) (-539.101) (-539.479) -- 0:00:08
Average standard deviation of split frequencies: 0.010646
860500 -- [-541.586] (-541.474) (-541.772) (-538.718) * (-542.390) (-542.736) [-538.493] (-538.357) -- 0:00:08
861000 -- [-539.883] (-539.847) (-541.398) (-541.750) * (-540.714) (-542.366) (-538.490) [-538.708] -- 0:00:08
861500 -- [-538.386] (-539.850) (-544.845) (-541.307) * (-538.764) (-540.719) (-539.595) [-541.584] -- 0:00:08
862000 -- [-538.951] (-540.267) (-539.441) (-542.176) * (-538.848) [-542.003] (-538.829) (-538.569) -- 0:00:08
862500 -- (-542.324) (-539.268) (-539.785) [-546.297] * (-539.386) (-539.754) [-539.489] (-539.404) -- 0:00:08
863000 -- (-541.556) (-541.695) (-541.141) [-541.033] * (-544.517) (-542.143) (-538.775) [-540.276] -- 0:00:08
863500 -- (-543.454) (-539.424) [-543.042] (-538.769) * (-539.655) (-541.347) [-539.280] (-540.924) -- 0:00:08
864000 -- [-539.765] (-538.881) (-540.545) (-538.799) * (-539.365) (-540.565) (-539.882) [-540.705] -- 0:00:08
864500 -- (-539.210) (-539.189) (-542.063) [-540.341] * (-541.100) [-540.235] (-541.535) (-541.428) -- 0:00:07
865000 -- (-539.850) (-538.851) [-541.422] (-539.869) * [-544.748] (-542.414) (-542.958) (-541.255) -- 0:00:07
Average standard deviation of split frequencies: 0.010172
865500 -- [-539.762] (-541.483) (-540.010) (-538.325) * (-540.153) (-540.889) (-540.867) [-540.500] -- 0:00:07
866000 -- [-538.472] (-542.565) (-543.009) (-538.821) * [-539.350] (-542.303) (-539.210) (-539.789) -- 0:00:07
866500 -- (-538.937) (-542.923) [-539.780] (-540.083) * (-540.211) (-540.643) [-538.784] (-538.743) -- 0:00:07
867000 -- [-539.617] (-544.208) (-539.839) (-539.334) * (-539.864) [-538.863] (-541.130) (-538.427) -- 0:00:07
867500 -- (-539.408) (-542.255) [-539.123] (-540.108) * [-542.969] (-538.200) (-541.742) (-539.166) -- 0:00:07
868000 -- (-544.290) (-541.379) (-539.015) [-542.521] * [-541.503] (-538.429) (-540.803) (-541.873) -- 0:00:07
868500 -- (-541.967) (-539.318) (-539.212) [-542.563] * [-541.662] (-539.982) (-544.025) (-540.704) -- 0:00:07
869000 -- (-542.837) (-541.054) (-540.663) [-540.106] * (-539.239) (-541.912) [-539.275] (-538.655) -- 0:00:07
869500 -- [-540.428] (-540.217) (-540.729) (-541.848) * [-539.170] (-541.613) (-541.531) (-541.399) -- 0:00:07
870000 -- (-542.543) (-539.338) [-540.631] (-542.153) * (-540.546) (-540.628) (-545.621) [-540.348] -- 0:00:07
Average standard deviation of split frequencies: 0.010016
870500 -- (-539.384) (-540.959) [-540.394] (-539.275) * [-539.248] (-540.275) (-542.459) (-540.823) -- 0:00:07
871000 -- (-538.466) (-540.923) (-539.450) [-539.848] * (-540.687) (-539.317) (-541.281) [-540.390] -- 0:00:07
871500 -- (-538.360) (-542.917) (-540.353) [-538.662] * [-538.798] (-540.008) (-544.396) (-538.875) -- 0:00:07
872000 -- (-540.051) (-539.967) [-538.026] (-539.605) * (-540.522) (-540.007) [-545.872] (-540.732) -- 0:00:07
872500 -- (-540.584) (-538.586) [-539.045] (-543.517) * (-539.900) (-538.199) [-539.566] (-540.528) -- 0:00:07
873000 -- (-540.282) (-537.836) (-541.291) [-544.143] * (-538.773) (-538.157) (-539.190) [-539.349] -- 0:00:07
873500 -- [-541.559] (-538.377) (-543.320) (-541.888) * (-540.777) (-538.452) (-539.474) [-540.455] -- 0:00:07
874000 -- (-543.576) (-541.416) [-540.228] (-544.583) * [-539.598] (-545.720) (-540.607) (-537.884) -- 0:00:07
874500 -- (-543.699) (-538.209) [-541.966] (-542.635) * [-539.388] (-538.602) (-541.510) (-538.265) -- 0:00:07
875000 -- (-545.552) [-538.581] (-541.669) (-540.089) * (-539.843) (-539.407) [-539.438] (-539.981) -- 0:00:07
Average standard deviation of split frequencies: 0.009821
875500 -- [-542.572] (-539.621) (-540.903) (-538.780) * (-540.579) (-541.170) [-540.396] (-539.234) -- 0:00:07
876000 -- [-539.439] (-539.888) (-539.067) (-540.011) * (-540.334) (-539.555) [-539.601] (-542.189) -- 0:00:07
876500 -- (-543.741) (-541.899) [-540.599] (-542.221) * (-541.100) [-539.247] (-547.836) (-539.383) -- 0:00:07
877000 -- (-540.870) [-541.822] (-538.791) (-539.329) * [-538.952] (-539.529) (-546.539) (-539.299) -- 0:00:07
877500 -- (-546.319) (-539.811) (-540.781) [-538.554] * (-538.156) (-538.200) (-542.427) [-538.247] -- 0:00:07
878000 -- (-542.862) [-540.078] (-539.685) (-541.191) * (-539.978) (-541.538) (-541.397) [-540.363] -- 0:00:07
878500 -- [-541.118] (-539.427) (-541.104) (-540.001) * (-540.568) (-540.795) (-540.770) [-540.418] -- 0:00:07
879000 -- (-538.690) (-541.664) (-539.566) [-539.278] * (-541.665) (-540.828) (-544.049) [-538.615] -- 0:00:07
879500 -- (-539.087) (-542.474) [-539.779] (-542.105) * (-541.953) (-538.795) [-540.208] (-538.311) -- 0:00:07
880000 -- (-539.564) (-539.442) [-539.302] (-539.696) * (-543.355) [-542.610] (-544.781) (-538.517) -- 0:00:07
Average standard deviation of split frequencies: 0.009778
880500 -- (-538.892) (-540.449) [-541.497] (-541.784) * (-542.165) (-539.851) [-542.947] (-539.506) -- 0:00:07
881000 -- [-541.301] (-543.042) (-538.182) (-542.767) * (-541.633) (-539.529) [-539.322] (-541.013) -- 0:00:07
881500 -- (-540.939) (-539.571) [-539.235] (-538.955) * [-541.407] (-544.574) (-537.930) (-537.841) -- 0:00:06
882000 -- (-540.822) (-541.238) (-539.285) [-541.427] * (-542.187) (-541.539) [-538.789] (-539.065) -- 0:00:06
882500 -- (-539.105) (-538.539) [-542.298] (-540.689) * (-542.121) (-539.416) (-539.439) [-541.277] -- 0:00:06
883000 -- (-538.281) (-538.658) [-540.986] (-540.969) * (-548.013) (-539.410) [-542.704] (-541.886) -- 0:00:06
883500 -- (-539.188) (-537.983) (-542.863) [-542.421] * (-539.467) (-545.572) [-542.956] (-539.558) -- 0:00:06
884000 -- (-539.674) (-539.531) [-540.565] (-544.585) * (-538.695) (-539.372) (-549.464) [-540.392] -- 0:00:06
884500 -- (-538.770) [-538.653] (-541.213) (-543.976) * [-538.719] (-538.620) (-542.547) (-543.511) -- 0:00:06
885000 -- [-539.466] (-538.837) (-540.375) (-544.898) * [-539.161] (-540.441) (-544.711) (-542.583) -- 0:00:06
Average standard deviation of split frequencies: 0.009810
885500 -- (-547.497) [-539.303] (-540.363) (-539.509) * (-542.355) [-539.707] (-544.155) (-540.105) -- 0:00:06
886000 -- [-540.994] (-540.426) (-541.627) (-540.230) * (-546.598) (-541.617) (-543.432) [-538.654] -- 0:00:06
886500 -- [-541.140] (-538.682) (-542.821) (-540.187) * (-546.133) [-542.137] (-540.886) (-542.291) -- 0:00:06
887000 -- (-539.129) (-539.768) (-544.397) [-543.386] * [-541.005] (-540.402) (-539.978) (-544.002) -- 0:00:06
887500 -- (-538.476) [-539.587] (-538.046) (-538.898) * [-540.941] (-543.303) (-541.377) (-539.381) -- 0:00:06
888000 -- [-538.694] (-545.612) (-538.150) (-538.210) * [-538.987] (-541.625) (-538.459) (-538.611) -- 0:00:06
888500 -- (-539.834) (-541.103) [-538.744] (-540.414) * (-541.068) (-542.174) (-540.037) [-538.876] -- 0:00:06
889000 -- (-548.505) (-540.881) [-541.753] (-538.463) * (-541.642) (-538.257) [-540.538] (-538.503) -- 0:00:06
889500 -- (-539.420) [-541.488] (-545.816) (-541.048) * (-542.186) (-538.764) [-537.729] (-539.059) -- 0:00:06
890000 -- [-539.550] (-541.324) (-545.206) (-538.601) * (-538.947) (-541.047) [-539.700] (-544.019) -- 0:00:06
Average standard deviation of split frequencies: 0.009725
890500 -- (-540.367) (-538.762) (-546.654) [-538.833] * (-537.926) (-543.574) [-540.135] (-544.356) -- 0:00:06
891000 -- (-539.575) [-538.575] (-541.592) (-538.612) * [-540.897] (-540.692) (-541.930) (-545.425) -- 0:00:06
891500 -- (-542.308) (-540.864) (-541.928) [-538.663] * (-540.773) (-542.854) (-538.440) [-540.697] -- 0:00:06
892000 -- (-541.262) (-540.713) (-543.206) [-540.349] * [-538.486] (-539.040) (-539.402) (-540.042) -- 0:00:06
892500 -- [-544.795] (-539.239) (-540.142) (-544.045) * (-541.195) (-540.823) [-541.702] (-541.839) -- 0:00:06
893000 -- [-541.502] (-539.967) (-542.276) (-539.375) * (-543.221) [-541.005] (-542.330) (-540.721) -- 0:00:06
893500 -- [-540.657] (-539.298) (-542.656) (-540.412) * [-540.026] (-538.571) (-541.564) (-539.531) -- 0:00:06
894000 -- (-544.181) (-539.851) [-541.821] (-545.131) * (-539.508) [-538.647] (-541.348) (-540.571) -- 0:00:06
894500 -- (-539.310) [-539.520] (-542.206) (-541.306) * (-540.173) (-539.768) (-541.435) [-538.363] -- 0:00:06
895000 -- [-543.051] (-542.770) (-539.956) (-541.937) * (-540.035) (-540.543) (-540.159) [-539.298] -- 0:00:06
Average standard deviation of split frequencies: 0.010029
895500 -- [-539.797] (-544.763) (-538.579) (-540.142) * [-539.352] (-541.167) (-540.124) (-540.089) -- 0:00:06
896000 -- (-539.399) (-540.605) (-539.673) [-538.980] * (-538.136) (-539.987) (-538.861) [-539.083] -- 0:00:06
896500 -- (-540.020) (-541.939) (-538.785) [-539.702] * [-541.683] (-539.658) (-540.628) (-540.042) -- 0:00:06
897000 -- (-539.905) (-541.099) [-540.078] (-539.030) * (-540.292) (-542.028) [-540.796] (-538.986) -- 0:00:06
897500 -- (-540.618) (-540.694) [-540.627] (-543.915) * (-542.113) (-542.419) [-539.553] (-539.644) -- 0:00:06
898000 -- [-541.586] (-542.597) (-538.771) (-543.378) * (-538.795) [-538.925] (-538.043) (-539.861) -- 0:00:06
898500 -- [-540.028] (-539.862) (-539.368) (-542.111) * (-540.394) (-539.068) (-543.159) [-539.814] -- 0:00:05
899000 -- (-541.174) [-539.589] (-540.635) (-538.510) * (-542.623) (-539.224) [-542.257] (-541.120) -- 0:00:05
899500 -- (-539.609) (-539.320) [-539.347] (-539.393) * (-538.824) (-538.426) (-543.978) [-538.109] -- 0:00:05
900000 -- [-539.308] (-539.219) (-543.724) (-541.962) * (-540.840) (-543.766) [-541.656] (-539.432) -- 0:00:05
Average standard deviation of split frequencies: 0.009748
900500 -- [-540.481] (-540.218) (-543.334) (-543.289) * (-541.175) [-541.292] (-539.239) (-539.928) -- 0:00:05
901000 -- (-545.444) [-539.838] (-545.454) (-542.430) * [-540.149] (-542.528) (-539.613) (-540.238) -- 0:00:05
901500 -- (-542.266) [-538.706] (-541.784) (-542.072) * (-539.212) [-540.986] (-540.410) (-541.111) -- 0:00:05
902000 -- (-539.254) [-538.943] (-538.515) (-540.236) * (-539.986) (-539.965) (-539.588) [-539.100] -- 0:00:05
902500 -- (-539.199) (-540.658) [-539.113] (-540.240) * (-539.421) (-540.693) [-539.891] (-541.256) -- 0:00:05
903000 -- [-540.045] (-538.910) (-544.500) (-539.062) * (-542.347) [-538.171] (-541.521) (-540.491) -- 0:00:05
903500 -- (-539.592) [-538.745] (-543.313) (-540.730) * [-543.112] (-541.934) (-540.371) (-542.063) -- 0:00:05
904000 -- (-542.343) (-541.229) (-539.504) [-538.193] * [-542.901] (-543.025) (-541.820) (-540.197) -- 0:00:05
904500 -- (-539.631) (-538.977) (-540.842) [-539.786] * (-541.721) (-540.991) (-543.814) [-541.798] -- 0:00:05
905000 -- [-539.851] (-538.282) (-542.661) (-540.648) * (-540.364) [-539.884] (-542.451) (-538.476) -- 0:00:05
Average standard deviation of split frequencies: 0.009626
905500 -- (-540.148) (-539.324) (-540.652) [-540.106] * [-538.560] (-545.528) (-540.596) (-539.663) -- 0:00:05
906000 -- (-538.648) [-541.421] (-540.479) (-539.528) * (-541.508) [-539.516] (-539.364) (-540.222) -- 0:00:05
906500 -- (-539.299) (-542.070) (-539.141) [-540.129] * (-541.241) [-540.600] (-538.684) (-539.683) -- 0:00:05
907000 -- (-538.466) [-539.758] (-539.822) (-539.061) * (-539.233) [-544.301] (-539.762) (-539.675) -- 0:00:05
907500 -- (-538.855) (-541.090) [-539.547] (-538.824) * (-538.452) (-540.305) [-539.449] (-537.975) -- 0:00:05
908000 -- (-539.140) (-540.066) (-538.905) [-538.737] * (-538.196) [-538.892] (-538.618) (-537.980) -- 0:00:05
908500 -- (-542.157) [-542.299] (-541.869) (-542.552) * (-538.178) (-541.022) [-539.232] (-540.625) -- 0:00:05
909000 -- (-541.862) (-539.901) (-540.327) [-541.564] * [-539.783] (-539.206) (-539.508) (-541.230) -- 0:00:05
909500 -- (-542.160) (-539.714) (-540.928) [-538.808] * [-542.194] (-541.387) (-538.490) (-539.466) -- 0:00:05
910000 -- [-540.858] (-539.921) (-540.427) (-539.188) * (-539.278) (-544.377) [-538.627] (-539.884) -- 0:00:05
Average standard deviation of split frequencies: 0.009576
910500 -- (-540.494) (-539.248) (-540.392) [-539.392] * (-541.240) [-539.926] (-541.052) (-539.658) -- 0:00:05
911000 -- (-538.332) (-540.653) (-543.045) [-540.646] * (-539.208) [-537.970] (-541.657) (-540.967) -- 0:00:05
911500 -- (-540.184) (-538.434) [-540.847] (-540.827) * (-539.728) [-540.044] (-543.230) (-538.902) -- 0:00:05
912000 -- (-538.985) (-538.914) [-538.143] (-538.426) * (-539.210) [-538.294] (-545.777) (-540.676) -- 0:00:05
912500 -- (-541.198) (-540.373) (-539.206) [-539.419] * (-539.801) (-542.048) (-539.381) [-538.498] -- 0:00:05
913000 -- (-542.768) (-538.613) (-541.189) [-538.934] * (-540.428) [-539.261] (-538.421) (-541.708) -- 0:00:05
913500 -- (-540.467) (-539.193) (-538.766) [-539.547] * [-539.194] (-540.118) (-539.125) (-541.498) -- 0:00:05
914000 -- (-543.124) (-539.004) [-538.250] (-540.921) * (-542.295) [-539.470] (-539.184) (-541.054) -- 0:00:05
914500 -- (-539.691) [-538.955] (-540.977) (-541.344) * [-543.897] (-539.773) (-544.513) (-541.815) -- 0:00:05
915000 -- (-538.643) [-538.945] (-539.308) (-539.279) * [-539.627] (-539.306) (-539.470) (-541.075) -- 0:00:05
Average standard deviation of split frequencies: 0.009553
915500 -- [-540.588] (-543.743) (-538.782) (-540.567) * [-538.456] (-538.347) (-540.160) (-539.032) -- 0:00:04
916000 -- (-541.188) (-546.318) [-538.820] (-544.217) * (-540.691) [-541.260] (-539.793) (-539.156) -- 0:00:04
916500 -- (-543.143) [-540.532] (-542.488) (-542.330) * [-542.024] (-544.432) (-538.793) (-541.348) -- 0:00:04
917000 -- (-541.706) (-543.624) (-541.135) [-537.706] * (-539.901) (-539.501) (-537.836) [-539.520] -- 0:00:04
917500 -- (-543.070) [-542.223] (-543.383) (-538.498) * (-538.740) [-540.646] (-539.338) (-540.773) -- 0:00:04
918000 -- (-538.680) (-542.555) (-540.766) [-539.043] * [-542.088] (-542.219) (-543.642) (-540.863) -- 0:00:04
918500 -- (-539.135) (-539.547) [-539.099] (-541.603) * (-540.184) (-537.952) [-538.149] (-539.748) -- 0:00:04
919000 -- [-540.032] (-542.290) (-538.979) (-540.531) * (-539.088) (-538.791) (-539.354) [-541.863] -- 0:00:04
919500 -- (-538.364) [-541.229] (-539.150) (-538.790) * (-538.170) [-539.932] (-539.256) (-546.607) -- 0:00:04
920000 -- [-538.501] (-539.693) (-539.739) (-540.800) * (-538.641) (-537.908) (-539.469) [-540.836] -- 0:00:04
Average standard deviation of split frequencies: 0.009440
920500 -- (-539.737) [-539.984] (-538.622) (-543.984) * (-542.943) (-539.605) [-542.381] (-539.328) -- 0:00:04
921000 -- [-538.550] (-539.565) (-538.838) (-540.139) * (-541.126) (-541.816) (-540.389) [-538.597] -- 0:00:04
921500 -- [-540.801] (-539.055) (-540.288) (-539.507) * (-542.207) (-540.508) [-548.044] (-538.810) -- 0:00:04
922000 -- (-539.478) [-544.273] (-543.816) (-542.063) * [-539.654] (-538.813) (-545.590) (-540.018) -- 0:00:04
922500 -- [-543.694] (-539.642) (-541.281) (-541.539) * (-540.710) [-538.939] (-540.332) (-542.362) -- 0:00:04
923000 -- (-541.632) (-540.057) [-538.498] (-540.348) * (-541.128) (-540.468) (-540.236) [-538.807] -- 0:00:04
923500 -- (-548.514) [-539.963] (-539.390) (-541.012) * [-541.296] (-539.574) (-540.932) (-541.212) -- 0:00:04
924000 -- (-542.100) (-539.648) [-542.270] (-540.577) * (-546.371) (-540.142) (-543.433) [-538.704] -- 0:00:04
924500 -- (-539.247) (-539.329) [-541.249] (-538.064) * (-538.358) (-538.276) (-546.817) [-538.150] -- 0:00:04
925000 -- (-538.932) [-542.673] (-541.791) (-539.250) * (-540.028) (-539.143) (-543.209) [-541.434] -- 0:00:04
Average standard deviation of split frequencies: 0.009036
925500 -- (-539.415) [-538.107] (-541.341) (-543.690) * (-540.570) [-539.070] (-540.415) (-541.201) -- 0:00:04
926000 -- [-538.581] (-540.272) (-539.353) (-539.905) * (-543.093) (-540.422) (-542.266) [-539.005] -- 0:00:04
926500 -- (-539.413) (-542.188) (-539.026) [-539.086] * (-543.512) (-539.359) (-540.656) [-538.619] -- 0:00:04
927000 -- (-541.628) (-540.688) (-539.397) [-538.719] * (-542.976) (-541.228) [-542.235] (-539.286) -- 0:00:04
927500 -- (-538.689) (-537.931) [-540.523] (-540.998) * (-540.340) (-542.484) [-539.020] (-541.564) -- 0:00:04
928000 -- (-543.682) (-540.497) (-541.696) [-538.739] * [-538.978] (-538.461) (-539.348) (-539.182) -- 0:00:04
928500 -- (-539.265) [-540.205] (-545.993) (-541.949) * (-538.898) (-540.464) (-540.295) [-540.203] -- 0:00:04
929000 -- (-542.937) [-538.837] (-539.740) (-539.098) * (-538.479) [-542.636] (-539.721) (-542.331) -- 0:00:04
929500 -- (-541.866) (-539.041) [-539.662] (-538.344) * (-538.163) (-542.210) [-540.640] (-539.123) -- 0:00:04
930000 -- (-539.516) [-538.491] (-540.045) (-538.459) * [-538.389] (-540.163) (-544.398) (-538.513) -- 0:00:04
Average standard deviation of split frequencies: 0.008927
930500 -- (-539.573) (-542.778) (-540.072) [-539.540] * (-539.271) [-538.396] (-545.343) (-538.909) -- 0:00:04
931000 -- [-538.582] (-542.195) (-539.203) (-541.983) * (-539.336) [-539.862] (-542.930) (-538.353) -- 0:00:04
931500 -- (-539.698) (-543.543) (-538.477) [-543.179] * [-538.382] (-541.696) (-539.525) (-538.981) -- 0:00:04
932000 -- (-540.067) (-543.760) (-538.624) [-541.355] * (-541.074) [-543.663] (-542.932) (-539.158) -- 0:00:04
932500 -- [-541.487] (-542.371) (-538.593) (-548.042) * (-539.128) (-542.480) [-538.563] (-540.212) -- 0:00:03
933000 -- [-540.295] (-537.931) (-540.961) (-545.723) * (-539.566) (-540.480) [-539.932] (-540.433) -- 0:00:03
933500 -- [-540.068] (-539.509) (-538.189) (-540.301) * (-543.852) [-539.854] (-539.148) (-538.981) -- 0:00:03
934000 -- (-539.281) (-538.807) [-542.237] (-538.818) * (-542.557) [-541.520] (-538.788) (-542.505) -- 0:00:03
934500 -- (-538.904) [-538.329] (-540.048) (-539.631) * [-539.630] (-540.193) (-540.467) (-541.313) -- 0:00:03
935000 -- (-542.503) (-538.201) [-538.564] (-539.883) * (-544.784) [-539.384] (-542.096) (-539.541) -- 0:00:03
Average standard deviation of split frequencies: 0.008845
935500 -- (-546.431) (-539.928) [-540.366] (-543.727) * (-542.621) (-541.584) (-539.311) [-539.285] -- 0:00:03
936000 -- (-544.434) (-541.177) [-538.964] (-543.589) * (-540.008) (-540.707) [-539.581] (-539.625) -- 0:00:03
936500 -- (-542.222) [-544.334] (-539.313) (-538.963) * (-540.485) (-540.043) (-540.798) [-537.739] -- 0:00:03
937000 -- (-538.513) (-538.563) [-540.089] (-540.671) * [-538.917] (-541.162) (-540.552) (-539.865) -- 0:00:03
937500 -- (-539.902) (-538.742) [-538.543] (-541.429) * (-538.922) (-540.707) [-541.666] (-537.871) -- 0:00:03
938000 -- [-540.870] (-544.498) (-538.718) (-542.730) * (-538.793) (-537.962) (-544.233) [-540.034] -- 0:00:03
938500 -- (-539.841) [-540.530] (-538.486) (-539.890) * (-538.833) (-537.825) [-540.173] (-539.896) -- 0:00:03
939000 -- (-539.938) (-540.894) (-539.379) [-541.263] * (-538.707) (-538.601) (-540.937) [-539.344] -- 0:00:03
939500 -- (-541.997) (-542.833) (-543.268) [-539.986] * (-541.679) [-537.714] (-540.604) (-539.864) -- 0:00:03
940000 -- (-539.213) [-539.977] (-539.710) (-539.939) * (-539.208) [-538.239] (-541.678) (-538.951) -- 0:00:03
Average standard deviation of split frequencies: 0.008653
940500 -- (-543.686) [-539.649] (-538.214) (-539.508) * (-539.058) (-540.923) [-542.397] (-543.050) -- 0:00:03
941000 -- (-539.104) [-538.963] (-540.140) (-541.187) * (-538.886) (-538.863) (-540.750) [-543.398] -- 0:00:03
941500 -- (-541.649) (-539.860) (-542.830) [-540.960] * (-540.282) [-539.090] (-541.493) (-540.481) -- 0:00:03
942000 -- (-540.790) [-538.485] (-540.166) (-542.029) * (-541.626) [-542.703] (-538.748) (-541.780) -- 0:00:03
942500 -- (-539.174) (-539.435) (-541.791) [-539.854] * (-542.125) (-541.177) [-542.026] (-541.060) -- 0:00:03
943000 -- (-538.954) (-540.722) [-540.464] (-542.024) * (-539.941) (-541.969) [-540.475] (-539.127) -- 0:00:03
943500 -- (-539.052) (-539.784) [-540.163] (-542.476) * (-540.321) [-541.134] (-541.576) (-543.380) -- 0:00:03
944000 -- (-543.283) [-538.077] (-538.197) (-539.693) * [-539.916] (-539.633) (-542.111) (-541.701) -- 0:00:03
944500 -- (-543.082) (-538.366) (-539.030) [-538.853] * [-540.379] (-540.156) (-546.794) (-538.999) -- 0:00:03
945000 -- (-538.713) [-538.144] (-539.328) (-540.009) * (-539.362) (-542.905) (-545.649) [-539.677] -- 0:00:03
Average standard deviation of split frequencies: 0.008637
945500 -- (-538.842) (-538.798) [-538.641] (-539.324) * (-538.283) (-542.149) [-539.675] (-542.469) -- 0:00:03
946000 -- (-538.812) [-540.721] (-539.983) (-539.829) * (-541.158) (-540.562) (-540.687) [-538.779] -- 0:00:03
946500 -- (-541.421) [-543.338] (-540.327) (-539.597) * (-542.873) (-540.118) [-540.059] (-539.250) -- 0:00:03
947000 -- (-541.165) (-541.578) (-538.539) [-538.756] * [-538.574] (-540.756) (-541.102) (-539.917) -- 0:00:03
947500 -- (-539.856) (-538.881) [-541.948] (-540.695) * (-538.647) [-544.896] (-540.763) (-543.488) -- 0:00:03
948000 -- (-542.481) [-540.045] (-538.807) (-541.062) * (-538.504) (-541.502) (-539.265) [-539.702] -- 0:00:03
948500 -- (-539.395) (-539.425) [-538.550] (-540.550) * (-538.473) [-539.944] (-539.540) (-541.846) -- 0:00:03
949000 -- (-539.298) (-539.261) [-538.668] (-539.185) * (-538.331) [-541.858] (-540.407) (-543.473) -- 0:00:03
949500 -- (-548.535) (-539.126) (-542.002) [-541.006] * (-539.565) (-541.612) (-539.205) [-539.581] -- 0:00:02
950000 -- [-543.635] (-542.050) (-540.242) (-539.452) * (-539.401) [-540.480] (-539.227) (-539.578) -- 0:00:02
Average standard deviation of split frequencies: 0.008331
950500 -- [-539.497] (-542.674) (-541.759) (-542.004) * (-538.549) [-539.285] (-543.890) (-545.953) -- 0:00:02
951000 -- (-541.401) (-538.543) [-541.173] (-539.157) * (-538.860) (-538.105) [-541.001] (-541.344) -- 0:00:02
951500 -- (-538.951) (-540.698) (-538.616) [-538.172] * [-537.847] (-542.296) (-539.171) (-539.496) -- 0:00:02
952000 -- [-542.093] (-546.066) (-539.528) (-541.309) * (-538.964) (-541.359) [-538.728] (-540.826) -- 0:00:02
952500 -- (-538.802) (-543.613) (-540.977) [-538.907] * [-538.646] (-540.644) (-539.249) (-540.772) -- 0:00:02
953000 -- (-538.801) (-540.623) (-541.995) [-539.570] * (-540.368) (-541.529) [-538.693] (-538.825) -- 0:00:02
953500 -- [-539.590] (-539.478) (-538.627) (-540.605) * (-541.473) [-540.543] (-543.202) (-540.849) -- 0:00:02
954000 -- (-539.475) (-538.786) [-538.703] (-538.456) * (-541.033) [-538.192] (-538.851) (-538.767) -- 0:00:02
954500 -- [-539.279] (-538.782) (-540.345) (-541.080) * (-541.794) [-541.343] (-542.815) (-539.503) -- 0:00:02
955000 -- (-540.744) (-541.138) (-542.675) [-538.781] * [-540.854] (-538.715) (-539.068) (-538.644) -- 0:00:02
Average standard deviation of split frequencies: 0.008514
955500 -- (-539.638) (-544.096) (-540.633) [-541.157] * [-541.431] (-539.345) (-538.601) (-539.272) -- 0:00:02
956000 -- (-538.873) [-539.795] (-549.133) (-544.416) * (-541.479) [-538.315] (-538.601) (-538.666) -- 0:00:02
956500 -- [-539.073] (-540.662) (-541.260) (-539.934) * (-542.786) (-539.554) [-540.653] (-538.621) -- 0:00:02
957000 -- (-541.883) (-539.332) [-539.501] (-540.726) * [-538.712] (-541.964) (-543.192) (-539.562) -- 0:00:02
957500 -- (-540.872) (-541.061) [-541.310] (-544.532) * (-544.341) [-539.566] (-539.303) (-538.775) -- 0:00:02
958000 -- (-538.475) (-540.294) [-544.541] (-540.572) * (-541.665) (-538.715) [-539.166] (-539.513) -- 0:00:02
958500 -- (-539.379) [-540.355] (-538.085) (-539.747) * [-539.645] (-538.522) (-540.777) (-540.432) -- 0:00:02
959000 -- [-540.728] (-540.253) (-538.090) (-539.128) * (-543.590) (-541.244) [-539.779] (-539.618) -- 0:00:02
959500 -- (-538.813) (-541.695) (-540.745) [-539.972] * (-541.287) (-542.000) (-539.509) [-539.893] -- 0:00:02
960000 -- (-540.213) [-538.673] (-539.212) (-539.875) * (-541.312) (-543.576) (-541.390) [-538.581] -- 0:00:02
Average standard deviation of split frequencies: 0.008538
960500 -- [-539.553] (-539.031) (-539.927) (-538.872) * (-539.280) (-538.941) [-540.121] (-540.134) -- 0:00:02
961000 -- (-539.878) [-539.401] (-540.485) (-539.729) * (-540.545) [-538.293] (-537.686) (-543.720) -- 0:00:02
961500 -- (-546.509) (-538.173) (-538.687) [-538.898] * (-538.042) [-538.693] (-538.728) (-541.156) -- 0:00:02
962000 -- (-543.661) [-540.266] (-539.911) (-540.162) * (-539.106) (-539.981) (-538.813) [-539.510] -- 0:00:02
962500 -- (-540.163) (-539.338) [-538.213] (-539.925) * (-539.862) (-539.678) [-538.616] (-540.178) -- 0:00:02
963000 -- (-545.415) (-541.136) [-540.255] (-539.234) * (-539.446) (-539.762) (-540.118) [-538.444] -- 0:00:02
963500 -- (-538.778) (-539.017) (-539.432) [-543.297] * (-539.472) (-539.753) [-538.213] (-539.846) -- 0:00:02
964000 -- (-538.910) [-539.567] (-538.394) (-539.426) * [-539.391] (-539.424) (-539.897) (-540.583) -- 0:00:02
964500 -- (-539.003) (-538.997) [-541.017] (-539.089) * (-544.509) (-539.148) (-540.379) [-540.037] -- 0:00:02
965000 -- [-540.888] (-538.384) (-540.390) (-544.516) * (-539.831) (-538.919) (-541.351) [-541.292] -- 0:00:02
Average standard deviation of split frequencies: 0.008204
965500 -- [-540.306] (-539.430) (-539.272) (-543.958) * (-541.771) (-538.845) [-541.161] (-538.168) -- 0:00:02
966000 -- (-538.901) (-540.672) (-538.479) [-546.922] * (-539.372) (-539.423) (-538.359) [-538.703] -- 0:00:02
966500 -- (-539.525) (-537.800) (-540.375) [-538.072] * (-540.274) (-539.699) [-538.250] (-538.446) -- 0:00:01
967000 -- (-541.211) (-539.020) [-539.437] (-540.923) * [-545.312] (-541.463) (-537.822) (-538.438) -- 0:00:01
967500 -- (-538.851) (-544.531) (-541.257) [-538.512] * (-544.476) (-543.886) [-542.454] (-541.445) -- 0:00:01
968000 -- [-540.414] (-542.165) (-540.607) (-539.806) * (-543.456) [-537.911] (-539.814) (-543.344) -- 0:00:01
968500 -- [-539.232] (-539.982) (-540.107) (-539.987) * (-541.609) (-538.294) (-540.567) [-539.813] -- 0:00:01
969000 -- (-541.239) [-542.688] (-542.808) (-541.751) * (-537.969) (-539.865) [-538.799] (-540.994) -- 0:00:01
969500 -- (-543.782) (-541.079) [-543.115] (-543.668) * (-539.301) (-540.755) (-538.702) [-540.695] -- 0:00:01
970000 -- (-540.450) (-540.767) (-542.479) [-543.920] * (-539.045) (-538.983) [-538.984] (-541.758) -- 0:00:01
Average standard deviation of split frequencies: 0.008062
970500 -- (-541.604) (-538.413) [-538.679] (-542.607) * (-538.247) (-538.447) [-540.435] (-541.453) -- 0:00:01
971000 -- (-540.865) (-539.795) (-538.373) [-539.981] * (-539.807) (-540.487) [-538.180] (-541.088) -- 0:00:01
971500 -- [-537.779] (-544.019) (-538.387) (-542.591) * [-537.915] (-539.484) (-541.350) (-539.154) -- 0:00:01
972000 -- (-538.007) (-539.807) (-538.466) [-540.592] * (-539.773) [-542.474] (-538.712) (-538.536) -- 0:00:01
972500 -- (-542.486) (-539.053) (-539.212) [-540.235] * (-538.984) [-538.389] (-538.397) (-543.434) -- 0:00:01
973000 -- (-543.684) (-540.401) (-539.722) [-539.853] * (-539.044) (-541.773) (-540.115) [-538.251] -- 0:00:01
973500 -- (-540.588) [-539.061] (-539.395) (-539.962) * (-539.227) (-540.613) (-545.568) [-543.654] -- 0:00:01
974000 -- (-540.433) [-539.478] (-545.624) (-541.736) * [-538.338] (-545.021) (-541.007) (-541.537) -- 0:00:01
974500 -- (-541.886) (-539.208) [-538.650] (-539.969) * [-539.386] (-544.073) (-539.338) (-539.925) -- 0:00:01
975000 -- (-540.812) (-540.661) (-539.403) [-544.376] * (-538.332) (-541.730) (-538.122) [-539.340] -- 0:00:01
Average standard deviation of split frequencies: 0.008030
975500 -- (-542.107) [-539.349] (-539.167) (-538.068) * [-539.765] (-538.878) (-538.931) (-540.780) -- 0:00:01
976000 -- [-540.964] (-544.131) (-540.166) (-538.139) * [-540.014] (-540.137) (-541.001) (-543.970) -- 0:00:01
976500 -- (-541.479) (-538.920) (-541.165) [-540.243] * (-539.220) [-538.571] (-539.789) (-539.817) -- 0:00:01
977000 -- (-541.731) [-538.565] (-539.948) (-540.259) * (-540.290) [-538.843] (-538.908) (-540.692) -- 0:00:01
977500 -- (-539.296) (-539.887) (-545.476) [-542.105] * [-542.326] (-543.618) (-538.879) (-538.451) -- 0:00:01
978000 -- (-538.205) (-544.031) (-539.123) [-539.385] * (-540.518) (-541.234) [-542.071] (-541.004) -- 0:00:01
978500 -- (-538.689) (-542.252) (-539.297) [-539.329] * (-541.572) (-538.379) (-544.000) [-538.769] -- 0:00:01
979000 -- (-542.812) (-540.605) (-544.235) [-539.160] * (-541.298) (-539.936) [-539.544] (-538.478) -- 0:00:01
979500 -- (-541.601) [-540.480] (-542.173) (-539.203) * (-538.082) (-538.270) [-539.188] (-538.758) -- 0:00:01
980000 -- (-541.307) [-542.250] (-542.121) (-541.012) * (-541.461) (-540.809) (-541.562) [-540.641] -- 0:00:01
Average standard deviation of split frequencies: 0.008502
980500 -- [-542.034] (-539.206) (-539.852) (-541.125) * (-540.042) (-539.283) [-542.443] (-538.758) -- 0:00:01
981000 -- (-539.578) (-538.157) [-538.452] (-543.231) * [-541.071] (-541.123) (-539.971) (-541.756) -- 0:00:01
981500 -- [-541.660] (-539.314) (-539.168) (-540.002) * (-538.691) [-539.550] (-539.412) (-541.116) -- 0:00:01
982000 -- (-539.447) (-540.919) (-540.157) [-542.501] * (-539.045) (-540.337) [-541.208] (-539.126) -- 0:00:01
982500 -- [-538.472] (-539.036) (-539.244) (-539.303) * (-541.158) [-541.858] (-540.488) (-538.277) -- 0:00:01
983000 -- (-539.558) [-538.603] (-544.308) (-542.999) * (-546.228) (-540.831) [-541.115] (-540.298) -- 0:00:01
983500 -- (-538.985) (-538.862) [-539.763] (-539.403) * (-543.049) (-539.581) [-538.230] (-541.169) -- 0:00:00
984000 -- (-541.499) (-539.269) (-538.824) [-539.360] * (-544.398) (-540.011) [-538.661] (-542.115) -- 0:00:00
984500 -- (-540.560) (-541.640) (-540.771) [-538.969] * (-542.406) (-538.781) (-541.008) [-540.691] -- 0:00:00
985000 -- (-538.520) (-541.294) [-538.174] (-541.446) * (-538.285) [-540.132] (-540.940) (-540.177) -- 0:00:00
Average standard deviation of split frequencies: 0.008486
985500 -- [-540.649] (-540.910) (-539.511) (-542.910) * (-539.180) (-538.677) [-543.223] (-540.003) -- 0:00:00
986000 -- (-540.807) (-544.377) [-538.831] (-540.396) * (-540.223) (-538.467) [-539.281] (-540.434) -- 0:00:00
986500 -- (-539.998) (-540.903) [-538.977] (-539.694) * (-539.902) (-540.802) (-538.907) [-541.325] -- 0:00:00
987000 -- (-539.845) (-538.235) [-543.205] (-540.497) * (-538.834) (-539.905) [-539.429] (-540.781) -- 0:00:00
987500 -- (-540.302) (-538.467) (-541.780) [-540.514] * (-539.450) (-549.620) (-539.880) [-539.800] -- 0:00:00
988000 -- (-542.268) (-538.353) (-540.620) [-541.987] * [-539.695] (-541.836) (-539.740) (-539.236) -- 0:00:00
988500 -- (-543.053) (-541.949) [-541.452] (-543.495) * (-541.402) (-538.146) [-538.580] (-542.138) -- 0:00:00
989000 -- [-538.984] (-539.989) (-538.852) (-545.479) * (-541.781) (-541.438) [-541.221] (-542.465) -- 0:00:00
989500 -- (-538.859) (-544.787) (-540.493) [-539.645] * (-538.892) [-539.218] (-539.041) (-544.767) -- 0:00:00
990000 -- [-538.743] (-539.633) (-542.735) (-543.263) * (-538.338) [-541.155] (-538.934) (-540.325) -- 0:00:00
Average standard deviation of split frequencies: 0.008892
990500 -- (-540.444) [-539.852] (-539.945) (-538.664) * (-539.307) [-541.063] (-544.167) (-538.701) -- 0:00:00
991000 -- [-538.302] (-539.875) (-540.529) (-540.267) * (-541.384) [-539.625] (-538.920) (-541.565) -- 0:00:00
991500 -- (-543.634) (-540.884) (-543.135) [-539.168] * (-542.536) (-539.575) [-541.237] (-541.659) -- 0:00:00
992000 -- (-543.167) (-547.664) [-539.566] (-542.382) * [-538.646] (-538.502) (-538.236) (-542.799) -- 0:00:00
992500 -- (-545.914) (-539.971) [-539.354] (-539.393) * (-539.794) [-540.860] (-540.358) (-542.397) -- 0:00:00
993000 -- [-540.236] (-538.138) (-539.002) (-539.980) * (-539.676) (-543.811) [-540.950] (-542.530) -- 0:00:00
993500 -- (-541.447) (-539.201) [-540.301] (-538.958) * (-543.637) (-540.102) (-543.100) [-539.661] -- 0:00:00
994000 -- (-539.662) [-538.321] (-539.669) (-541.479) * (-540.697) [-539.478] (-540.108) (-539.773) -- 0:00:00
994500 -- [-540.481] (-538.182) (-538.763) (-540.646) * (-540.757) (-539.791) (-542.824) [-539.996] -- 0:00:00
995000 -- (-547.405) [-539.320] (-538.246) (-539.224) * (-540.578) (-542.442) [-542.867] (-544.817) -- 0:00:00
Average standard deviation of split frequencies: 0.008726
995500 -- (-543.017) (-548.150) (-545.181) [-539.101] * (-538.220) (-542.476) [-541.485] (-540.984) -- 0:00:00
996000 -- (-541.164) [-539.869] (-548.095) (-540.287) * (-543.149) (-541.851) (-545.475) [-538.689] -- 0:00:00
996500 -- (-541.899) (-539.021) [-539.126] (-540.421) * (-542.075) [-543.894] (-543.421) (-539.652) -- 0:00:00
997000 -- (-539.516) (-546.189) [-539.136] (-543.604) * [-541.383] (-538.280) (-539.567) (-538.215) -- 0:00:00
997500 -- (-539.173) [-539.249] (-543.249) (-539.873) * (-538.268) (-539.670) [-538.270] (-541.569) -- 0:00:00
998000 -- (-539.665) (-539.645) [-538.976] (-539.768) * [-538.577] (-541.491) (-540.134) (-543.542) -- 0:00:00
998500 -- (-538.700) [-540.394] (-539.167) (-538.258) * (-539.345) (-544.718) (-542.690) [-543.436] -- 0:00:00
999000 -- (-540.669) (-540.108) [-539.867] (-538.333) * [-539.736] (-542.708) (-540.100) (-544.282) -- 0:00:00
999500 -- (-539.445) (-541.259) [-540.845] (-539.512) * (-538.566) (-545.716) (-540.209) [-538.902] -- 0:00:00
1000000 -- (-538.603) [-538.909] (-542.365) (-539.454) * (-539.060) [-541.111] (-539.803) (-538.359) -- 0:00:00
Average standard deviation of split frequencies: 0.008574
Analysis completed in 59 seconds
Analysis used 58.38 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -537.68
Likelihood of best state for "cold" chain of run 2 was -537.68
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 67 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
35.2 % ( 34 %) Dirichlet(Pi{all})
35.7 % ( 26 %) Slider(Pi{all})
78.8 % ( 50 %) Multiplier(Alpha{1,2})
77.7 % ( 50 %) Multiplier(Alpha{3})
24.5 % ( 31 %) Slider(Pinvar{all})
98.6 % ( 96 %) ExtSPR(Tau{all},V{all})
70.2 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 92 %) ParsSPR(Tau{all},V{all})
28.2 % ( 28 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.5 % ( 21 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.3 % ( 70 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
35.1 % ( 27 %) Dirichlet(Pi{all})
35.0 % ( 30 %) Slider(Pi{all})
78.6 % ( 50 %) Multiplier(Alpha{1,2})
77.9 % ( 47 %) Multiplier(Alpha{3})
24.7 % ( 34 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.0 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 27 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.5 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 165828 0.82 0.67
3 | 166410 166886 0.84
4 | 167697 166396 166783
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.51
2 | 167206 0.82 0.67
3 | 167151 166215 0.84
4 | 166081 166419 166928
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -539.29
| 1 |
| 2 2 |
| |
| 2 2 21 1 1 1 2 2 1|
|1 1 1* 1 2 1 22 21 2 2 22 1 21 1 |
| 2 1 1 2 1 12 * 1121 12 21 11 |
| 2 211 1 12 2 1 * 2 1 1 1 |
| 1 2 *2 12 211 1 1 1 212 * |
| 1 2 2 2 2 2 2 2 2 2 2 2 1 2|
| 1 1 2 1 11 2 2 1 |
| 2 2 * 1 2 |
| 1 1 |
| 1 2 2 |
| |
|2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -541.24
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -539.37 -543.38
2 -539.37 -543.07
--------------------------------------
TOTAL -539.37 -543.24
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894584 0.091191 0.348881 1.486362 0.856159 1501.00 1501.00 1.000
r(A<->C){all} 0.166035 0.019279 0.000056 0.448688 0.134071 337.56 358.82 1.005
r(A<->G){all} 0.165238 0.021269 0.000010 0.465043 0.122750 177.69 206.06 1.000
r(A<->T){all} 0.165159 0.019206 0.000066 0.449068 0.128394 121.92 172.44 1.002
r(C<->G){all} 0.162675 0.020394 0.000117 0.457370 0.120537 78.44 87.36 1.000
r(C<->T){all} 0.173331 0.022342 0.000076 0.473259 0.130754 242.29 245.46 1.000
r(G<->T){all} 0.167561 0.019319 0.000065 0.456349 0.129856 213.78 234.94 1.000
pi(A){all} 0.225661 0.000436 0.183494 0.266444 0.224755 1239.35 1346.76 1.001
pi(C){all} 0.253526 0.000493 0.208006 0.295116 0.253253 966.07 1133.60 1.000
pi(G){all} 0.299722 0.000513 0.256436 0.343357 0.299581 1171.60 1233.01 1.001
pi(T){all} 0.221091 0.000413 0.183818 0.263757 0.220078 1134.13 1317.57 1.000
alpha{1,2} 0.418170 0.222718 0.000134 1.395940 0.254997 991.51 1246.26 1.000
alpha{3} 0.447122 0.222128 0.000290 1.370687 0.306475 1501.00 1501.00 1.000
pinvar{all} 0.995801 0.000024 0.986348 0.999998 0.997394 1248.14 1333.49 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ....**
8 -- .***.*
9 -- .*.*..
10 -- ...**.
11 -- .**.**
12 -- .**...
13 -- .****.
14 -- ..*..*
15 -- .*...*
16 -- ..****
17 -- ..*.*.
18 -- .*.***
19 -- ..**..
20 -- .*..*.
21 -- ...*.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 450 0.149900 0.002827 0.147901 0.151899 2
8 450 0.149900 0.004711 0.146569 0.153231 2
9 449 0.149567 0.005182 0.145903 0.153231 2
10 447 0.148901 0.011777 0.140573 0.157229 2
11 442 0.147235 0.004711 0.143904 0.150566 2
12 439 0.146236 0.008951 0.139907 0.152565 2
13 439 0.146236 0.009893 0.139241 0.153231 2
14 437 0.145570 0.002355 0.143904 0.147235 2
15 436 0.145237 0.008480 0.139241 0.151233 2
16 425 0.141572 0.010835 0.133911 0.149234 2
17 414 0.137908 0.009422 0.131246 0.144570 2
18 411 0.136909 0.001413 0.135909 0.137908 2
19 405 0.134910 0.015546 0.123917 0.145903 2
20 392 0.130580 0.018844 0.117255 0.143904 2
21 381 0.126915 0.013662 0.117255 0.136576 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099761 0.009771 0.000023 0.293191 0.070011 1.000 2
length{all}[2] 0.097666 0.009365 0.000061 0.294003 0.068032 1.000 2
length{all}[3] 0.100800 0.010599 0.000022 0.302909 0.070015 1.000 2
length{all}[4] 0.098732 0.009955 0.000039 0.305004 0.068983 1.000 2
length{all}[5] 0.101346 0.010285 0.000044 0.308082 0.071945 1.000 2
length{all}[6] 0.100887 0.010109 0.000067 0.297534 0.070633 1.000 2
length{all}[7] 0.096281 0.009182 0.000289 0.294986 0.068162 1.000 2
length{all}[8] 0.101171 0.009216 0.000219 0.289956 0.070797 0.998 2
length{all}[9] 0.102128 0.011875 0.000204 0.294652 0.074626 1.004 2
length{all}[10] 0.096726 0.010237 0.000048 0.294800 0.059660 1.000 2
length{all}[11] 0.098906 0.010448 0.000183 0.314213 0.067504 0.998 2
length{all}[12] 0.091013 0.009865 0.000098 0.283006 0.057564 1.008 2
length{all}[13] 0.094126 0.008552 0.000501 0.289280 0.060504 0.999 2
length{all}[14] 0.100962 0.009617 0.000039 0.320023 0.072760 0.999 2
length{all}[15] 0.103356 0.012930 0.000014 0.328896 0.065623 0.999 2
length{all}[16] 0.092504 0.008288 0.000083 0.283008 0.067856 0.998 2
length{all}[17] 0.100004 0.010528 0.000133 0.320377 0.065513 0.998 2
length{all}[18] 0.097629 0.008479 0.000193 0.262775 0.071688 0.998 2
length{all}[19] 0.102195 0.012187 0.000028 0.338301 0.066669 0.998 2
length{all}[20] 0.091366 0.007931 0.000507 0.251283 0.062353 0.999 2
length{all}[21] 0.102486 0.009395 0.001132 0.304695 0.068187 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008574
Maximum standard deviation of split frequencies = 0.018844
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|-------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 44 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 390
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 49 patterns at 130 / 130 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 49 patterns at 130 / 130 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
47824 bytes for conP
4312 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.087914 0.033960 0.100881 0.046725 0.044060 0.067873 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -567.422954
Iterating by ming2
Initial: fx= 567.422954
x= 0.08791 0.03396 0.10088 0.04672 0.04406 0.06787 0.30000 1.30000
1 h-m-p 0.0000 0.0003 314.5338 +++ 541.320559 m 0.0003 14 | 1/8
2 h-m-p 0.0024 0.0474 30.8823 ------------.. | 1/8
3 h-m-p 0.0000 0.0001 288.5504 ++ 534.788632 m 0.0001 46 | 2/8
4 h-m-p 0.0007 0.0554 28.7810 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 258.2562 ++ 533.408140 m 0.0000 77 | 3/8
6 h-m-p 0.0002 0.0693 23.2785 ----------.. | 3/8
7 h-m-p 0.0000 0.0002 223.3756 +++ 525.168644 m 0.0002 108 | 4/8
8 h-m-p 0.0017 0.0921 17.9819 -----------.. | 4/8
9 h-m-p 0.0000 0.0002 182.7820 ++ 519.922176 m 0.0002 139 | 5/8
10 h-m-p 0.0015 0.1355 13.1491 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 129.5571 ++ 518.213782 m 0.0001 170 | 6/8
12 h-m-p 0.7171 8.0000 0.0000 ++ 518.213782 m 8.0000 181 | 6/8
13 h-m-p 0.6068 8.0000 0.0000 ++ 518.213782 m 8.0000 194 | 6/8
14 h-m-p 0.0160 8.0000 0.0295 --------C 518.213782 0 0.0000 215 | 6/8
15 h-m-p 0.0160 8.0000 0.0000 Y 518.213782 0 0.0160 228 | 6/8
16 h-m-p 0.0160 8.0000 0.0000 +++++ 518.213782 m 8.0000 244 | 6/8
17 h-m-p 0.0133 6.6749 0.0619 -----C 518.213782 0 0.0000 262 | 6/8
18 h-m-p 0.0160 8.0000 0.0002 +++++ 518.213782 m 8.0000 278 | 6/8
19 h-m-p 0.0305 6.5821 0.0631 --------C 518.213782 0 0.0000 299 | 6/8
20 h-m-p 0.0160 8.0000 0.0003 ------Y 518.213782 0 0.0000 318 | 6/8
21 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/8
22 h-m-p 0.0160 8.0000 0.0000 +++++ 518.213782 m 8.0000 358 | 6/8
23 h-m-p 0.0038 1.9216 0.9796 +++++ 518.213739 m 1.9216 374 | 7/8
24 h-m-p 0.3654 1.8270 0.9097 ++ 518.213573 m 1.8270 387 | 8/8
25 h-m-p 0.0160 8.0000 0.0000 Y 518.213573 0 0.0160 399
Out..
lnL = -518.213573
400 lfun, 400 eigenQcodon, 2400 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.018363 0.017681 0.031544 0.054776 0.053612 0.034589 0.000100 0.769969 0.193927
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 17.918067
np = 9
lnL0 = -543.999505
Iterating by ming2
Initial: fx= 543.999505
x= 0.01836 0.01768 0.03154 0.05478 0.05361 0.03459 0.00011 0.76997 0.19393
1 h-m-p 0.0000 0.0000 288.9750 ++ 543.480422 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0007 151.4995 +++ 530.960641 m 0.0007 27 | 2/9
3 h-m-p 0.0000 0.0000 196.7441 ++ 530.625085 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0005 153.7887 +++ 524.748057 m 0.0005 52 | 4/9
5 h-m-p 0.0000 0.0000 514.2355 ++ 523.739566 m 0.0000 64 | 5/9
6 h-m-p 0.0000 0.0000 7727.5392 ++ 522.187082 m 0.0000 76 | 6/9
7 h-m-p 0.0007 0.0058 19.0307 ++ 521.438058 m 0.0058 88 | 7/9
8 h-m-p 0.0001 0.0007 118.9959 ++ 521.157022 m 0.0007 100 | 8/9
9 h-m-p 0.0075 0.0940 0.2624 ++ 518.213573 m 0.0940 112 | 9/9
10 h-m-p 0.0160 8.0000 0.0000 N 518.213573 0 0.0160 125
Out..
lnL = -518.213573
126 lfun, 378 eigenQcodon, 1512 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.095876 0.104722 0.073430 0.032658 0.042286 0.053158 0.000100 1.666906 0.258803 0.374325 2.385206
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.332067
np = 11
lnL0 = -565.089745
Iterating by ming2
Initial: fx= 565.089745
x= 0.09588 0.10472 0.07343 0.03266 0.04229 0.05316 0.00011 1.66691 0.25880 0.37432 2.38521
1 h-m-p 0.0000 0.0000 262.0218 ++ 564.848654 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0010 178.2752 ++++ 541.789224 m 0.0010 32 | 2/11
3 h-m-p 0.0000 0.0001 296.8730 ++ 536.883987 m 0.0001 46 | 3/11
4 h-m-p 0.0002 0.0008 91.4051 ++ 531.536215 m 0.0008 60 | 4/11
5 h-m-p 0.0000 0.0001 961.9862 ++ 524.712400 m 0.0001 74 | 5/11
6 h-m-p 0.0000 0.0001 820.6331 ++ 522.804267 m 0.0001 88 | 6/11
7 h-m-p 0.0024 0.0118 5.5827 ------------.. | 6/11
8 h-m-p 0.0000 0.0001 169.6041 ++ 519.320210 m 0.0001 126 | 7/11
9 h-m-p 0.0160 8.0000 2.5823 -------------.. | 7/11
10 h-m-p 0.0000 0.0001 125.8347 ++ 518.213742 m 0.0001 165 | 8/11
11 h-m-p 0.1292 8.0000 0.0000 +++ 518.213742 m 8.0000 180 | 8/11
12 h-m-p 0.0160 8.0000 0.0186 -------Y 518.213742 0 0.0000 204 | 8/11
13 h-m-p 0.0160 8.0000 0.0009 +++++ 518.213742 m 8.0000 224 | 8/11
14 h-m-p 0.0160 8.0000 6.4853 ------------Y 518.213742 0 0.0000 253 | 8/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 518.213742 m 8.0000 270 | 8/11
16 h-m-p 0.0034 1.6985 1.0860 ++++Y 518.213734 0 1.2821 291 | 8/11
17 h-m-p 1.6000 8.0000 0.0003 --------N 518.213734 0 0.0000 313 | 8/11
18 h-m-p 0.0160 8.0000 0.0000 N 518.213734 0 0.0160 330
Out..
lnL = -518.213734
331 lfun, 1324 eigenQcodon, 5958 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -518.223566 S = -518.211996 -0.004428
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:02
did 20 / 49 patterns 0:02
did 30 / 49 patterns 0:02
did 40 / 49 patterns 0:02
did 49 / 49 patterns 0:02
Time used: 0:02
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.086381 0.094515 0.096225 0.063568 0.083312 0.076106 0.000100 1.081555 1.104483
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 15.148007
np = 9
lnL0 = -579.076568
Iterating by ming2
Initial: fx= 579.076568
x= 0.08638 0.09452 0.09622 0.06357 0.08331 0.07611 0.00011 1.08155 1.10448
1 h-m-p 0.0000 0.0000 282.6746 ++ 578.867663 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0200 55.3977 +++++ 530.923157 m 0.0200 29 | 2/9
3 h-m-p 0.0000 0.0001 825.7856 ++ 527.848164 m 0.0001 41 | 3/9
4 h-m-p 0.0000 0.0001 725.0978 ++ 518.223951 m 0.0001 53 | 4/9
5 h-m-p 0.0000 0.0000 13.0930 ++ 518.223339 m 0.0000 65 | 5/9
6 h-m-p 0.0000 0.0000 66.6155 ++ 518.219881 m 0.0000 77 | 6/9
7 h-m-p 0.0000 0.0001 2.5900 --------.. | 6/9
8 h-m-p 0.0000 0.0000 171.3166 ++ 518.214785 m 0.0000 107 | 7/9
9 h-m-p 0.0160 8.0000 0.8094 -------------.. | 7/9
10 h-m-p 0.0000 0.0000 75.7329 ++ 518.213573 m 0.0000 144 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 Y 518.213573 0 1.6000 156 | 8/9
12 h-m-p 0.0160 8.0000 0.0000 Y 518.213573 0 0.0160 169
Out..
lnL = -518.213573
170 lfun, 1870 eigenQcodon, 10200 P(t)
Time used: 0:05
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.062649 0.091936 0.018075 0.058073 0.050747 0.065677 0.000100 0.900000 0.453365 1.674229 2.352632
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 16.717056
np = 11
lnL0 = -555.479905
Iterating by ming2
Initial: fx= 555.479905
x= 0.06265 0.09194 0.01808 0.05807 0.05075 0.06568 0.00011 0.90000 0.45337 1.67423 2.35263
1 h-m-p 0.0000 0.0000 228.1847 ++ 555.386204 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0004 224.8607 +++ 544.712666 m 0.0004 31 | 2/11
3 h-m-p 0.0001 0.0005 197.6890 ++ 527.292996 m 0.0005 45 | 3/11
4 h-m-p 0.0017 0.0086 26.2379 ++ 522.754805 m 0.0086 59 | 4/11
5 h-m-p 0.0000 0.0000 6190.1250 ++ 520.865054 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 2699448.2607 ++ 520.435513 m 0.0000 87 | 6/11
7 h-m-p 0.0034 0.2906 5.9153 ------------.. | 6/11
8 h-m-p 0.0000 0.0000 172.2456 ++ 520.238336 m 0.0000 125 | 7/11
9 h-m-p 0.0001 0.0138 11.6921 ++++ 518.689153 m 0.0138 141 | 8/11
10 h-m-p 0.0005 0.0025 1.7348 ++ 518.213573 m 0.0025 155 | 9/11
11 h-m-p 1.6000 8.0000 0.0000 +Y 518.213573 0 6.4000 170 | 9/11
12 h-m-p 0.0192 8.0000 0.0000 Y 518.213573 0 0.0048 186 | 9/11
13 h-m-p 0.0814 8.0000 0.0000 N 518.213573 0 0.0203 202 | 9/11
14 h-m-p 0.0160 8.0000 0.0000 -N 518.213573 0 0.0010 219
Out..
lnL = -518.213573
220 lfun, 2640 eigenQcodon, 14520 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -518.254060 S = -518.214202 -0.017620
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:09
did 20 / 49 patterns 0:09
did 30 / 49 patterns 0:09
did 40 / 49 patterns 0:09
did 49 / 49 patterns 0:10
Time used: 0:10
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=130
NC_011896_1_WP_010908558_1_1941_MLBR_RS09210 MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
NC_002677_1_NP_302237_1_1109_trxB MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
NZ_LVXE01000020_1_WP_010908558_1_893_A3216_RS07335 MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
NZ_LYPH01000025_1_WP_010908558_1_1049_A8144_RS04995 MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
NZ_CP029543_1_WP_010908558_1_1970_DIJ64_RS10030 MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
NZ_AP014567_1_WP_010908558_1_2019_JK2ML_RS10275 MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
**************************************************
NC_011896_1_WP_010908558_1_1941_MLBR_RS09210 FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
NC_002677_1_NP_302237_1_1109_trxB FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
NZ_LVXE01000020_1_WP_010908558_1_893_A3216_RS07335 FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
NZ_LYPH01000025_1_WP_010908558_1_1049_A8144_RS04995 FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
NZ_CP029543_1_WP_010908558_1_1970_DIJ64_RS10030 FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
NZ_AP014567_1_WP_010908558_1_2019_JK2ML_RS10275 FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
**************************************************
NC_011896_1_WP_010908558_1_1941_MLBR_RS09210 DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
NC_002677_1_NP_302237_1_1109_trxB DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
NZ_LVXE01000020_1_WP_010908558_1_893_A3216_RS07335 DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
NZ_LYPH01000025_1_WP_010908558_1_1049_A8144_RS04995 DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
NZ_CP029543_1_WP_010908558_1_1970_DIJ64_RS10030 DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
NZ_AP014567_1_WP_010908558_1_2019_JK2ML_RS10275 DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
******************************
>NC_011896_1_WP_010908558_1_1941_MLBR_RS09210 ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC >NC_002677_1_NP_302237_1_1109_trxB ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC >NZ_LVXE01000020_1_WP_010908558_1_893_A3216_RS07335 ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC >NZ_LYPH01000025_1_WP_010908558_1_1049_A8144_RS04995 ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC >NZ_CP029543_1_WP_010908558_1_1970_DIJ64_RS10030 ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC >NZ_AP014567_1_WP_010908558_1_2019_JK2ML_RS10275 ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC
>NC_011896_1_WP_010908558_1_1941_MLBR_RS09210 MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV >NC_002677_1_NP_302237_1_1109_trxB MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV >NZ_LVXE01000020_1_WP_010908558_1_893_A3216_RS07335 MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV >NZ_LYPH01000025_1_WP_010908558_1_1049_A8144_RS04995 MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV >NZ_CP029543_1_WP_010908558_1_1970_DIJ64_RS10030 MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV >NZ_AP014567_1_WP_010908558_1_2019_JK2ML_RS10275 MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
#NEXUS
[ID: 0861762785]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908558_1_1941_MLBR_RS09210
NC_002677_1_NP_302237_1_1109_trxB
NZ_LVXE01000020_1_WP_010908558_1_893_A3216_RS07335
NZ_LYPH01000025_1_WP_010908558_1_1049_A8144_RS04995
NZ_CP029543_1_WP_010908558_1_1970_DIJ64_RS10030
NZ_AP014567_1_WP_010908558_1_2019_JK2ML_RS10275
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908558_1_1941_MLBR_RS09210,
2 NC_002677_1_NP_302237_1_1109_trxB,
3 NZ_LVXE01000020_1_WP_010908558_1_893_A3216_RS07335,
4 NZ_LYPH01000025_1_WP_010908558_1_1049_A8144_RS04995,
5 NZ_CP029543_1_WP_010908558_1_1970_DIJ64_RS10030,
6 NZ_AP014567_1_WP_010908558_1_2019_JK2ML_RS10275
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07001103,2:0.06803178,3:0.07001549,4:0.06898323,5:0.07194508,6:0.070633);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07001103,2:0.06803178,3:0.07001549,4:0.06898323,5:0.07194508,6:0.070633);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -539.37 -543.38
2 -539.37 -543.07
--------------------------------------
TOTAL -539.37 -543.24
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894584 0.091191 0.348881 1.486362 0.856159 1501.00 1501.00 1.000
r(A<->C){all} 0.166035 0.019279 0.000056 0.448688 0.134071 337.56 358.82 1.005
r(A<->G){all} 0.165238 0.021269 0.000010 0.465043 0.122750 177.69 206.06 1.000
r(A<->T){all} 0.165159 0.019206 0.000066 0.449068 0.128394 121.92 172.44 1.002
r(C<->G){all} 0.162675 0.020394 0.000117 0.457370 0.120537 78.44 87.36 1.000
r(C<->T){all} 0.173331 0.022342 0.000076 0.473259 0.130754 242.29 245.46 1.000
r(G<->T){all} 0.167561 0.019319 0.000065 0.456349 0.129856 213.78 234.94 1.000
pi(A){all} 0.225661 0.000436 0.183494 0.266444 0.224755 1239.35 1346.76 1.001
pi(C){all} 0.253526 0.000493 0.208006 0.295116 0.253253 966.07 1133.60 1.000
pi(G){all} 0.299722 0.000513 0.256436 0.343357 0.299581 1171.60 1233.01 1.001
pi(T){all} 0.221091 0.000413 0.183818 0.263757 0.220078 1134.13 1317.57 1.000
alpha{1,2} 0.418170 0.222718 0.000134 1.395940 0.254997 991.51 1246.26 1.000
alpha{3} 0.447122 0.222128 0.000290 1.370687 0.306475 1501.00 1501.00 1.000
pinvar{all} 0.995801 0.000024 0.986348 0.999998 0.997394 1248.14 1333.49 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/12res/trxB/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 130
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 3 3 3 3 3 3 | TAC 0 0 0 0 0 0 | TGC 1 1 1 1 1 1
Leu TTA 3 3 3 3 3 3 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 2 2 2 2 2 2
CTC 0 0 0 0 0 0 | CCC 1 1 1 1 1 1 | CAC 3 3 3 3 3 3 | CGC 0 0 0 0 0 0
CTA 0 0 0 0 0 0 | CCA 2 2 2 2 2 2 | Gln CAA 3 3 3 3 3 3 | CGA 2 2 2 2 2 2
CTG 3 3 3 3 3 3 | CCG 4 4 4 4 4 4 | CAG 4 4 4 4 4 4 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 1 1 1 1 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 4 4 4 4 4 4 | ACC 2 2 2 2 2 2 | AAC 5 5 5 5 5 5 | AGC 0 0 0 0 0 0
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 1 1 1 1 1 1 | Arg AGA 1 1 1 1 1 1
Met ATG 2 2 2 2 2 2 | ACG 3 3 3 3 3 3 | AAG 5 5 5 5 5 5 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 3 3 3 3 3 3 | Asp GAT 4 4 4 4 4 4 | Gly GGT 1 1 1 1 1 1
GTC 8 8 8 8 8 8 | GCC 4 4 4 4 4 4 | GAC 5 5 5 5 5 5 | GGC 2 2 2 2 2 2
GTA 1 1 1 1 1 1 | GCA 2 2 2 2 2 2 | Glu GAA 5 5 5 5 5 5 | GGA 1 1 1 1 1 1
GTG 8 8 8 8 8 8 | GCG 3 3 3 3 3 3 | GAG 0 0 0 0 0 0 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908558_1_1941_MLBR_RS09210
position 1: T:0.17692 C:0.21538 A:0.22308 G:0.38462
position 2: T:0.31538 C:0.23846 A:0.29231 G:0.15385
position 3: T:0.16923 C:0.30769 A:0.16154 G:0.36154
Average T:0.22051 C:0.25385 A:0.22564 G:0.30000
#2: NC_002677_1_NP_302237_1_1109_trxB
position 1: T:0.17692 C:0.21538 A:0.22308 G:0.38462
position 2: T:0.31538 C:0.23846 A:0.29231 G:0.15385
position 3: T:0.16923 C:0.30769 A:0.16154 G:0.36154
Average T:0.22051 C:0.25385 A:0.22564 G:0.30000
#3: NZ_LVXE01000020_1_WP_010908558_1_893_A3216_RS07335
position 1: T:0.17692 C:0.21538 A:0.22308 G:0.38462
position 2: T:0.31538 C:0.23846 A:0.29231 G:0.15385
position 3: T:0.16923 C:0.30769 A:0.16154 G:0.36154
Average T:0.22051 C:0.25385 A:0.22564 G:0.30000
#4: NZ_LYPH01000025_1_WP_010908558_1_1049_A8144_RS04995
position 1: T:0.17692 C:0.21538 A:0.22308 G:0.38462
position 2: T:0.31538 C:0.23846 A:0.29231 G:0.15385
position 3: T:0.16923 C:0.30769 A:0.16154 G:0.36154
Average T:0.22051 C:0.25385 A:0.22564 G:0.30000
#5: NZ_CP029543_1_WP_010908558_1_1970_DIJ64_RS10030
position 1: T:0.17692 C:0.21538 A:0.22308 G:0.38462
position 2: T:0.31538 C:0.23846 A:0.29231 G:0.15385
position 3: T:0.16923 C:0.30769 A:0.16154 G:0.36154
Average T:0.22051 C:0.25385 A:0.22564 G:0.30000
#6: NZ_AP014567_1_WP_010908558_1_2019_JK2ML_RS10275
position 1: T:0.17692 C:0.21538 A:0.22308 G:0.38462
position 2: T:0.31538 C:0.23846 A:0.29231 G:0.15385
position 3: T:0.16923 C:0.30769 A:0.16154 G:0.36154
Average T:0.22051 C:0.25385 A:0.22564 G:0.30000
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 0
TTC 12 | TCC 18 | TAC 0 | TGC 6
Leu L TTA 18 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 12 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 12
CTC 0 | CCC 6 | CAC 18 | CGC 0
CTA 0 | CCA 12 | Gln Q CAA 18 | CGA 12
CTG 18 | CCG 24 | CAG 24 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 6 | Asn N AAT 6 | Ser S AGT 6
ATC 24 | ACC 12 | AAC 30 | AGC 0
ATA 0 | ACA 0 | Lys K AAA 6 | Arg R AGA 6
Met M ATG 12 | ACG 18 | AAG 30 | AGG 12
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 18 | Asp D GAT 24 | Gly G GGT 6
GTC 48 | GCC 24 | GAC 30 | GGC 12
GTA 6 | GCA 12 | Glu E GAA 30 | GGA 6
GTG 48 | GCG 18 | GAG 0 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.17692 C:0.21538 A:0.22308 G:0.38462
position 2: T:0.31538 C:0.23846 A:0.29231 G:0.15385
position 3: T:0.16923 C:0.30769 A:0.16154 G:0.36154
Average T:0.22051 C:0.25385 A:0.22564 G:0.30000
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -518.213573 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908558_1_1941_MLBR_RS09210: 0.000004, NC_002677_1_NP_302237_1_1109_trxB: 0.000004, NZ_LVXE01000020_1_WP_010908558_1_893_A3216_RS07335: 0.000004, NZ_LYPH01000025_1_WP_010908558_1_1049_A8144_RS04995: 0.000004, NZ_CP029543_1_WP_010908558_1_1970_DIJ64_RS10030: 0.000004, NZ_AP014567_1_WP_010908558_1_2019_JK2ML_RS10275: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 311.6 78.4 0.0001 0.0000 0.0000 0.0 0.0
7..2 0.000 311.6 78.4 0.0001 0.0000 0.0000 0.0 0.0
7..3 0.000 311.6 78.4 0.0001 0.0000 0.0000 0.0 0.0
7..4 0.000 311.6 78.4 0.0001 0.0000 0.0000 0.0 0.0
7..5 0.000 311.6 78.4 0.0001 0.0000 0.0000 0.0 0.0
7..6 0.000 311.6 78.4 0.0001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -518.213573 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908558_1_1941_MLBR_RS09210: 0.000004, NC_002677_1_NP_302237_1_1109_trxB: 0.000004, NZ_LVXE01000020_1_WP_010908558_1_893_A3216_RS07335: 0.000004, NZ_LYPH01000025_1_WP_010908558_1_1049_A8144_RS04995: 0.000004, NZ_CP029543_1_WP_010908558_1_1970_DIJ64_RS10030: 0.000004, NZ_AP014567_1_WP_010908558_1_2019_JK2ML_RS10275: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 311.6 78.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 311.6 78.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 311.6 78.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 311.6 78.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 311.6 78.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 311.6 78.4 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -518.213734 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.616543 0.287444 0.000001 1.348797
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908558_1_1941_MLBR_RS09210: 0.000004, NC_002677_1_NP_302237_1_1109_trxB: 0.000004, NZ_LVXE01000020_1_WP_010908558_1_893_A3216_RS07335: 0.000004, NZ_LYPH01000025_1_WP_010908558_1_1049_A8144_RS04995: 0.000004, NZ_CP029543_1_WP_010908558_1_1970_DIJ64_RS10030: 0.000004, NZ_AP014567_1_WP_010908558_1_2019_JK2ML_RS10275: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.61654 0.28744 0.09601
w: 0.00000 1.00000 1.34880
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 311.6 78.4 0.4169 0.0000 0.0000 0.0 0.0
7..2 0.000 311.6 78.4 0.4169 0.0000 0.0000 0.0 0.0
7..3 0.000 311.6 78.4 0.4169 0.0000 0.0000 0.0 0.0
7..4 0.000 311.6 78.4 0.4169 0.0000 0.0000 0.0 0.0
7..5 0.000 311.6 78.4 0.4169 0.0000 0.0000 0.0 0.0
7..6 0.000 311.6 78.4 0.4169 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908558_1_1941_MLBR_RS09210)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908558_1_1941_MLBR_RS09210)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -518.213573 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.516587
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908558_1_1941_MLBR_RS09210: 0.000004, NC_002677_1_NP_302237_1_1109_trxB: 0.000004, NZ_LVXE01000020_1_WP_010908558_1_893_A3216_RS07335: 0.000004, NZ_LYPH01000025_1_WP_010908558_1_1049_A8144_RS04995: 0.000004, NZ_CP029543_1_WP_010908558_1_1970_DIJ64_RS10030: 0.000004, NZ_AP014567_1_WP_010908558_1_2019_JK2ML_RS10275: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.51659
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 311.6 78.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 311.6 78.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 311.6 78.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 311.6 78.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 311.6 78.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 311.6 78.4 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:05
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -518.213573 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.774140 2.521814
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908558_1_1941_MLBR_RS09210: 0.000004, NC_002677_1_NP_302237_1_1109_trxB: 0.000004, NZ_LVXE01000020_1_WP_010908558_1_893_A3216_RS07335: 0.000004, NZ_LYPH01000025_1_WP_010908558_1_1049_A8144_RS04995: 0.000004, NZ_CP029543_1_WP_010908558_1_1970_DIJ64_RS10030: 0.000004, NZ_AP014567_1_WP_010908558_1_2019_JK2ML_RS10275: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.77414
(p1 = 0.00001) w = 2.52181
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 2.52181
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 311.6 78.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 311.6 78.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 311.6 78.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 311.6 78.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 311.6 78.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 311.6 78.4 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908558_1_1941_MLBR_RS09210)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.097 0.098 0.098 0.099 0.100 0.100 0.101 0.102 0.102 0.103
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Time used: 0:10
Model 1: NearlyNeutral -518.213573 Model 2: PositiveSelection -518.213734 Model 0: one-ratio -518.213573 Model 7: beta -518.213573 Model 8: beta&w>1 -518.213573 Model 0 vs 1 0.0 Model 2 vs 1 3.2200000009652285E-4 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
