--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:44:06 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/trxB/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -539.37          -543.38
2       -539.37          -543.07
--------------------------------------
TOTAL     -539.37          -543.24
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.894584    0.091191    0.348881    1.486362    0.856159   1501.00   1501.00    1.000
r(A<->C){all}   0.166035    0.019279    0.000056    0.448688    0.134071    337.56    358.82    1.005
r(A<->G){all}   0.165238    0.021269    0.000010    0.465043    0.122750    177.69    206.06    1.000
r(A<->T){all}   0.165159    0.019206    0.000066    0.449068    0.128394    121.92    172.44    1.002
r(C<->G){all}   0.162675    0.020394    0.000117    0.457370    0.120537     78.44     87.36    1.000
r(C<->T){all}   0.173331    0.022342    0.000076    0.473259    0.130754    242.29    245.46    1.000
r(G<->T){all}   0.167561    0.019319    0.000065    0.456349    0.129856    213.78    234.94    1.000
pi(A){all}      0.225661    0.000436    0.183494    0.266444    0.224755   1239.35   1346.76    1.001
pi(C){all}      0.253526    0.000493    0.208006    0.295116    0.253253    966.07   1133.60    1.000
pi(G){all}      0.299722    0.000513    0.256436    0.343357    0.299581   1171.60   1233.01    1.001
pi(T){all}      0.221091    0.000413    0.183818    0.263757    0.220078   1134.13   1317.57    1.000
alpha{1,2}      0.418170    0.222718    0.000134    1.395940    0.254997    991.51   1246.26    1.000
alpha{3}        0.447122    0.222128    0.000290    1.370687    0.306475   1501.00   1501.00    1.000
pinvar{all}     0.995801    0.000024    0.986348    0.999998    0.997394   1248.14   1333.49    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-518.213573
Model 2: PositiveSelection	-518.213734
Model 0: one-ratio	-518.213573
Model 7: beta	-518.213573
Model 8: beta&w>1	-518.213573


Model 0 vs 1	0.0

Model 2 vs 1	3.2200000009652285E-4

Model 8 vs 7	0.0
>C1
MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
>C2
MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
>C3
MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
>C4
MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
>C5
MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
>C6
MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=130 

C1              MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
C2              MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
C3              MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
C4              MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
C5              MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
C6              MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
                **************************************************

C1              FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
C2              FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
C3              FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
C4              FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
C5              FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
C6              FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
                **************************************************

C1              DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
C2              DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
C3              DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
C4              DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
C5              DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
C6              DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
                ******************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [3900]--->[3900]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.462 Mb, Max= 30.660 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
C2              MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
C3              MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
C4              MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
C5              MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
C6              MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
                **************************************************

C1              FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
C2              FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
C3              FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
C4              FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
C5              FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
C6              FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
                **************************************************

C1              DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
C2              DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
C3              DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
C4              DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
C5              DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
C6              DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
                ******************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT
C2              ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT
C3              ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT
C4              ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT
C5              ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT
C6              ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT
                **************************************************

C1              TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG
C2              TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG
C3              TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG
C4              TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG
C5              TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG
C6              TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG
                **************************************************

C1              TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG
C2              TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG
C3              TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG
C4              TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG
C5              TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG
C6              TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG
                **************************************************

C1              TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA
C2              TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA
C3              TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA
C4              TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA
C5              TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA
C6              TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA
                **************************************************

C1              CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC
C2              CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC
C3              CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC
C4              CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC
C5              CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC
C6              CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC
                **************************************************

C1              CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG
C2              CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG
C3              CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG
C4              CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG
C5              CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG
C6              CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG
                **************************************************

C1              GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT
C2              GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT
C3              GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT
C4              GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT
C5              GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT
C6              GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT
                **************************************************

C1              CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC
C2              CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC
C3              CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC
C4              CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC
C5              CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC
C6              CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC
                ****************************************



>C1
ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT
TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG
TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG
TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA
CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC
CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG
GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT
CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC
>C2
ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT
TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG
TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG
TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA
CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC
CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG
GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT
CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC
>C3
ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT
TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG
TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG
TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA
CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC
CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG
GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT
CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC
>C4
ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT
TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG
TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG
TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA
CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC
CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG
GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT
CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC
>C5
ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT
TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG
TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG
TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA
CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC
CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG
GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT
CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC
>C6
ATGGTCCGGGAACATGGCGTCGGTGTGCGACGTTGGACTAGACGTGACCT
TATTGCTGAACAGTTAAACGAAACCATCAACGTCAACAACATGGTGCTTG
TCGCCTTTTGGGCGTCCTGGTGCGGACCAGATCGATTGTTTGTGCCGACG
TTTCACGCGTCGTCGAATAAGCACTCTGATGTCGTGCACTTAAACGTAGA
CACCAAAGCCGAAAGGCAACTGGCATTAGCAGCTCAGATCAGGTCCATCC
CCACGTTGGTGGCCTTCAAGAAGGGCAAGCCGCTGTTGAGTCAGGCTGGG
GATCTGACGCCGGCGGTGCCGGGGTATTTGGTGCAACAAATCAAGGCCTT
CGACGTCTCCGACGATGGGGTCGTGCCAGACGAACAGGTC
>C1
MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
>C2
MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
>C3
MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
>C4
MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
>C5
MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV
>C6
MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPT
FHASSNKHSDVVHLNVDTKAERQLALAAQIRSIPTLVAFKKGKPLLSQAG
DLTPAVPGYLVQQIKAFDVSDDGVVPDEQV


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 390 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579790574
      Setting output file names to "/data/12res/trxB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 164527930
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0861762785
      Seed = 944376866
      Swapseed = 1579790574
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -872.838646 -- -24.965149
         Chain 2 -- -872.838563 -- -24.965149
         Chain 3 -- -872.838646 -- -24.965149
         Chain 4 -- -872.838646 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -872.838646 -- -24.965149
         Chain 2 -- -872.838696 -- -24.965149
         Chain 3 -- -872.838696 -- -24.965149
         Chain 4 -- -872.838646 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-872.839] (-872.839) (-872.839) (-872.839) * [-872.839] (-872.839) (-872.839) (-872.839) 
        500 -- (-548.162) [-546.686] (-549.820) (-547.192) * (-549.716) [-549.568] (-547.068) (-549.496) -- 0:00:00
       1000 -- (-546.332) (-554.122) [-545.864] (-549.255) * (-546.195) (-550.600) (-549.033) [-551.236] -- 0:00:00
       1500 -- [-546.089] (-549.850) (-553.915) (-543.884) * (-544.974) [-546.228] (-547.273) (-548.276) -- 0:00:00
       2000 -- (-546.965) (-552.769) (-546.932) [-548.310] * (-547.520) [-545.797] (-553.219) (-549.097) -- 0:00:00
       2500 -- (-549.441) (-554.193) [-545.740] (-552.012) * (-548.330) (-548.012) (-554.284) [-546.989] -- 0:00:00
       3000 -- (-547.342) [-545.705] (-551.295) (-552.658) * (-546.532) [-549.839] (-549.291) (-550.997) -- 0:00:00
       3500 -- [-551.259] (-543.929) (-545.480) (-550.221) * (-547.147) [-548.212] (-548.125) (-550.767) -- 0:00:00
       4000 -- (-543.974) [-552.420] (-547.114) (-558.594) * [-557.102] (-550.964) (-552.591) (-558.391) -- 0:00:00
       4500 -- (-549.011) (-547.588) (-550.093) [-549.687] * (-550.963) [-546.199] (-548.880) (-549.053) -- 0:00:00
       5000 -- (-550.729) (-549.166) (-551.197) [-545.145] * (-545.766) [-542.744] (-560.482) (-547.235) -- 0:00:00

      Average standard deviation of split frequencies: 0.104757

       5500 -- (-555.917) (-548.546) [-548.808] (-553.471) * (-552.769) [-548.551] (-554.985) (-549.501) -- 0:00:00
       6000 -- (-548.030) (-546.040) (-547.783) [-551.775] * [-546.824] (-547.192) (-544.656) (-545.263) -- 0:00:00
       6500 -- (-554.539) (-549.346) (-547.732) [-548.196] * (-549.281) (-549.914) (-541.421) [-548.988] -- 0:00:00
       7000 -- (-553.947) (-548.943) (-554.975) [-548.809] * [-547.349] (-549.120) (-540.303) (-549.451) -- 0:00:00
       7500 -- (-550.798) [-551.353] (-550.274) (-552.541) * (-549.638) [-555.288] (-538.045) (-549.347) -- 0:00:00
       8000 -- (-548.652) (-553.428) [-544.336] (-543.817) * (-545.722) [-548.212] (-539.217) (-554.405) -- 0:00:00
       8500 -- [-550.175] (-557.188) (-549.062) (-549.212) * [-549.724] (-555.569) (-540.920) (-561.315) -- 0:00:00
       9000 -- (-547.199) (-547.229) [-550.331] (-557.091) * (-551.404) (-550.285) [-540.465] (-555.408) -- 0:00:00
       9500 -- (-547.025) (-551.426) [-550.485] (-547.281) * (-552.502) (-547.855) (-540.724) [-543.071] -- 0:00:00
      10000 -- (-552.012) (-545.931) (-557.991) [-554.144] * (-549.505) (-548.727) (-540.693) [-553.191] -- 0:00:00

      Average standard deviation of split frequencies: 0.076335

      10500 -- (-556.361) (-551.324) (-550.705) [-551.964] * [-548.848] (-544.625) (-541.211) (-544.666) -- 0:00:00
      11000 -- [-545.422] (-548.964) (-548.532) (-556.943) * (-551.896) [-547.448] (-540.826) (-554.537) -- 0:00:00
      11500 -- [-547.572] (-551.387) (-546.550) (-552.358) * (-554.724) [-548.644] (-539.760) (-554.214) -- 0:00:00
      12000 -- (-553.989) (-558.163) [-553.579] (-540.769) * (-546.624) [-546.572] (-539.118) (-563.842) -- 0:00:00
      12500 -- (-550.513) [-555.219] (-546.569) (-539.320) * (-550.679) (-546.206) [-540.593] (-551.714) -- 0:00:00
      13000 -- (-557.052) (-547.705) [-549.329] (-540.215) * (-557.040) (-550.380) [-540.434] (-558.375) -- 0:00:00
      13500 -- (-554.482) (-549.210) [-551.695] (-541.093) * (-547.375) (-548.725) [-539.024] (-557.631) -- 0:00:00
      14000 -- (-556.280) [-552.673] (-549.000) (-543.159) * (-546.470) (-547.881) [-546.927] (-553.650) -- 0:01:10
      14500 -- (-553.814) (-542.473) (-549.776) [-538.225] * (-545.644) (-549.043) [-540.184] (-555.102) -- 0:01:07
      15000 -- (-547.936) [-551.586] (-546.788) (-539.541) * [-547.472] (-545.670) (-538.173) (-542.264) -- 0:01:05

      Average standard deviation of split frequencies: 0.051993

      15500 -- (-546.455) (-552.974) (-551.043) [-539.731] * [-557.219] (-545.063) (-545.920) (-540.601) -- 0:01:03
      16000 -- (-541.021) (-551.931) [-547.657] (-539.228) * (-552.112) (-544.966) (-540.688) [-538.921] -- 0:01:01
      16500 -- (-543.921) (-546.602) (-545.998) [-542.206] * (-546.439) [-549.615] (-539.515) (-539.813) -- 0:00:59
      17000 -- [-540.346] (-549.670) (-552.882) (-543.321) * [-545.907] (-549.191) (-539.111) (-540.292) -- 0:00:57
      17500 -- [-538.820] (-546.861) (-545.944) (-540.852) * (-548.132) [-543.095] (-540.947) (-540.450) -- 0:00:56
      18000 -- (-539.788) (-554.182) (-554.620) [-539.338] * (-550.672) [-548.385] (-538.286) (-543.547) -- 0:00:54
      18500 -- (-542.239) [-554.977] (-551.691) (-539.114) * (-550.492) [-546.500] (-538.404) (-538.228) -- 0:00:53
      19000 -- (-539.082) (-549.702) (-555.472) [-539.076] * [-546.405] (-557.178) (-542.124) (-540.886) -- 0:00:51
      19500 -- [-539.846] (-545.048) (-547.545) (-540.182) * (-548.635) (-544.702) [-540.987] (-542.350) -- 0:00:50
      20000 -- [-538.609] (-548.568) (-549.291) (-539.127) * (-551.526) (-574.634) [-539.780] (-540.029) -- 0:00:49

      Average standard deviation of split frequencies: 0.047140

      20500 -- (-541.384) [-545.212] (-563.123) (-538.669) * (-550.205) (-540.927) (-539.210) [-539.561] -- 0:00:47
      21000 -- [-541.008] (-554.030) (-548.430) (-538.430) * [-550.344] (-542.113) (-540.224) (-538.802) -- 0:00:46
      21500 -- (-537.994) [-549.688] (-543.491) (-543.264) * (-553.525) (-540.568) [-538.672] (-544.869) -- 0:00:45
      22000 -- (-543.303) [-546.032] (-541.349) (-540.858) * [-553.439] (-540.147) (-538.078) (-540.023) -- 0:00:44
      22500 -- (-539.590) [-549.478] (-540.676) (-540.359) * (-554.667) [-543.742] (-539.674) (-539.607) -- 0:00:43
      23000 -- [-539.230] (-546.715) (-540.479) (-540.388) * [-542.715] (-539.453) (-541.444) (-539.097) -- 0:00:42
      23500 -- (-538.907) [-547.353] (-538.052) (-539.589) * (-546.713) (-540.680) [-539.077] (-538.366) -- 0:00:41
      24000 -- (-539.779) (-552.022) (-539.410) [-538.346] * (-557.302) [-540.944] (-538.964) (-538.918) -- 0:00:40
      24500 -- (-540.297) (-552.003) [-539.121] (-540.196) * [-551.386] (-540.441) (-543.188) (-539.244) -- 0:00:39
      25000 -- (-538.386) (-551.607) [-540.788] (-539.666) * (-548.225) [-542.583] (-541.726) (-544.076) -- 0:00:39

      Average standard deviation of split frequencies: 0.037086

      25500 -- (-540.450) [-551.646] (-539.591) (-542.161) * [-548.637] (-541.557) (-541.475) (-541.777) -- 0:00:38
      26000 -- (-539.183) (-552.540) [-540.414] (-540.429) * (-552.866) (-539.267) [-539.261] (-541.154) -- 0:00:37
      26500 -- (-539.303) [-547.716] (-539.534) (-542.200) * (-548.223) (-538.457) (-539.396) [-539.485] -- 0:00:36
      27000 -- (-541.038) (-548.789) (-538.510) [-541.552] * (-547.214) (-541.274) (-541.631) [-538.679] -- 0:00:36
      27500 -- (-543.722) (-554.116) [-538.591] (-539.067) * (-550.746) (-540.640) [-539.496] (-538.733) -- 0:00:35
      28000 -- (-543.482) (-555.932) [-540.292] (-538.296) * (-551.133) (-539.331) [-538.944] (-539.282) -- 0:00:34
      28500 -- (-538.898) (-552.435) (-539.613) [-538.773] * (-552.240) [-538.170] (-542.653) (-540.732) -- 0:00:34
      29000 -- (-538.607) (-550.390) (-538.799) [-542.929] * (-556.704) (-539.561) (-539.890) [-540.683] -- 0:00:33
      29500 -- (-539.917) [-546.557] (-541.301) (-539.704) * (-545.746) (-538.871) (-539.991) [-539.894] -- 0:01:05
      30000 -- [-538.676] (-553.119) (-539.924) (-542.813) * (-551.444) (-538.738) (-538.865) [-539.768] -- 0:01:04

      Average standard deviation of split frequencies: 0.032281

      30500 -- (-542.387) [-545.905] (-538.283) (-539.729) * [-551.083] (-539.873) (-539.021) (-540.430) -- 0:01:03
      31000 -- (-539.397) [-552.706] (-541.624) (-546.199) * (-544.472) (-539.601) (-541.070) [-544.452] -- 0:01:02
      31500 -- (-540.443) (-553.168) (-541.419) [-541.907] * (-549.588) [-538.758] (-542.582) (-539.625) -- 0:01:01
      32000 -- (-538.275) [-557.025] (-541.565) (-538.421) * (-548.254) (-541.027) [-541.557] (-539.158) -- 0:01:00
      32500 -- (-539.269) (-561.330) [-538.927] (-539.784) * (-554.422) (-543.570) [-539.294] (-539.092) -- 0:00:59
      33000 -- [-539.105] (-542.023) (-539.309) (-538.813) * [-543.394] (-543.125) (-540.194) (-539.949) -- 0:00:58
      33500 -- (-538.921) (-538.754) (-538.325) [-539.556] * (-555.268) (-542.498) [-540.516] (-538.596) -- 0:00:57
      34000 -- (-539.434) (-540.864) (-542.963) [-539.045] * (-548.387) (-541.511) [-541.139] (-543.500) -- 0:00:56
      34500 -- (-540.555) (-539.976) (-543.017) [-540.089] * (-551.957) [-539.348] (-540.714) (-539.387) -- 0:00:55
      35000 -- (-539.184) [-539.005] (-542.404) (-546.119) * (-549.375) (-539.362) [-540.342] (-543.114) -- 0:00:55

      Average standard deviation of split frequencies: 0.033081

      35500 -- (-538.336) (-540.749) [-539.903] (-545.032) * [-550.075] (-540.520) (-538.648) (-539.502) -- 0:00:54
      36000 -- [-539.033] (-539.608) (-539.752) (-542.474) * (-551.953) (-542.757) [-538.731] (-538.615) -- 0:00:53
      36500 -- (-540.107) (-539.257) [-540.218] (-540.632) * (-553.774) (-542.479) (-543.000) [-538.609] -- 0:00:52
      37000 -- [-538.939] (-539.276) (-539.096) (-539.876) * [-540.744] (-538.725) (-543.065) (-539.073) -- 0:00:52
      37500 -- (-539.653) (-539.207) (-538.156) [-538.429] * (-538.224) (-538.194) (-539.296) [-539.000] -- 0:00:51
      38000 -- (-539.621) (-539.101) [-538.690] (-542.771) * (-540.497) (-539.021) (-540.784) [-538.689] -- 0:00:50
      38500 -- (-544.043) (-538.259) (-538.939) [-541.989] * (-541.187) (-538.256) [-539.402] (-538.434) -- 0:00:49
      39000 -- (-541.057) (-541.541) [-538.192] (-537.776) * (-540.262) [-539.056] (-540.046) (-538.694) -- 0:00:49
      39500 -- [-540.214] (-540.063) (-539.080) (-541.383) * (-546.525) (-542.883) (-541.895) [-539.439] -- 0:00:48
      40000 -- [-540.067] (-539.255) (-538.590) (-543.588) * (-539.681) [-542.981] (-541.934) (-540.485) -- 0:00:48

      Average standard deviation of split frequencies: 0.034776

      40500 -- [-539.291] (-538.863) (-539.670) (-538.946) * [-539.942] (-544.178) (-539.164) (-540.667) -- 0:00:47
      41000 -- (-541.125) [-538.229] (-543.181) (-539.705) * (-541.510) (-547.345) (-539.887) [-539.353] -- 0:00:46
      41500 -- [-539.785] (-538.462) (-538.728) (-538.501) * (-538.555) (-543.207) (-540.577) [-541.927] -- 0:00:46
      42000 -- (-538.050) (-538.441) (-541.771) [-539.865] * (-540.923) (-544.425) [-540.484] (-543.090) -- 0:00:45
      42500 -- [-538.993] (-540.961) (-544.417) (-542.211) * (-543.466) [-543.196] (-540.273) (-541.775) -- 0:00:45
      43000 -- (-539.292) [-539.756] (-543.677) (-539.509) * [-542.700] (-538.922) (-542.014) (-539.781) -- 0:00:44
      43500 -- (-542.926) (-538.199) (-539.856) [-538.518] * (-540.740) [-539.743] (-538.218) (-539.395) -- 0:00:43
      44000 -- (-540.046) [-538.247] (-539.727) (-540.072) * (-542.429) (-541.740) (-538.655) [-541.434] -- 0:00:43
      44500 -- [-538.279] (-538.300) (-538.922) (-538.937) * (-539.117) (-542.753) [-539.063] (-543.266) -- 0:00:42
      45000 -- (-538.506) (-538.557) [-538.172] (-539.005) * (-539.065) (-539.300) (-538.377) [-538.612] -- 0:00:42

      Average standard deviation of split frequencies: 0.031720

      45500 -- (-543.577) [-539.430] (-539.744) (-540.791) * (-541.275) [-537.941] (-539.371) (-539.012) -- 0:00:41
      46000 -- (-540.235) [-538.565] (-540.717) (-539.785) * (-538.955) [-538.602] (-538.051) (-540.000) -- 0:01:02
      46500 -- (-542.417) [-539.370] (-541.764) (-542.893) * (-539.643) (-538.825) [-538.572] (-539.836) -- 0:01:01
      47000 -- (-543.507) (-539.079) (-543.199) [-538.274] * (-543.911) [-538.623] (-538.319) (-539.378) -- 0:01:00
      47500 -- (-541.732) (-538.859) (-542.972) [-538.965] * [-538.592] (-538.120) (-540.535) (-540.848) -- 0:01:00
      48000 -- (-538.718) (-537.895) (-539.544) [-539.354] * (-539.793) [-538.119] (-538.463) (-542.957) -- 0:00:59
      48500 -- (-540.401) (-539.087) [-540.871] (-541.617) * (-539.684) (-538.358) (-539.493) [-543.061] -- 0:00:58
      49000 -- (-546.298) [-539.233] (-541.018) (-539.439) * (-539.755) (-539.905) [-538.814] (-538.135) -- 0:00:58
      49500 -- (-546.134) [-538.991] (-539.343) (-539.736) * (-539.771) [-541.822] (-541.412) (-538.856) -- 0:00:57
      50000 -- (-541.148) (-540.972) [-540.020] (-540.421) * [-538.541] (-543.481) (-542.589) (-538.563) -- 0:00:57

      Average standard deviation of split frequencies: 0.030570

      50500 -- (-539.605) [-537.863] (-544.258) (-539.239) * [-540.056] (-539.470) (-538.383) (-538.850) -- 0:00:56
      51000 -- (-540.595) (-539.110) (-541.016) [-541.210] * [-540.119] (-538.713) (-539.186) (-538.539) -- 0:00:55
      51500 -- [-540.333] (-538.034) (-539.216) (-542.634) * (-539.859) (-540.100) [-543.934] (-537.748) -- 0:00:55
      52000 -- [-539.001] (-540.800) (-537.741) (-539.681) * (-538.806) [-539.881] (-542.099) (-538.233) -- 0:00:54
      52500 -- (-539.008) [-539.199] (-539.118) (-539.053) * (-538.406) (-539.549) (-539.745) [-541.838] -- 0:00:54
      53000 -- (-539.685) [-538.774] (-539.079) (-539.558) * (-539.639) (-543.414) (-539.244) [-539.003] -- 0:00:53
      53500 -- [-542.273] (-544.936) (-539.960) (-538.495) * (-540.399) (-541.746) [-539.149] (-539.075) -- 0:00:53
      54000 -- (-540.341) [-539.623] (-539.981) (-540.974) * (-542.392) (-542.294) [-539.371] (-540.889) -- 0:00:52
      54500 -- (-541.680) [-541.665] (-544.358) (-541.759) * [-538.420] (-544.457) (-539.833) (-539.147) -- 0:00:52
      55000 -- (-540.196) (-541.356) (-541.335) [-547.612] * (-538.872) [-544.760] (-539.370) (-540.572) -- 0:00:51

      Average standard deviation of split frequencies: 0.029042

      55500 -- (-543.260) [-539.846] (-542.446) (-541.201) * (-542.324) [-543.629] (-546.212) (-540.968) -- 0:00:51
      56000 -- (-539.835) (-540.081) (-544.010) [-540.558] * (-541.569) (-539.485) [-539.389] (-539.388) -- 0:00:50
      56500 -- (-538.872) [-540.291] (-541.798) (-541.627) * (-542.061) (-538.047) (-539.764) [-539.416] -- 0:00:50
      57000 -- (-539.142) (-539.209) [-538.079] (-539.102) * (-540.672) [-537.989] (-540.160) (-540.385) -- 0:00:49
      57500 -- (-538.773) [-538.728] (-542.054) (-541.020) * (-542.945) [-539.116] (-540.661) (-539.568) -- 0:00:49
      58000 -- (-538.932) (-540.367) [-540.215] (-540.215) * (-540.164) [-539.351] (-541.884) (-544.435) -- 0:00:48
      58500 -- (-538.492) (-539.473) [-539.121] (-543.227) * (-538.384) (-539.954) [-540.187] (-542.109) -- 0:00:48
      59000 -- (-543.763) (-542.058) [-542.654] (-542.548) * [-539.376] (-542.574) (-540.117) (-541.625) -- 0:00:47
      59500 -- (-541.865) (-537.944) [-540.872] (-548.494) * [-537.924] (-539.377) (-540.869) (-540.381) -- 0:00:47
      60000 -- (-539.292) [-540.355] (-537.986) (-548.865) * (-537.816) (-539.238) [-538.113] (-540.147) -- 0:00:47

      Average standard deviation of split frequencies: 0.026808

      60500 -- [-541.634] (-544.194) (-538.923) (-543.405) * (-539.469) [-539.252] (-539.213) (-539.016) -- 0:00:46
      61000 -- (-542.616) (-539.301) (-542.302) [-539.099] * (-543.444) [-538.957] (-538.901) (-539.896) -- 0:00:46
      61500 -- (-541.022) (-538.926) (-539.419) [-538.994] * [-541.088] (-540.749) (-540.728) (-538.337) -- 0:00:45
      62000 -- (-541.846) (-539.330) [-538.807] (-540.577) * (-541.978) (-539.096) [-539.525] (-541.672) -- 0:00:45
      62500 -- (-538.538) (-539.425) (-539.887) [-538.800] * (-542.248) (-541.518) (-540.962) [-538.813] -- 0:01:00
      63000 -- (-539.805) (-538.619) (-538.037) [-538.445] * (-542.787) [-543.347] (-539.623) (-538.337) -- 0:00:59
      63500 -- (-541.886) (-539.571) [-538.125] (-538.979) * (-540.851) [-539.983] (-539.422) (-539.370) -- 0:00:58
      64000 -- (-540.336) (-539.218) [-541.067] (-539.824) * (-540.217) (-539.228) (-539.074) [-539.910] -- 0:00:58
      64500 -- (-539.149) (-539.921) [-539.494] (-539.784) * (-541.904) (-539.961) [-538.241] (-538.504) -- 0:00:58
      65000 -- (-538.492) (-540.508) [-540.281] (-539.680) * (-539.976) [-538.185] (-538.328) (-538.271) -- 0:00:57

      Average standard deviation of split frequencies: 0.025849

      65500 -- (-538.949) (-539.435) (-538.952) [-540.010] * [-538.595] (-538.049) (-540.795) (-539.126) -- 0:00:57
      66000 -- [-538.536] (-541.983) (-538.090) (-541.919) * (-541.005) [-540.446] (-542.188) (-538.985) -- 0:00:56
      66500 -- (-537.907) (-539.070) (-540.437) [-539.103] * [-542.139] (-538.817) (-539.508) (-539.525) -- 0:00:56
      67000 -- (-538.617) (-539.083) [-542.655] (-544.549) * (-544.214) (-540.640) [-539.255] (-539.448) -- 0:00:55
      67500 -- (-542.618) [-540.401] (-545.001) (-541.364) * [-538.377] (-540.827) (-539.010) (-540.005) -- 0:00:55
      68000 -- (-541.329) (-537.960) [-540.581] (-539.802) * (-539.938) (-538.402) (-538.759) [-538.378] -- 0:00:54
      68500 -- (-542.481) (-541.628) (-541.234) [-540.243] * (-541.192) [-539.945] (-539.319) (-539.724) -- 0:00:54
      69000 -- [-541.302] (-540.379) (-540.472) (-538.284) * (-538.094) [-539.802] (-544.370) (-539.361) -- 0:00:53
      69500 -- (-540.710) (-538.920) (-538.899) [-542.810] * (-540.596) [-538.671] (-538.867) (-538.371) -- 0:00:53
      70000 -- [-539.517] (-541.215) (-543.608) (-540.709) * (-538.586) (-543.723) [-539.017] (-539.152) -- 0:00:53

      Average standard deviation of split frequencies: 0.025413

      70500 -- (-540.126) (-539.950) (-540.520) [-540.986] * (-542.211) (-543.844) (-538.650) [-539.306] -- 0:00:52
      71000 -- (-542.648) [-539.958] (-540.819) (-539.248) * (-540.062) (-540.636) [-538.478] (-538.541) -- 0:00:52
      71500 -- (-539.489) (-538.331) (-540.332) [-540.479] * (-542.168) [-542.540] (-538.559) (-538.552) -- 0:00:51
      72000 -- (-538.538) (-541.766) [-540.009] (-538.647) * (-541.363) (-544.219) [-541.351] (-545.045) -- 0:00:51
      72500 -- (-542.793) (-542.404) [-540.633] (-539.300) * [-541.953] (-539.163) (-539.407) (-540.765) -- 0:00:51
      73000 -- (-541.637) (-539.332) (-538.712) [-538.875] * (-540.329) (-540.616) [-538.898] (-540.509) -- 0:00:50
      73500 -- (-539.573) [-538.396] (-542.346) (-542.619) * (-540.346) (-540.223) [-538.747] (-540.032) -- 0:00:50
      74000 -- [-540.429] (-540.135) (-542.407) (-540.406) * [-539.882] (-540.512) (-538.158) (-539.862) -- 0:00:50
      74500 -- (-542.294) (-541.255) (-540.908) [-542.258] * [-540.599] (-543.189) (-540.286) (-538.645) -- 0:00:49
      75000 -- (-540.494) [-540.711] (-538.391) (-540.665) * (-538.519) (-539.208) (-540.335) [-539.516] -- 0:00:49

      Average standard deviation of split frequencies: 0.025106

      75500 -- (-539.375) (-538.959) (-539.193) [-537.716] * (-538.764) (-539.184) [-539.275] (-541.151) -- 0:00:48
      76000 -- (-539.555) [-539.510] (-539.870) (-540.335) * (-539.290) (-541.278) [-544.084] (-541.093) -- 0:00:48
      76500 -- [-538.433] (-540.768) (-541.274) (-542.288) * [-538.373] (-539.365) (-539.062) (-539.842) -- 0:00:48
      77000 -- (-538.602) (-539.479) [-538.360] (-544.724) * (-540.109) (-540.050) [-540.625] (-539.692) -- 0:00:47
      77500 -- (-539.376) (-539.381) [-539.520] (-539.299) * (-546.159) [-539.232] (-539.430) (-539.535) -- 0:00:47
      78000 -- (-544.535) (-538.722) (-538.662) [-538.227] * (-539.667) (-539.788) (-538.792) [-542.855] -- 0:00:47
      78500 -- (-543.011) (-539.733) (-541.019) [-538.744] * [-537.820] (-539.584) (-540.993) (-542.884) -- 0:00:46
      79000 -- (-542.013) (-540.768) [-540.651] (-544.150) * (-540.078) (-540.263) (-543.576) [-538.501] -- 0:00:46
      79500 -- (-545.541) [-540.041] (-540.252) (-543.419) * [-539.018] (-539.264) (-543.640) (-538.691) -- 0:00:57
      80000 -- (-544.469) (-538.651) [-539.488] (-540.668) * (-540.190) (-539.429) [-539.343] (-541.430) -- 0:00:57

      Average standard deviation of split frequencies: 0.023375

      80500 -- [-540.997] (-538.369) (-539.387) (-539.998) * [-539.438] (-542.456) (-539.464) (-540.317) -- 0:00:57
      81000 -- (-546.424) [-539.901] (-540.166) (-540.606) * [-541.931] (-542.757) (-541.560) (-538.380) -- 0:00:56
      81500 -- (-539.890) (-538.459) (-540.878) [-541.388] * (-538.417) [-538.075] (-540.588) (-540.125) -- 0:00:56
      82000 -- [-540.565] (-543.247) (-541.406) (-542.430) * (-540.214) (-539.783) [-541.562] (-538.419) -- 0:00:55
      82500 -- (-540.366) (-541.030) [-540.553] (-540.343) * (-538.434) [-538.250] (-542.153) (-538.414) -- 0:00:55
      83000 -- (-541.899) (-540.022) [-539.855] (-538.993) * (-544.963) (-539.085) [-538.647] (-539.895) -- 0:00:55
      83500 -- (-538.412) [-539.177] (-539.196) (-538.735) * [-539.802] (-539.883) (-538.411) (-537.892) -- 0:00:54
      84000 -- (-538.499) (-545.629) [-539.074] (-543.485) * (-541.262) (-544.341) [-538.360] (-541.328) -- 0:00:54
      84500 -- (-538.577) [-542.960] (-538.857) (-540.732) * (-538.206) [-541.995] (-538.253) (-539.995) -- 0:00:54
      85000 -- (-539.301) (-545.865) (-541.921) [-540.841] * (-540.003) (-539.136) [-539.507] (-538.943) -- 0:00:53

      Average standard deviation of split frequencies: 0.023492

      85500 -- [-539.907] (-544.288) (-540.922) (-539.642) * (-538.165) [-539.176] (-539.796) (-538.682) -- 0:00:53
      86000 -- (-539.587) (-543.238) (-538.747) [-538.418] * [-538.671] (-540.741) (-540.255) (-538.412) -- 0:00:53
      86500 -- [-539.749] (-540.957) (-542.456) (-538.150) * [-539.552] (-546.472) (-545.050) (-539.372) -- 0:00:52
      87000 -- (-543.996) (-540.741) (-540.052) [-538.952] * (-538.908) [-541.000] (-543.210) (-544.626) -- 0:00:52
      87500 -- (-539.061) (-541.146) [-539.610] (-537.956) * [-539.651] (-539.689) (-539.217) (-539.521) -- 0:00:52
      88000 -- (-544.334) (-538.490) (-539.457) [-540.798] * [-540.785] (-544.051) (-545.969) (-540.027) -- 0:00:51
      88500 -- (-545.403) (-539.404) [-541.598] (-540.607) * [-538.331] (-537.819) (-545.795) (-539.778) -- 0:00:51
      89000 -- (-548.702) (-540.528) (-541.240) [-538.249] * (-544.563) (-548.894) [-540.902] (-540.232) -- 0:00:51
      89500 -- (-546.758) (-540.880) (-539.350) [-541.326] * [-540.166] (-549.165) (-543.764) (-541.765) -- 0:00:50
      90000 -- [-539.574] (-540.762) (-539.325) (-543.041) * (-538.944) [-538.010] (-538.649) (-538.877) -- 0:00:50

      Average standard deviation of split frequencies: 0.026776

      90500 -- [-538.353] (-543.762) (-539.141) (-540.312) * [-543.587] (-540.528) (-538.767) (-540.553) -- 0:00:50
      91000 -- (-538.682) (-539.113) (-540.829) [-541.426] * [-539.635] (-540.163) (-543.343) (-538.125) -- 0:00:49
      91500 -- [-539.644] (-539.040) (-543.365) (-543.227) * (-541.394) [-541.338] (-538.156) (-539.214) -- 0:00:49
      92000 -- (-538.177) (-539.136) [-538.213] (-544.780) * (-540.641) (-541.150) (-540.847) [-538.813] -- 0:00:49
      92500 -- (-538.867) [-539.596] (-539.471) (-542.551) * (-541.469) (-540.293) [-539.866] (-538.567) -- 0:00:49
      93000 -- (-540.260) (-542.832) (-539.460) [-547.067] * (-539.572) (-541.952) (-539.109) [-541.975] -- 0:00:48
      93500 -- (-542.704) (-537.868) (-547.222) [-544.509] * (-539.438) (-540.909) (-539.562) [-544.871] -- 0:00:48
      94000 -- (-539.677) (-539.856) (-539.540) [-539.028] * (-541.702) [-539.741] (-538.095) (-540.605) -- 0:00:48
      94500 -- (-541.275) (-541.419) (-542.513) [-540.280] * [-539.134] (-542.064) (-537.996) (-542.089) -- 0:00:47
      95000 -- (-544.525) (-538.960) [-542.444] (-538.330) * (-539.355) (-543.343) [-539.418] (-540.274) -- 0:00:47

      Average standard deviation of split frequencies: 0.025586

      95500 -- (-544.896) (-538.811) (-539.278) [-541.236] * [-538.526] (-539.149) (-539.459) (-539.739) -- 0:00:47
      96000 -- (-541.014) (-538.365) (-539.367) [-540.253] * (-545.740) (-538.796) [-539.747] (-539.483) -- 0:00:47
      96500 -- [-539.974] (-542.150) (-538.903) (-539.970) * [-539.100] (-540.280) (-540.990) (-541.106) -- 0:00:56
      97000 -- (-542.729) (-538.852) [-538.361] (-543.915) * (-539.500) [-539.322] (-538.845) (-541.297) -- 0:00:55
      97500 -- (-538.704) [-542.144] (-539.033) (-544.400) * [-539.240] (-539.634) (-539.860) (-541.846) -- 0:00:55
      98000 -- (-541.953) [-541.453] (-540.611) (-541.457) * (-541.468) (-540.350) [-540.780] (-541.299) -- 0:00:55
      98500 -- (-544.958) [-539.866] (-539.816) (-541.025) * (-540.682) (-539.839) [-542.289] (-543.957) -- 0:00:54
      99000 -- (-545.822) [-541.052] (-539.316) (-541.407) * (-541.354) (-540.772) (-542.922) [-537.991] -- 0:00:54
      99500 -- (-540.899) [-538.785] (-544.489) (-542.183) * [-540.649] (-538.920) (-538.172) (-540.602) -- 0:00:54
      100000 -- (-541.200) (-540.757) (-541.025) [-542.464] * (-540.925) (-538.826) (-540.569) [-540.408] -- 0:00:54

      Average standard deviation of split frequencies: 0.023934

      100500 -- (-542.900) (-540.252) (-542.291) [-542.604] * [-540.925] (-541.022) (-543.486) (-540.354) -- 0:00:53
      101000 -- [-540.332] (-541.829) (-541.016) (-539.954) * (-538.941) [-540.204] (-540.012) (-542.284) -- 0:00:53
      101500 -- [-539.280] (-549.002) (-540.112) (-541.780) * [-538.697] (-539.792) (-538.643) (-543.105) -- 0:00:53
      102000 -- (-538.751) (-539.758) (-540.261) [-539.570] * [-540.560] (-539.636) (-541.321) (-543.126) -- 0:00:52
      102500 -- (-540.573) (-538.688) (-539.189) [-542.320] * (-539.812) [-538.294] (-541.814) (-538.945) -- 0:00:52
      103000 -- (-541.029) [-539.320] (-539.602) (-539.554) * [-539.885] (-540.457) (-542.087) (-540.785) -- 0:00:52
      103500 -- (-542.975) [-541.552] (-538.942) (-540.983) * (-540.399) (-545.558) [-539.306] (-540.753) -- 0:00:51
      104000 -- (-539.595) (-539.052) (-541.258) [-539.094] * (-539.817) (-540.303) [-538.203] (-540.337) -- 0:00:51
      104500 -- [-540.373] (-541.892) (-540.197) (-538.460) * [-540.677] (-539.866) (-538.063) (-540.513) -- 0:00:51
      105000 -- (-539.481) (-540.300) (-539.979) [-538.775] * (-538.402) [-544.272] (-542.664) (-540.369) -- 0:00:51

      Average standard deviation of split frequencies: 0.022977

      105500 -- [-541.151] (-538.755) (-539.913) (-539.388) * [-537.844] (-546.075) (-539.411) (-539.315) -- 0:00:50
      106000 -- (-539.751) [-540.448] (-541.620) (-540.322) * (-540.011) [-542.778] (-543.086) (-543.079) -- 0:00:50
      106500 -- (-550.013) [-539.729] (-538.238) (-539.980) * (-543.110) [-543.827] (-539.494) (-539.872) -- 0:00:50
      107000 -- [-541.273] (-542.633) (-538.863) (-541.442) * [-540.359] (-539.771) (-538.205) (-540.555) -- 0:00:50
      107500 -- (-540.582) (-544.856) [-539.454] (-540.684) * [-539.581] (-539.090) (-540.776) (-538.680) -- 0:00:49
      108000 -- [-540.647] (-544.028) (-539.008) (-541.006) * (-540.860) (-539.179) (-542.323) [-537.794] -- 0:00:49
      108500 -- [-543.738] (-539.754) (-542.468) (-539.386) * [-541.289] (-538.468) (-542.509) (-538.159) -- 0:00:49
      109000 -- (-540.704) [-541.110] (-538.828) (-544.386) * (-538.301) (-539.590) (-540.159) [-539.872] -- 0:00:49
      109500 -- (-539.917) (-539.431) (-540.058) [-543.360] * (-546.160) (-538.802) (-541.473) [-538.568] -- 0:00:48
      110000 -- (-539.045) (-538.104) [-539.703] (-539.834) * (-542.639) [-540.248] (-543.645) (-539.676) -- 0:00:48

      Average standard deviation of split frequencies: 0.023192

      110500 -- (-541.178) [-540.426] (-542.129) (-539.453) * (-538.746) (-538.823) [-540.719] (-539.172) -- 0:00:48
      111000 -- (-540.307) [-541.781] (-538.636) (-538.485) * (-539.363) [-540.304] (-540.142) (-539.724) -- 0:00:48
      111500 -- (-543.366) (-538.970) (-538.669) [-538.967] * [-540.994] (-541.621) (-539.409) (-543.451) -- 0:00:47
      112000 -- [-542.257] (-539.200) (-541.341) (-540.618) * (-539.113) [-540.198] (-542.100) (-544.271) -- 0:00:47
      112500 -- (-539.949) (-540.601) (-540.397) [-538.099] * (-538.964) (-539.089) [-540.632] (-538.388) -- 0:00:47
      113000 -- (-539.129) [-539.311] (-539.577) (-539.446) * (-541.081) [-539.486] (-539.800) (-542.556) -- 0:00:54
      113500 -- (-540.043) [-539.946] (-539.970) (-542.799) * (-543.955) (-538.880) (-539.013) [-540.583] -- 0:00:54
      114000 -- (-541.809) (-540.024) (-538.405) [-541.394] * (-541.980) (-542.782) [-539.236] (-541.595) -- 0:00:54
      114500 -- (-542.229) (-542.501) [-541.680] (-538.983) * (-540.691) (-542.969) (-542.116) [-541.361] -- 0:00:54
      115000 -- (-538.986) (-539.234) (-545.109) [-540.452] * (-540.878) (-540.859) (-538.790) [-541.305] -- 0:00:53

      Average standard deviation of split frequencies: 0.022351

      115500 -- (-540.582) (-542.015) [-544.525] (-540.277) * (-541.913) (-540.313) (-538.680) [-539.432] -- 0:00:53
      116000 -- (-538.795) [-541.268] (-539.552) (-545.069) * [-539.806] (-540.220) (-538.891) (-542.190) -- 0:00:53
      116500 -- [-542.059] (-541.220) (-539.277) (-545.118) * [-541.937] (-540.083) (-542.038) (-541.147) -- 0:00:53
      117000 -- (-540.490) (-540.596) [-538.603] (-539.411) * (-539.601) (-538.851) [-541.499] (-542.238) -- 0:00:52
      117500 -- (-542.521) (-539.165) (-538.774) [-538.042] * [-539.958] (-542.561) (-542.843) (-539.371) -- 0:00:52
      118000 -- [-539.425] (-539.391) (-541.714) (-542.293) * [-539.853] (-540.228) (-538.661) (-540.534) -- 0:00:52
      118500 -- (-540.099) (-538.854) (-545.309) [-539.571] * [-540.404] (-539.574) (-539.663) (-540.736) -- 0:00:52
      119000 -- (-541.909) (-538.305) (-540.959) [-539.897] * (-537.848) [-538.371] (-538.966) (-539.029) -- 0:00:51
      119500 -- (-541.721) [-538.111] (-538.584) (-539.168) * (-538.804) [-541.816] (-539.039) (-539.343) -- 0:00:51
      120000 -- (-538.880) (-538.414) [-539.927] (-541.067) * (-539.453) (-537.939) (-539.070) [-538.537] -- 0:00:51

      Average standard deviation of split frequencies: 0.025176

      120500 -- (-539.283) (-540.478) [-538.795] (-540.016) * [-539.826] (-539.712) (-541.838) (-538.532) -- 0:00:51
      121000 -- [-545.034] (-540.001) (-539.426) (-540.522) * (-537.772) (-539.736) [-539.150] (-542.253) -- 0:00:50
      121500 -- [-542.905] (-540.907) (-542.842) (-543.871) * (-538.375) (-542.246) (-538.956) [-539.043] -- 0:00:50
      122000 -- (-540.478) [-541.264] (-539.766) (-537.983) * [-540.164] (-538.895) (-538.591) (-540.336) -- 0:00:50
      122500 -- (-541.859) (-541.574) [-538.982] (-538.322) * (-539.535) [-538.705] (-538.538) (-540.703) -- 0:00:50
      123000 -- (-542.378) [-542.454] (-540.229) (-541.070) * (-538.482) (-543.136) [-538.160] (-538.571) -- 0:00:49
      123500 -- (-541.860) (-547.092) (-538.364) [-540.379] * (-537.831) (-547.531) (-540.411) [-538.481] -- 0:00:49
      124000 -- (-540.647) [-539.763] (-538.699) (-539.492) * (-539.065) (-543.564) [-539.495] (-539.867) -- 0:00:49
      124500 -- (-540.085) (-539.965) [-540.191] (-542.929) * (-538.827) (-542.122) (-538.523) [-538.692] -- 0:00:49
      125000 -- (-540.123) [-540.283] (-541.893) (-541.299) * (-540.275) (-539.683) [-540.301] (-537.976) -- 0:00:49

      Average standard deviation of split frequencies: 0.023903

      125500 -- (-538.980) [-538.727] (-540.415) (-539.318) * (-538.289) [-538.246] (-539.809) (-540.605) -- 0:00:48
      126000 -- (-543.543) (-539.519) [-541.521] (-538.692) * (-539.731) (-539.271) (-539.622) [-542.289] -- 0:00:48
      126500 -- (-541.350) (-544.886) (-538.348) [-538.680] * (-539.804) [-538.894] (-538.856) (-543.800) -- 0:00:48
      127000 -- (-541.831) (-543.711) [-538.287] (-540.925) * (-542.073) (-541.421) [-538.914] (-540.195) -- 0:00:48
      127500 -- [-541.288] (-541.262) (-538.486) (-543.322) * (-540.063) [-540.841] (-538.792) (-540.200) -- 0:00:47
      128000 -- (-542.132) (-540.391) (-538.566) [-539.666] * (-539.745) (-539.338) [-541.859] (-538.888) -- 0:00:47
      128500 -- (-541.221) [-541.399] (-539.014) (-545.089) * [-540.532] (-538.991) (-544.783) (-540.148) -- 0:00:47
      129000 -- (-539.721) (-541.252) (-538.649) [-540.575] * (-540.083) (-538.917) [-541.479] (-539.239) -- 0:00:47
      129500 -- (-541.906) [-542.649] (-540.989) (-542.004) * (-540.978) (-540.277) (-540.496) [-540.119] -- 0:00:47
      130000 -- (-539.733) (-538.909) (-538.691) [-539.292] * (-541.709) (-538.616) (-541.069) [-540.420] -- 0:00:46

      Average standard deviation of split frequencies: 0.023355

      130500 -- [-538.390] (-540.276) (-540.991) (-539.379) * (-541.041) [-539.553] (-541.681) (-550.751) -- 0:00:53
      131000 -- [-539.427] (-539.233) (-538.603) (-542.624) * (-544.008) (-541.316) (-545.144) [-539.511] -- 0:00:53
      131500 -- (-539.434) (-544.222) (-538.582) [-539.131] * (-538.705) (-538.699) (-539.485) [-541.947] -- 0:00:52
      132000 -- (-539.648) [-538.765] (-540.736) (-538.242) * (-538.862) [-541.023] (-538.542) (-543.080) -- 0:00:52
      132500 -- (-541.359) [-541.798] (-539.376) (-538.729) * (-543.005) (-539.168) [-540.485] (-542.894) -- 0:00:52
      133000 -- (-545.219) (-545.230) [-539.863] (-539.548) * (-540.863) (-540.588) [-538.737] (-544.992) -- 0:00:52
      133500 -- (-539.515) [-540.626] (-538.759) (-540.890) * (-540.161) [-538.919] (-542.528) (-543.200) -- 0:00:51
      134000 -- [-538.652] (-537.980) (-538.994) (-541.644) * (-539.915) (-540.461) [-540.239] (-542.577) -- 0:00:51
      134500 -- (-540.447) [-539.635] (-541.244) (-538.297) * (-540.171) (-544.074) [-539.224] (-542.053) -- 0:00:51
      135000 -- (-537.915) (-539.460) (-544.078) [-538.052] * (-538.764) (-539.905) (-539.004) [-541.577] -- 0:00:51

      Average standard deviation of split frequencies: 0.024467

      135500 -- (-538.281) (-540.228) (-544.873) [-540.219] * (-539.766) (-543.029) (-539.059) [-539.117] -- 0:00:51
      136000 -- (-538.379) (-543.396) [-539.098] (-540.211) * (-540.360) (-538.670) [-537.995] (-538.292) -- 0:00:50
      136500 -- (-539.778) (-542.736) [-540.687] (-540.620) * (-539.870) [-538.800] (-542.611) (-538.878) -- 0:00:50
      137000 -- (-545.746) [-543.036] (-539.436) (-541.632) * (-538.448) [-541.083] (-541.375) (-540.514) -- 0:00:50
      137500 -- (-539.681) (-543.766) (-539.775) [-540.293] * (-540.304) [-539.187] (-543.566) (-539.979) -- 0:00:50
      138000 -- (-540.317) (-538.648) (-542.234) [-543.388] * [-541.232] (-540.099) (-544.906) (-539.970) -- 0:00:49
      138500 -- (-538.281) (-539.394) [-538.730] (-541.356) * (-542.378) (-539.970) (-538.163) [-541.237] -- 0:00:49
      139000 -- (-539.874) (-540.042) [-539.426] (-540.139) * (-540.792) (-539.147) (-538.976) [-539.251] -- 0:00:49
      139500 -- [-538.247] (-541.790) (-544.780) (-542.174) * (-540.799) (-538.896) (-541.374) [-544.071] -- 0:00:49
      140000 -- (-540.846) (-539.867) (-540.941) [-542.452] * (-538.922) (-541.568) (-538.925) [-542.322] -- 0:00:49

      Average standard deviation of split frequencies: 0.021783

      140500 -- (-541.757) (-539.685) [-542.761] (-539.163) * [-541.744] (-542.679) (-539.158) (-539.281) -- 0:00:48
      141000 -- [-541.050] (-539.355) (-543.362) (-539.980) * (-541.106) (-538.942) [-543.235] (-541.611) -- 0:00:48
      141500 -- (-541.687) [-540.042] (-542.645) (-543.413) * (-540.088) [-538.276] (-540.885) (-540.473) -- 0:00:48
      142000 -- (-541.098) [-540.796] (-543.028) (-543.968) * (-551.236) (-540.309) [-539.366] (-538.430) -- 0:00:48
      142500 -- [-538.208] (-539.227) (-541.282) (-539.979) * (-540.300) (-539.920) [-540.781] (-538.431) -- 0:00:48
      143000 -- (-539.509) [-538.143] (-540.211) (-539.630) * (-540.266) [-541.547] (-538.531) (-539.005) -- 0:00:47
      143500 -- (-539.534) (-538.272) (-539.059) [-540.682] * (-539.363) (-541.292) (-540.298) [-539.194] -- 0:00:47
      144000 -- [-540.173] (-537.947) (-541.139) (-539.856) * (-538.757) [-539.667] (-541.130) (-539.808) -- 0:00:47
      144500 -- (-541.041) [-540.868] (-539.570) (-542.295) * (-537.711) (-540.721) (-539.015) [-538.884] -- 0:00:47
      145000 -- (-544.984) (-541.514) (-540.031) [-539.138] * (-537.799) [-539.623] (-539.397) (-538.452) -- 0:00:47

      Average standard deviation of split frequencies: 0.021884

      145500 -- [-542.961] (-539.887) (-540.199) (-537.947) * (-537.968) (-539.963) [-538.721] (-539.337) -- 0:00:46
      146000 -- (-543.695) (-541.533) [-539.984] (-540.525) * (-540.991) [-542.488] (-541.791) (-540.633) -- 0:00:46
      146500 -- [-542.347] (-542.105) (-540.952) (-540.602) * (-543.861) (-544.192) [-539.038] (-540.848) -- 0:00:46
      147000 -- (-539.106) (-538.019) [-538.624] (-540.701) * (-539.595) (-541.392) [-539.283] (-541.829) -- 0:00:46
      147500 -- (-540.159) [-538.589] (-538.131) (-538.982) * (-538.371) (-539.001) (-542.045) [-540.095] -- 0:00:46
      148000 -- (-541.473) (-543.833) (-539.939) [-538.073] * (-538.440) (-541.430) (-541.507) [-540.746] -- 0:00:51
      148500 -- (-538.381) (-542.376) [-538.724] (-538.605) * (-541.938) [-542.669] (-543.499) (-538.928) -- 0:00:51
      149000 -- (-538.233) (-538.727) [-538.817] (-540.295) * (-540.285) (-538.590) (-539.457) [-540.366] -- 0:00:51
      149500 -- (-541.953) (-541.931) [-539.455] (-540.456) * (-540.824) [-539.733] (-539.086) (-550.234) -- 0:00:51
      150000 -- [-541.210] (-543.878) (-542.091) (-540.595) * [-539.174] (-539.707) (-538.616) (-539.315) -- 0:00:51

      Average standard deviation of split frequencies: 0.021554

      150500 -- (-538.704) (-540.884) [-539.717] (-540.066) * (-538.475) (-539.696) [-539.633] (-540.170) -- 0:00:50
      151000 -- (-539.358) (-544.526) [-543.181] (-552.294) * (-540.872) (-543.295) (-540.863) [-538.750] -- 0:00:50
      151500 -- (-539.182) [-541.630] (-544.255) (-539.640) * (-540.892) (-541.958) [-541.016] (-540.042) -- 0:00:50
      152000 -- (-539.586) [-539.434] (-538.493) (-537.825) * (-539.904) (-539.098) [-539.046] (-540.757) -- 0:00:50
      152500 -- (-541.608) (-539.384) [-539.184] (-541.117) * (-539.357) (-543.339) (-544.722) [-540.295] -- 0:00:50
      153000 -- [-541.492] (-546.519) (-539.455) (-542.741) * (-540.150) (-544.514) (-543.606) [-538.864] -- 0:00:49
      153500 -- [-540.693] (-543.012) (-539.125) (-538.443) * (-539.298) (-541.113) (-539.161) [-545.100] -- 0:00:49
      154000 -- [-538.466] (-541.912) (-542.574) (-540.680) * [-542.795] (-538.519) (-539.258) (-544.596) -- 0:00:49
      154500 -- (-541.082) (-542.300) [-539.586] (-542.065) * (-538.239) [-540.148] (-540.007) (-538.977) -- 0:00:49
      155000 -- (-541.328) (-542.605) (-538.650) [-540.215] * (-538.927) (-539.216) [-537.992] (-539.071) -- 0:00:49

      Average standard deviation of split frequencies: 0.021686

      155500 -- (-539.683) [-538.991] (-539.858) (-540.432) * (-540.634) (-539.085) (-539.577) [-539.480] -- 0:00:48
      156000 -- [-538.921] (-539.089) (-539.354) (-540.891) * (-540.968) (-541.575) (-539.982) [-540.937] -- 0:00:48
      156500 -- (-541.022) (-541.523) (-545.553) [-541.548] * (-543.650) (-541.143) (-541.359) [-538.931] -- 0:00:48
      157000 -- (-539.903) (-537.873) [-539.288] (-541.412) * [-539.998] (-539.945) (-538.186) (-539.538) -- 0:00:48
      157500 -- (-540.195) [-540.239] (-539.779) (-539.704) * (-541.015) (-539.207) [-538.902] (-537.727) -- 0:00:48
      158000 -- (-543.813) (-541.361) (-543.443) [-539.762] * (-538.171) (-539.184) (-538.177) [-537.979] -- 0:00:47
      158500 -- [-538.967] (-541.110) (-543.036) (-543.009) * (-539.745) (-538.449) (-538.472) [-539.349] -- 0:00:47
      159000 -- [-540.370] (-545.624) (-546.018) (-544.262) * (-541.863) [-538.651] (-539.781) (-540.797) -- 0:00:47
      159500 -- [-539.520] (-539.523) (-543.291) (-539.227) * (-538.439) (-539.128) [-540.712] (-538.246) -- 0:00:47
      160000 -- (-539.214) (-538.873) [-540.049] (-540.277) * (-540.205) (-540.480) (-539.794) [-538.398] -- 0:00:47

      Average standard deviation of split frequencies: 0.021574

      160500 -- (-539.798) (-539.393) [-539.545] (-538.077) * [-542.920] (-540.048) (-542.751) (-544.781) -- 0:00:47
      161000 -- (-540.086) (-540.372) (-543.763) [-540.440] * (-539.425) (-542.442) [-539.911] (-539.833) -- 0:00:46
      161500 -- (-540.868) (-539.292) [-540.313] (-543.235) * (-538.394) (-540.003) (-540.295) [-538.654] -- 0:00:46
      162000 -- (-543.017) (-539.564) [-539.984] (-542.119) * [-538.798] (-547.237) (-540.715) (-541.067) -- 0:00:46
      162500 -- (-539.973) (-539.589) (-539.120) [-538.293] * (-540.975) [-546.409] (-540.005) (-540.157) -- 0:00:46
      163000 -- (-539.507) (-539.649) [-538.808] (-538.958) * (-540.377) (-539.898) [-539.520] (-541.208) -- 0:00:46
      163500 -- (-541.151) (-541.200) [-540.607] (-542.342) * (-541.657) (-541.174) (-539.571) [-541.232] -- 0:00:46
      164000 -- (-539.535) (-540.731) [-543.414] (-538.837) * [-539.867] (-538.412) (-538.509) (-539.704) -- 0:00:45
      164500 -- (-541.827) (-542.928) (-542.859) [-538.790] * [-539.584] (-538.760) (-539.765) (-538.656) -- 0:00:45
      165000 -- (-539.531) (-539.810) (-538.563) [-538.428] * (-539.253) (-541.749) (-539.584) [-538.677] -- 0:00:45

      Average standard deviation of split frequencies: 0.019377

      165500 -- [-538.831] (-539.706) (-542.122) (-540.019) * (-539.928) (-540.766) (-540.377) [-538.651] -- 0:00:50
      166000 -- (-538.349) (-540.609) (-538.134) [-537.877] * (-540.315) (-543.034) [-540.622] (-538.484) -- 0:00:50
      166500 -- [-542.951] (-541.794) (-541.561) (-539.847) * (-540.588) (-538.848) (-539.480) [-540.177] -- 0:00:50
      167000 -- (-541.530) [-541.873] (-542.852) (-542.348) * (-543.948) (-540.085) [-543.788] (-539.756) -- 0:00:49
      167500 -- (-542.527) (-539.154) [-541.740] (-538.613) * (-540.483) [-544.314] (-539.928) (-538.874) -- 0:00:49
      168000 -- (-542.915) (-539.799) (-538.338) [-541.277] * [-541.096] (-540.016) (-539.341) (-538.122) -- 0:00:49
      168500 -- (-542.146) (-544.713) (-538.948) [-539.345] * (-540.016) (-540.157) [-538.463] (-538.832) -- 0:00:49
      169000 -- [-542.012] (-538.308) (-540.211) (-540.970) * (-539.463) (-539.162) [-538.392] (-539.589) -- 0:00:49
      169500 -- (-539.590) (-538.683) (-540.105) [-538.753] * (-540.175) [-538.559] (-538.814) (-541.796) -- 0:00:48
      170000 -- (-540.025) [-539.229] (-541.274) (-541.269) * (-540.614) (-540.866) (-541.114) [-538.253] -- 0:00:48

      Average standard deviation of split frequencies: 0.018848

      170500 -- (-543.803) [-539.907] (-544.155) (-542.545) * (-542.539) (-544.690) [-538.161] (-538.298) -- 0:00:48
      171000 -- [-540.137] (-538.742) (-539.712) (-540.290) * (-540.086) (-540.501) [-538.252] (-538.670) -- 0:00:48
      171500 -- (-541.464) (-543.109) [-539.510] (-540.121) * (-539.917) (-538.867) [-539.722] (-540.864) -- 0:00:48
      172000 -- (-538.568) (-540.120) (-539.583) [-539.144] * [-539.574] (-540.596) (-539.561) (-541.082) -- 0:00:48
      172500 -- (-538.310) (-543.947) [-539.155] (-539.425) * (-542.197) [-543.050] (-540.786) (-543.223) -- 0:00:47
      173000 -- (-539.419) [-540.440] (-539.308) (-540.204) * (-538.829) [-539.507] (-542.157) (-539.531) -- 0:00:47
      173500 -- (-541.878) (-543.779) [-537.997] (-538.594) * (-539.445) (-540.255) (-543.596) [-540.615] -- 0:00:47
      174000 -- (-546.098) (-543.318) [-540.977] (-538.967) * [-545.420] (-540.023) (-539.252) (-540.376) -- 0:00:47
      174500 -- (-540.583) (-543.805) (-541.378) [-539.695] * (-542.371) (-541.167) [-539.962] (-540.334) -- 0:00:47
      175000 -- [-541.504] (-538.889) (-538.664) (-539.705) * (-541.270) (-541.124) (-539.572) [-539.511] -- 0:00:47

      Average standard deviation of split frequencies: 0.017331

      175500 -- (-540.983) (-539.560) [-539.453] (-542.851) * (-544.661) (-538.495) [-539.235] (-539.619) -- 0:00:46
      176000 -- [-538.463] (-539.688) (-540.642) (-540.383) * (-543.348) (-539.352) (-540.466) [-538.851] -- 0:00:46
      176500 -- (-538.583) [-541.525] (-539.716) (-540.721) * (-540.298) (-538.993) (-542.653) [-539.095] -- 0:00:46
      177000 -- (-541.149) (-543.793) (-540.781) [-538.769] * (-538.102) [-539.048] (-542.113) (-539.076) -- 0:00:46
      177500 -- (-539.746) (-544.951) (-539.589) [-544.563] * (-539.327) (-539.424) (-540.265) [-541.735] -- 0:00:46
      178000 -- (-540.837) [-540.240] (-539.997) (-542.576) * (-541.184) (-539.485) [-539.738] (-542.354) -- 0:00:46
      178500 -- (-540.374) (-538.510) [-544.221] (-541.287) * [-538.430] (-538.917) (-540.849) (-544.554) -- 0:00:46
      179000 -- [-539.374] (-539.288) (-539.843) (-545.798) * (-538.962) (-538.434) [-538.824] (-550.231) -- 0:00:45
      179500 -- (-541.856) (-540.188) [-538.718] (-540.876) * (-539.043) [-538.844] (-538.800) (-543.118) -- 0:00:45
      180000 -- (-544.948) [-539.599] (-540.022) (-539.444) * (-537.914) (-541.678) [-537.945] (-540.991) -- 0:00:45

      Average standard deviation of split frequencies: 0.015042

      180500 -- (-540.800) (-539.287) [-540.661] (-539.562) * (-539.559) (-542.211) (-539.464) [-540.107] -- 0:00:45
      181000 -- (-543.082) [-539.105] (-540.300) (-543.006) * (-541.785) (-538.973) [-541.198] (-540.521) -- 0:00:45
      181500 -- [-541.617] (-539.333) (-542.966) (-543.532) * (-543.308) [-541.251] (-540.547) (-538.854) -- 0:00:45
      182000 -- [-539.728] (-543.607) (-538.265) (-542.835) * (-540.721) [-547.195] (-541.240) (-538.118) -- 0:00:44
      182500 -- (-540.081) (-544.598) [-540.113] (-539.625) * [-542.155] (-547.420) (-540.496) (-538.863) -- 0:00:49
      183000 -- [-538.799] (-541.009) (-542.204) (-540.444) * (-546.142) (-540.302) [-539.388] (-539.600) -- 0:00:49
      183500 -- (-539.393) [-546.774] (-540.380) (-539.817) * (-542.694) (-539.605) (-539.091) [-541.044] -- 0:00:48
      184000 -- (-543.614) [-541.277] (-540.481) (-542.385) * (-540.527) (-541.622) (-541.419) [-539.737] -- 0:00:48
      184500 -- (-546.828) (-540.159) [-539.006] (-539.102) * [-541.449] (-539.594) (-541.919) (-538.162) -- 0:00:48
      185000 -- (-546.845) (-538.971) (-541.613) [-539.165] * (-538.215) [-539.079] (-539.833) (-538.869) -- 0:00:48

      Average standard deviation of split frequencies: 0.013939

      185500 -- (-540.166) [-539.750] (-542.185) (-539.693) * (-538.081) [-540.727] (-538.464) (-540.790) -- 0:00:48
      186000 -- (-544.505) (-539.912) (-541.987) [-538.706] * (-541.048) (-542.323) [-539.995] (-539.223) -- 0:00:48
      186500 -- [-542.347] (-540.600) (-538.518) (-543.964) * (-541.309) (-542.846) (-544.252) [-538.598] -- 0:00:47
      187000 -- (-539.303) [-539.692] (-540.093) (-539.417) * (-539.794) (-537.782) [-538.542] (-540.409) -- 0:00:47
      187500 -- (-540.149) (-538.620) [-539.660] (-538.965) * (-544.091) [-538.421] (-539.579) (-539.118) -- 0:00:47
      188000 -- (-540.834) [-540.793] (-541.480) (-539.693) * [-546.250] (-538.338) (-539.356) (-539.810) -- 0:00:47
      188500 -- [-538.640] (-540.432) (-539.405) (-539.094) * (-543.023) (-539.397) (-542.637) [-538.904] -- 0:00:47
      189000 -- [-538.413] (-539.839) (-540.301) (-543.782) * (-537.835) [-540.199] (-540.580) (-544.177) -- 0:00:47
      189500 -- (-538.769) [-541.077] (-539.771) (-539.646) * (-543.467) (-544.885) [-540.748] (-544.129) -- 0:00:47
      190000 -- (-539.449) (-539.569) [-540.842] (-539.974) * (-539.676) (-543.347) (-546.594) [-541.392] -- 0:00:46

      Average standard deviation of split frequencies: 0.011635

      190500 -- (-543.283) (-543.013) [-538.315] (-539.486) * (-539.427) (-538.298) (-543.394) [-540.871] -- 0:00:46
      191000 -- [-542.132] (-540.821) (-542.221) (-539.347) * [-539.556] (-539.320) (-542.142) (-538.766) -- 0:00:46
      191500 -- [-540.295] (-540.932) (-541.060) (-539.580) * (-538.565) [-540.400] (-543.391) (-538.657) -- 0:00:46
      192000 -- (-544.160) (-538.684) [-540.469] (-540.421) * [-537.922] (-542.926) (-540.471) (-542.521) -- 0:00:46
      192500 -- (-543.384) (-539.081) [-540.409] (-541.018) * (-542.015) (-542.697) [-540.839] (-541.598) -- 0:00:46
      193000 -- [-540.581] (-539.177) (-539.680) (-542.475) * (-542.264) [-538.765] (-541.682) (-539.461) -- 0:00:45
      193500 -- (-540.718) [-540.047] (-541.108) (-541.651) * (-539.078) (-542.916) (-539.209) [-539.860] -- 0:00:45
      194000 -- (-539.528) (-539.521) [-541.304] (-538.819) * [-541.411] (-541.831) (-539.794) (-539.895) -- 0:00:45
      194500 -- (-545.029) (-538.450) [-538.900] (-538.056) * (-538.669) [-540.030] (-538.430) (-538.532) -- 0:00:45
      195000 -- (-542.005) (-542.037) [-542.365] (-538.590) * (-543.689) (-541.839) [-540.058] (-541.924) -- 0:00:45

      Average standard deviation of split frequencies: 0.009781

      195500 -- (-542.949) (-538.450) [-539.819] (-538.229) * (-538.736) [-541.245] (-542.620) (-546.753) -- 0:00:45
      196000 -- [-539.562] (-538.604) (-543.589) (-539.450) * (-539.582) (-542.509) (-540.174) [-547.541] -- 0:00:45
      196500 -- (-540.173) [-538.467] (-542.908) (-540.350) * (-538.719) [-538.881] (-538.633) (-545.248) -- 0:00:44
      197000 -- (-539.663) [-538.303] (-542.437) (-539.534) * (-540.039) [-539.109] (-539.708) (-539.857) -- 0:00:44
      197500 -- [-543.228] (-538.538) (-537.945) (-543.184) * (-539.093) [-538.568] (-539.710) (-539.434) -- 0:00:44
      198000 -- (-543.415) [-540.844] (-538.210) (-539.376) * [-539.908] (-538.694) (-540.644) (-539.497) -- 0:00:44
      198500 -- (-541.076) [-538.148] (-541.539) (-539.340) * (-539.799) (-541.023) [-539.577] (-542.601) -- 0:00:44
      199000 -- (-538.108) (-542.652) [-538.737] (-542.061) * (-540.179) [-538.235] (-538.513) (-541.315) -- 0:00:44
      199500 -- (-539.640) (-540.922) (-539.458) [-539.137] * (-542.800) [-538.974] (-540.056) (-540.003) -- 0:00:44
      200000 -- (-539.093) (-542.416) (-540.360) [-538.881] * (-540.029) (-538.898) (-539.064) [-541.321] -- 0:00:48

      Average standard deviation of split frequencies: 0.008144

      200500 -- [-538.662] (-541.428) (-542.088) (-541.499) * (-540.808) [-540.869] (-539.014) (-539.127) -- 0:00:47
      201000 -- (-538.778) (-538.132) [-540.752] (-540.972) * (-547.734) (-541.142) (-541.921) [-539.312] -- 0:00:47
      201500 -- (-539.976) (-539.820) [-542.262] (-539.211) * (-543.416) (-539.824) (-542.354) [-541.119] -- 0:00:47
      202000 -- (-543.577) [-541.109] (-543.140) (-540.826) * [-541.823] (-539.412) (-539.151) (-538.681) -- 0:00:47
      202500 -- (-539.191) (-539.140) [-538.295] (-539.852) * (-538.976) (-541.005) (-538.874) [-539.113] -- 0:00:47
      203000 -- (-539.479) [-539.801] (-538.283) (-540.939) * (-537.971) (-541.153) (-538.926) [-538.078] -- 0:00:47
      203500 -- (-539.744) (-540.516) (-539.622) [-540.784] * (-539.894) [-538.949] (-541.405) (-542.601) -- 0:00:46
      204000 -- (-540.807) (-542.321) [-540.252] (-540.282) * (-540.871) (-539.056) (-541.585) [-539.562] -- 0:00:46
      204500 -- (-539.244) [-538.130] (-540.535) (-539.071) * (-538.558) (-541.272) (-539.100) [-539.720] -- 0:00:46
      205000 -- (-540.986) (-538.307) [-538.392] (-539.681) * (-539.679) (-539.272) [-541.215] (-540.724) -- 0:00:46

      Average standard deviation of split frequencies: 0.009001

      205500 -- (-539.610) (-539.284) [-538.241] (-540.967) * (-543.355) [-538.810] (-538.971) (-542.191) -- 0:00:46
      206000 -- (-543.719) (-539.106) [-538.119] (-542.176) * (-542.384) (-541.611) [-538.831] (-543.435) -- 0:00:46
      206500 -- (-543.462) [-541.668] (-538.063) (-539.947) * (-541.260) (-541.320) (-539.530) [-539.098] -- 0:00:46
      207000 -- (-541.403) (-541.170) [-541.089] (-538.514) * [-538.993] (-540.503) (-539.924) (-539.896) -- 0:00:45
      207500 -- [-540.601] (-539.534) (-540.833) (-539.344) * (-538.407) (-539.635) (-542.921) [-541.934] -- 0:00:45
      208000 -- (-544.282) (-540.910) (-538.916) [-539.452] * (-538.798) (-539.724) (-543.726) [-541.309] -- 0:00:45
      208500 -- (-539.895) (-538.770) (-541.964) [-538.622] * (-543.221) [-538.167] (-543.014) (-539.678) -- 0:00:45
      209000 -- (-548.548) (-539.813) (-538.749) [-539.497] * [-540.367] (-538.703) (-543.171) (-539.000) -- 0:00:45
      209500 -- (-543.778) (-538.512) (-538.416) [-539.175] * (-540.664) (-542.620) [-538.668] (-541.374) -- 0:00:45
      210000 -- (-542.310) (-539.618) [-539.118] (-539.730) * (-538.580) (-541.583) [-540.549] (-541.598) -- 0:00:45

      Average standard deviation of split frequencies: 0.007692

      210500 -- (-542.651) (-544.480) (-540.755) [-540.742] * [-539.362] (-542.982) (-542.621) (-538.743) -- 0:00:45
      211000 -- (-543.562) [-539.997] (-540.209) (-540.785) * (-539.102) [-539.106] (-540.416) (-538.821) -- 0:00:44
      211500 -- (-538.501) (-542.936) (-540.022) [-540.815] * (-539.757) (-542.191) [-540.371] (-540.957) -- 0:00:44
      212000 -- (-539.156) [-542.102] (-541.621) (-539.082) * (-543.224) (-538.723) [-538.586] (-543.931) -- 0:00:44
      212500 -- (-539.057) (-542.875) (-539.248) [-545.270] * [-538.805] (-541.485) (-542.649) (-540.576) -- 0:00:44
      213000 -- (-539.402) (-541.233) [-542.056] (-540.900) * (-538.575) [-540.277] (-542.149) (-542.232) -- 0:00:44
      213500 -- (-538.363) (-539.936) (-539.304) [-540.128] * [-539.807] (-540.591) (-538.375) (-538.135) -- 0:00:44
      214000 -- (-540.013) (-539.743) [-539.510] (-539.276) * (-544.415) (-540.464) [-539.402] (-539.538) -- 0:00:44
      214500 -- (-539.830) (-539.454) (-541.249) [-540.364] * [-541.418] (-540.109) (-540.602) (-542.826) -- 0:00:43
      215000 -- (-542.844) (-541.079) (-539.558) [-538.248] * [-539.763] (-542.052) (-543.604) (-539.160) -- 0:00:43

      Average standard deviation of split frequencies: 0.008002

      215500 -- (-539.754) (-538.248) (-539.480) [-541.189] * (-540.318) (-546.251) [-541.391] (-540.107) -- 0:00:43
      216000 -- [-538.987] (-538.394) (-541.757) (-539.048) * (-540.376) (-539.544) (-539.779) [-544.310] -- 0:00:43
      216500 -- (-541.579) (-541.573) (-540.574) [-539.204] * (-538.340) (-540.043) (-540.181) [-540.921] -- 0:00:43
      217000 -- (-538.591) [-540.244] (-545.861) (-540.180) * [-540.883] (-538.588) (-538.971) (-539.811) -- 0:00:46
      217500 -- [-540.038] (-538.756) (-538.192) (-540.647) * (-542.656) (-541.747) [-538.124] (-541.816) -- 0:00:46
      218000 -- (-538.423) (-539.138) [-538.470] (-540.265) * (-541.859) (-542.373) [-538.251] (-541.851) -- 0:00:46
      218500 -- (-538.519) [-539.373] (-539.510) (-539.456) * (-540.901) [-541.647] (-539.918) (-540.990) -- 0:00:46
      219000 -- [-540.767] (-538.840) (-542.802) (-541.898) * (-539.828) (-539.027) (-538.595) [-540.371] -- 0:00:46
      219500 -- (-541.673) [-540.216] (-543.678) (-542.025) * (-539.219) [-539.125] (-538.922) (-539.102) -- 0:00:46
      220000 -- (-539.697) (-540.083) (-543.771) [-538.801] * (-538.454) [-538.278] (-539.721) (-537.975) -- 0:00:46

      Average standard deviation of split frequencies: 0.009969

      220500 -- (-538.646) [-539.115] (-541.095) (-540.109) * (-539.503) [-540.538] (-540.368) (-541.608) -- 0:00:45
      221000 -- (-541.558) (-540.689) (-545.912) [-542.741] * [-538.297] (-538.503) (-538.348) (-543.938) -- 0:00:45
      221500 -- (-539.557) [-539.669] (-539.640) (-541.190) * (-542.113) (-539.374) [-538.530] (-541.929) -- 0:00:45
      222000 -- (-543.464) (-542.227) (-539.220) [-541.019] * (-541.741) (-542.039) [-541.274] (-543.515) -- 0:00:45
      222500 -- [-540.350] (-542.248) (-539.683) (-539.780) * (-542.520) (-538.872) [-541.601] (-541.652) -- 0:00:45
      223000 -- (-540.261) [-542.380] (-540.989) (-540.350) * (-540.856) (-540.168) [-540.886] (-537.914) -- 0:00:45
      223500 -- (-540.657) (-541.415) [-541.124] (-538.988) * (-543.905) [-540.285] (-540.419) (-538.081) -- 0:00:45
      224000 -- (-540.660) (-541.295) [-540.324] (-545.033) * (-545.381) [-539.174] (-538.699) (-538.894) -- 0:00:45
      224500 -- (-539.452) (-538.966) [-542.119] (-540.957) * (-539.907) [-539.089] (-541.062) (-539.243) -- 0:00:44
      225000 -- [-539.078] (-539.150) (-540.458) (-539.069) * (-542.080) [-538.148] (-538.269) (-541.714) -- 0:00:44

      Average standard deviation of split frequencies: 0.009039

      225500 -- [-540.815] (-540.195) (-539.429) (-538.806) * [-539.632] (-539.893) (-540.633) (-541.332) -- 0:00:44
      226000 -- (-540.313) [-541.403] (-539.328) (-538.396) * (-539.073) (-541.935) [-539.209] (-542.700) -- 0:00:44
      226500 -- (-540.372) (-539.312) [-539.117] (-538.568) * [-538.756] (-538.470) (-542.726) (-540.551) -- 0:00:44
      227000 -- [-540.590] (-541.820) (-541.184) (-540.200) * (-541.855) (-539.493) (-540.473) [-540.805] -- 0:00:44
      227500 -- (-539.048) [-539.021] (-538.534) (-538.782) * [-540.388] (-538.013) (-539.580) (-540.438) -- 0:00:44
      228000 -- (-543.394) (-539.110) [-540.030] (-541.400) * [-538.938] (-540.345) (-539.942) (-540.882) -- 0:00:44
      228500 -- [-546.336] (-538.676) (-539.923) (-538.535) * (-540.539) (-539.543) [-539.935] (-544.497) -- 0:00:43
      229000 -- (-538.974) (-540.185) [-539.181] (-539.868) * (-541.662) [-541.066] (-539.786) (-539.773) -- 0:00:43
      229500 -- (-538.801) [-540.164] (-542.047) (-541.756) * (-540.763) (-542.526) [-538.711] (-541.456) -- 0:00:43
      230000 -- (-541.091) (-541.327) (-538.268) [-540.532] * (-539.460) [-542.727] (-539.749) (-541.834) -- 0:00:43

      Average standard deviation of split frequencies: 0.009265

      230500 -- (-539.681) (-539.953) (-539.478) [-539.636] * (-540.761) (-544.949) (-540.391) [-544.062] -- 0:00:43
      231000 -- (-545.156) (-540.430) (-539.227) [-542.864] * (-539.752) (-544.256) (-544.764) [-538.787] -- 0:00:43
      231500 -- (-539.667) (-538.887) [-538.437] (-542.232) * [-540.034] (-540.249) (-538.673) (-541.430) -- 0:00:43
      232000 -- [-539.590] (-541.857) (-539.857) (-540.411) * (-542.677) [-541.136] (-542.182) (-538.562) -- 0:00:43
      232500 -- (-538.196) (-539.897) (-537.950) [-539.423] * [-543.283] (-542.363) (-541.077) (-540.487) -- 0:00:42
      233000 -- (-538.926) [-540.360] (-538.966) (-540.167) * (-538.522) (-541.016) (-543.290) [-542.761] -- 0:00:42
      233500 -- (-539.711) [-543.698] (-539.818) (-539.402) * (-538.330) [-540.399] (-539.741) (-539.475) -- 0:00:42
      234000 -- (-540.003) (-541.139) (-542.169) [-539.719] * (-540.751) (-542.871) [-539.294] (-538.764) -- 0:00:42
      234500 -- (-542.939) [-540.751] (-541.106) (-538.561) * (-541.325) (-543.827) (-540.254) [-539.056] -- 0:00:45
      235000 -- [-543.680] (-546.863) (-539.952) (-538.867) * (-540.490) (-540.554) (-545.878) [-540.431] -- 0:00:45

      Average standard deviation of split frequencies: 0.009854

      235500 -- [-538.293] (-542.330) (-540.030) (-540.367) * (-538.986) [-539.741] (-543.204) (-550.570) -- 0:00:45
      236000 -- (-539.653) (-540.608) (-542.355) [-540.648] * [-538.568] (-539.605) (-538.664) (-541.216) -- 0:00:45
      236500 -- [-539.006] (-538.871) (-542.380) (-538.611) * (-541.434) (-540.578) [-538.665] (-543.198) -- 0:00:45
      237000 -- (-541.122) (-539.195) (-541.693) [-539.012] * (-542.758) [-538.843] (-539.768) (-539.762) -- 0:00:45
      237500 -- (-540.498) (-538.722) [-539.619] (-539.190) * (-539.102) (-538.877) (-539.513) [-539.204] -- 0:00:44
      238000 -- [-540.910] (-538.202) (-542.968) (-540.982) * (-539.558) [-538.441] (-539.068) (-541.813) -- 0:00:44
      238500 -- [-543.217] (-544.991) (-541.877) (-545.921) * (-541.551) [-537.965] (-538.385) (-543.514) -- 0:00:44
      239000 -- (-539.271) (-538.976) [-542.077] (-542.662) * (-540.262) (-537.965) [-538.356] (-549.248) -- 0:00:44
      239500 -- (-540.103) (-541.195) (-537.825) [-538.513] * [-540.914] (-539.243) (-540.004) (-543.153) -- 0:00:44
      240000 -- (-540.809) (-538.424) (-538.966) [-540.729] * (-538.627) [-538.635] (-539.429) (-540.220) -- 0:00:44

      Average standard deviation of split frequencies: 0.009794

      240500 -- (-542.728) (-538.115) [-538.162] (-538.118) * (-540.069) [-539.618] (-539.422) (-541.198) -- 0:00:44
      241000 -- (-543.543) (-539.432) [-538.040] (-542.292) * (-542.584) (-539.341) [-539.404] (-539.926) -- 0:00:44
      241500 -- (-539.168) (-538.065) [-538.591] (-539.396) * (-544.110) (-540.911) (-542.548) [-539.351] -- 0:00:43
      242000 -- (-538.959) (-540.055) (-537.867) [-542.667] * (-540.641) (-540.175) (-540.198) [-541.329] -- 0:00:43
      242500 -- (-538.110) [-539.246] (-540.135) (-539.403) * (-542.813) [-539.583] (-541.834) (-540.343) -- 0:00:43
      243000 -- (-538.650) (-541.192) [-538.854] (-540.769) * (-542.239) [-539.279] (-539.832) (-540.736) -- 0:00:43
      243500 -- (-543.840) (-541.456) [-539.841] (-539.541) * (-538.504) [-541.007] (-539.203) (-538.613) -- 0:00:43
      244000 -- (-538.589) (-541.658) (-550.234) [-540.860] * (-542.397) (-537.947) (-539.636) [-540.925] -- 0:00:43
      244500 -- (-539.307) (-538.466) [-548.833] (-540.838) * (-542.768) [-539.890] (-540.164) (-539.140) -- 0:00:43
      245000 -- [-539.313] (-541.163) (-542.199) (-540.561) * (-540.748) [-539.096] (-539.605) (-537.933) -- 0:00:43

      Average standard deviation of split frequencies: 0.009965

      245500 -- (-540.969) (-541.237) (-539.434) [-539.665] * (-540.334) [-538.772] (-539.047) (-538.876) -- 0:00:43
      246000 -- [-539.757] (-545.511) (-540.879) (-541.211) * (-539.631) (-539.850) (-539.333) [-537.848] -- 0:00:42
      246500 -- (-539.873) (-542.077) [-544.023] (-539.075) * (-541.839) [-539.270] (-538.535) (-543.735) -- 0:00:42
      247000 -- [-539.049] (-539.843) (-541.350) (-542.188) * (-539.603) (-539.431) (-540.697) [-544.001] -- 0:00:42
      247500 -- (-545.494) [-538.373] (-540.160) (-542.124) * (-540.291) (-538.958) [-538.935] (-539.195) -- 0:00:42
      248000 -- (-543.773) (-538.754) [-538.548] (-543.280) * [-539.866] (-539.996) (-539.292) (-542.044) -- 0:00:42
      248500 -- (-542.771) (-540.929) (-543.748) [-540.223] * (-540.546) (-538.584) [-538.935] (-539.480) -- 0:00:42
      249000 -- (-542.308) (-538.271) (-538.687) [-539.536] * (-541.414) (-538.685) (-542.770) [-538.422] -- 0:00:42
      249500 -- (-539.749) (-538.388) [-539.671] (-538.606) * [-539.781] (-540.981) (-540.637) (-540.312) -- 0:00:42
      250000 -- (-540.148) [-537.906] (-539.547) (-541.385) * (-540.046) [-542.452] (-540.901) (-539.986) -- 0:00:42

      Average standard deviation of split frequencies: 0.010782

      250500 -- [-543.728] (-537.934) (-538.318) (-539.022) * (-542.997) (-540.799) [-543.171] (-540.725) -- 0:00:41
      251000 -- [-539.590] (-543.010) (-540.620) (-539.531) * (-540.648) (-540.481) [-538.798] (-541.894) -- 0:00:41
      251500 -- (-538.920) (-538.319) (-540.794) [-540.288] * [-538.891] (-538.160) (-540.790) (-542.822) -- 0:00:41
      252000 -- [-538.177] (-539.984) (-541.321) (-540.884) * (-538.708) (-541.808) [-539.125] (-540.297) -- 0:00:44
      252500 -- (-543.780) [-539.120] (-542.244) (-541.763) * (-538.933) (-540.402) [-538.056] (-539.696) -- 0:00:44
      253000 -- (-542.203) (-545.284) [-539.825] (-542.728) * (-539.157) (-543.165) [-539.190] (-543.732) -- 0:00:44
      253500 -- (-540.157) (-545.378) [-543.194] (-544.474) * (-543.374) [-540.763] (-538.404) (-542.667) -- 0:00:44
      254000 -- (-539.160) [-538.942] (-543.060) (-542.537) * (-544.029) (-543.209) [-539.876] (-539.894) -- 0:00:44
      254500 -- (-538.644) [-538.379] (-539.059) (-538.411) * (-538.883) (-540.375) (-542.858) [-541.815] -- 0:00:43
      255000 -- (-539.913) (-538.843) (-541.036) [-539.130] * [-539.783] (-540.174) (-540.612) (-543.910) -- 0:00:43

      Average standard deviation of split frequencies: 0.010926

      255500 -- (-543.690) (-542.588) [-545.188] (-539.001) * (-538.991) (-541.489) (-538.345) [-545.379] -- 0:00:43
      256000 -- (-542.912) (-545.421) (-541.475) [-538.408] * (-538.186) [-541.122] (-540.090) (-543.283) -- 0:00:43
      256500 -- (-540.822) (-541.677) (-540.022) [-539.230] * (-541.029) (-544.567) (-540.341) [-539.984] -- 0:00:43
      257000 -- (-539.672) (-540.457) [-540.961] (-539.411) * (-538.157) [-542.338] (-540.760) (-540.678) -- 0:00:43
      257500 -- (-539.043) (-539.414) (-542.659) [-539.475] * (-540.005) (-540.732) (-543.958) [-540.507] -- 0:00:43
      258000 -- (-540.048) [-539.169] (-542.673) (-539.404) * (-539.939) (-540.504) [-542.973] (-540.600) -- 0:00:43
      258500 -- (-540.372) (-539.111) [-538.653] (-542.232) * (-539.142) (-540.853) (-539.923) [-538.437] -- 0:00:43
      259000 -- [-538.691] (-541.041) (-541.456) (-539.233) * (-539.024) (-543.467) [-539.331] (-541.277) -- 0:00:42
      259500 -- (-539.132) [-539.981] (-541.548) (-542.943) * (-539.739) (-540.987) [-539.414] (-541.570) -- 0:00:42
      260000 -- (-539.487) [-539.905] (-540.276) (-538.076) * (-540.481) [-541.439] (-538.733) (-539.960) -- 0:00:42

      Average standard deviation of split frequencies: 0.010971

      260500 -- (-540.574) (-539.486) [-537.892] (-545.557) * (-538.870) [-547.958] (-540.347) (-539.691) -- 0:00:42
      261000 -- (-538.922) (-544.237) (-539.992) [-539.105] * (-538.667) [-541.510] (-538.382) (-539.343) -- 0:00:42
      261500 -- (-539.621) (-542.791) [-540.548] (-541.197) * (-539.734) [-543.233] (-537.796) (-539.775) -- 0:00:42
      262000 -- (-540.799) (-539.328) [-541.901] (-539.790) * [-545.411] (-539.272) (-538.576) (-540.317) -- 0:00:42
      262500 -- (-540.202) (-539.854) [-539.608] (-546.437) * (-543.014) (-541.336) [-538.497] (-541.195) -- 0:00:42
      263000 -- (-539.286) [-544.029] (-541.690) (-539.134) * (-540.571) (-538.411) (-545.867) [-540.399] -- 0:00:42
      263500 -- (-540.763) (-541.086) (-546.601) [-541.243] * (-538.485) [-538.702] (-543.068) (-539.407) -- 0:00:41
      264000 -- (-542.861) (-541.224) (-541.459) [-541.580] * (-538.667) (-543.051) [-539.473] (-537.885) -- 0:00:41
      264500 -- (-543.285) [-541.481] (-542.213) (-540.056) * (-542.969) [-542.245] (-543.396) (-538.064) -- 0:00:41
      265000 -- (-540.789) (-541.693) (-540.061) [-540.791] * [-541.550] (-539.358) (-539.157) (-538.964) -- 0:00:41

      Average standard deviation of split frequencies: 0.012051

      265500 -- (-539.611) (-541.892) (-539.199) [-539.669] * (-541.183) (-539.458) (-540.494) [-539.664] -- 0:00:41
      266000 -- (-540.718) (-539.996) (-543.272) [-539.520] * (-540.357) [-540.375] (-543.250) (-538.831) -- 0:00:41
      266500 -- (-541.455) (-539.854) [-540.950] (-538.785) * [-538.817] (-541.156) (-540.119) (-538.545) -- 0:00:41
      267000 -- [-539.791] (-539.698) (-538.415) (-541.726) * (-539.025) [-540.662] (-541.912) (-541.516) -- 0:00:41
      267500 -- (-539.456) (-541.746) (-539.108) [-541.002] * [-541.361] (-540.244) (-540.477) (-538.092) -- 0:00:41
      268000 -- [-539.209] (-542.978) (-538.529) (-541.976) * (-539.234) (-539.326) (-540.507) [-539.067] -- 0:00:40
      268500 -- (-540.809) [-545.763] (-539.529) (-538.722) * (-539.314) (-541.066) (-540.693) [-543.090] -- 0:00:40
      269000 -- [-542.190] (-538.631) (-539.146) (-542.676) * [-541.082] (-538.303) (-538.109) (-538.780) -- 0:00:43
      269500 -- [-539.533] (-540.218) (-543.593) (-540.690) * (-538.557) [-539.580] (-539.323) (-539.403) -- 0:00:43
      270000 -- (-539.949) (-538.736) (-538.873) [-538.118] * (-541.309) (-540.917) (-539.975) [-539.744] -- 0:00:43

      Average standard deviation of split frequencies: 0.011727

      270500 -- (-541.490) [-538.813] (-541.500) (-539.989) * (-539.168) (-539.066) (-538.668) [-538.429] -- 0:00:43
      271000 -- (-541.994) [-538.622] (-539.208) (-538.848) * (-539.828) [-540.901] (-539.606) (-542.734) -- 0:00:43
      271500 -- [-540.529] (-539.250) (-539.385) (-538.885) * (-543.142) [-538.805] (-539.362) (-545.825) -- 0:00:42
      272000 -- (-538.803) (-540.530) (-541.893) [-540.115] * (-540.266) [-541.152] (-539.428) (-542.683) -- 0:00:42
      272500 -- [-538.956] (-540.094) (-541.583) (-539.163) * [-538.682] (-538.404) (-539.703) (-541.400) -- 0:00:42
      273000 -- (-542.702) (-542.829) [-541.052] (-540.569) * [-538.422] (-540.663) (-543.621) (-539.825) -- 0:00:42
      273500 -- (-538.588) (-538.154) [-541.004] (-544.111) * [-540.951] (-544.052) (-541.072) (-538.877) -- 0:00:42
      274000 -- (-538.772) (-540.812) (-539.553) [-538.317] * (-543.512) (-540.706) (-541.218) [-541.538] -- 0:00:42
      274500 -- [-541.418] (-539.095) (-538.019) (-540.919) * (-539.507) (-543.069) [-538.729] (-540.190) -- 0:00:42
      275000 -- (-539.385) (-540.879) [-538.211] (-540.794) * (-539.292) (-538.743) [-539.182] (-540.419) -- 0:00:42

      Average standard deviation of split frequencies: 0.010931

      275500 -- (-538.952) (-543.908) [-539.764] (-541.173) * (-543.364) (-539.342) [-540.471] (-544.362) -- 0:00:42
      276000 -- (-543.472) [-540.807] (-540.856) (-539.796) * (-541.585) [-539.494] (-538.766) (-542.186) -- 0:00:41
      276500 -- (-543.785) (-539.823) [-543.738] (-541.767) * (-540.643) [-542.563] (-541.088) (-540.629) -- 0:00:41
      277000 -- (-541.094) (-540.495) (-542.248) [-539.858] * (-539.261) [-538.919] (-539.713) (-541.613) -- 0:00:41
      277500 -- [-539.253] (-542.284) (-541.421) (-545.224) * (-538.702) (-539.326) [-537.995] (-541.131) -- 0:00:41
      278000 -- [-541.408] (-542.042) (-540.501) (-539.984) * (-540.069) (-542.105) (-538.474) [-538.598] -- 0:00:41
      278500 -- (-538.339) (-539.836) [-542.403] (-539.683) * (-539.077) (-540.977) [-539.659] (-543.053) -- 0:00:41
      279000 -- (-538.165) (-542.160) [-541.889] (-539.909) * (-539.768) [-539.230] (-541.864) (-544.732) -- 0:00:41
      279500 -- [-537.830] (-541.285) (-541.426) (-540.117) * (-542.583) (-542.667) (-542.333) [-540.427] -- 0:00:41
      280000 -- [-540.445] (-540.008) (-539.708) (-540.844) * (-540.660) (-539.359) (-539.005) [-540.321] -- 0:00:41

      Average standard deviation of split frequencies: 0.009406

      280500 -- (-539.426) [-538.601] (-538.208) (-541.379) * (-542.624) [-540.057] (-540.617) (-539.264) -- 0:00:41
      281000 -- (-540.480) [-542.595] (-539.761) (-539.558) * (-539.174) (-540.041) (-541.863) [-538.883] -- 0:00:40
      281500 -- (-540.612) [-538.952] (-539.583) (-539.595) * (-539.908) [-540.272] (-540.399) (-540.337) -- 0:00:40
      282000 -- (-542.215) [-539.362] (-539.428) (-541.264) * (-539.454) [-538.911] (-542.054) (-538.573) -- 0:00:40
      282500 -- (-539.393) (-539.468) (-540.818) [-541.464] * (-538.668) (-540.637) [-539.809] (-540.119) -- 0:00:40
      283000 -- [-543.403] (-541.573) (-539.469) (-540.245) * [-540.432] (-538.956) (-540.571) (-541.504) -- 0:00:40
      283500 -- (-540.704) [-540.963] (-539.293) (-540.023) * [-539.100] (-538.942) (-539.682) (-541.781) -- 0:00:40
      284000 -- [-538.354] (-543.568) (-541.758) (-542.569) * (-542.074) [-538.517] (-538.342) (-539.232) -- 0:00:40
      284500 -- (-539.955) [-541.685] (-544.512) (-541.890) * [-539.689] (-538.873) (-540.606) (-541.187) -- 0:00:40
      285000 -- (-540.385) (-541.967) [-539.954] (-542.521) * (-544.311) (-542.836) (-542.463) [-541.520] -- 0:00:40

      Average standard deviation of split frequencies: 0.010405

      285500 -- (-538.330) [-542.518] (-539.306) (-546.360) * (-543.075) (-538.449) [-539.878] (-541.590) -- 0:00:40
      286000 -- (-539.981) [-542.434] (-540.981) (-543.925) * (-540.389) (-540.139) (-538.435) [-539.067] -- 0:00:39
      286500 -- (-541.283) (-544.392) (-539.403) [-545.036] * [-539.649] (-539.792) (-539.246) (-540.560) -- 0:00:42
      287000 -- (-538.739) (-540.950) [-540.638] (-544.487) * (-540.559) (-542.539) (-540.950) [-540.467] -- 0:00:42
      287500 -- (-542.338) (-541.135) [-542.167] (-539.668) * (-541.081) (-539.722) [-538.864] (-540.728) -- 0:00:42
      288000 -- (-541.745) (-539.514) (-543.024) [-540.623] * (-541.583) (-538.888) (-539.038) [-539.921] -- 0:00:42
      288500 -- [-540.193] (-541.544) (-538.468) (-541.758) * [-543.192] (-538.185) (-539.709) (-541.730) -- 0:00:41
      289000 -- (-541.226) (-539.657) [-541.065] (-540.440) * [-540.534] (-540.891) (-543.813) (-538.744) -- 0:00:41
      289500 -- [-540.737] (-539.487) (-544.275) (-539.007) * [-539.911] (-541.391) (-544.938) (-540.051) -- 0:00:41
      290000 -- (-539.378) [-538.912] (-542.106) (-539.931) * (-542.316) [-541.408] (-539.947) (-540.317) -- 0:00:41

      Average standard deviation of split frequencies: 0.010035

      290500 -- (-540.812) [-540.708] (-539.496) (-539.332) * [-539.537] (-542.218) (-541.740) (-539.453) -- 0:00:41
      291000 -- (-538.647) (-541.975) (-541.632) [-540.121] * (-542.532) (-538.803) (-538.903) [-542.667] -- 0:00:41
      291500 -- (-540.669) (-540.110) [-539.140] (-541.611) * (-540.409) [-538.569] (-542.614) (-539.254) -- 0:00:41
      292000 -- (-539.751) (-540.536) (-540.538) [-538.606] * [-538.648] (-540.487) (-542.859) (-538.814) -- 0:00:41
      292500 -- (-539.013) (-539.923) (-538.453) [-538.618] * (-541.519) (-541.490) (-541.106) [-539.740] -- 0:00:41
      293000 -- (-542.796) (-540.567) (-539.432) [-538.435] * (-541.290) [-539.653] (-537.783) (-542.243) -- 0:00:41
      293500 -- [-539.858] (-540.592) (-542.291) (-543.077) * [-539.553] (-540.005) (-542.259) (-546.642) -- 0:00:40
      294000 -- (-538.888) [-539.860] (-541.334) (-541.686) * (-540.137) [-539.973] (-541.540) (-540.437) -- 0:00:40
      294500 -- (-538.470) [-540.507] (-540.526) (-545.307) * (-540.824) (-541.948) [-538.292] (-539.951) -- 0:00:40
      295000 -- (-542.276) (-540.175) (-538.940) [-542.844] * (-540.587) (-541.167) (-543.260) [-541.528] -- 0:00:40

      Average standard deviation of split frequencies: 0.010053

      295500 -- (-540.363) (-543.663) [-540.467] (-544.287) * (-541.380) [-538.372] (-543.279) (-540.459) -- 0:00:40
      296000 -- (-539.486) [-539.523] (-539.681) (-538.719) * (-540.499) (-542.252) (-540.119) [-541.701] -- 0:00:40
      296500 -- (-539.970) (-544.884) (-544.771) [-539.528] * [-538.718] (-539.234) (-539.319) (-541.728) -- 0:00:40
      297000 -- (-540.175) (-539.261) (-541.071) [-538.721] * (-540.378) [-542.114] (-540.233) (-539.940) -- 0:00:40
      297500 -- [-539.381] (-539.423) (-543.062) (-542.861) * (-540.120) (-544.046) (-538.553) [-538.470] -- 0:00:40
      298000 -- [-539.826] (-541.727) (-544.236) (-539.035) * (-539.533) (-540.658) (-539.235) [-540.933] -- 0:00:40
      298500 -- (-539.536) [-540.240] (-538.871) (-543.615) * (-539.988) (-542.793) (-539.261) [-540.985] -- 0:00:39
      299000 -- [-540.016] (-540.269) (-539.576) (-541.151) * [-539.003] (-541.639) (-539.058) (-539.425) -- 0:00:39
      299500 -- [-538.044] (-538.343) (-541.015) (-540.517) * [-538.694] (-539.817) (-538.076) (-541.408) -- 0:00:39
      300000 -- (-542.304) [-542.684] (-540.451) (-541.661) * (-539.722) (-541.992) [-538.656] (-544.207) -- 0:00:39

      Average standard deviation of split frequencies: 0.009701

      300500 -- (-541.318) (-542.009) (-539.964) [-543.542] * (-540.641) (-539.717) [-538.097] (-540.590) -- 0:00:39
      301000 -- (-542.700) (-540.874) (-539.792) [-538.891] * (-540.302) (-538.306) [-543.737] (-545.753) -- 0:00:39
      301500 -- (-540.649) [-539.797] (-539.732) (-539.308) * (-539.220) (-538.399) (-538.450) [-542.321] -- 0:00:39
      302000 -- (-543.653) [-540.116] (-544.178) (-538.786) * (-541.798) (-538.441) [-544.964] (-540.304) -- 0:00:39
      302500 -- (-541.065) (-541.590) (-542.991) [-539.303] * [-539.971] (-541.952) (-538.960) (-540.659) -- 0:00:39
      303000 -- (-539.984) [-539.477] (-541.510) (-541.526) * (-539.969) (-540.759) [-543.686] (-538.632) -- 0:00:39
      303500 -- (-539.118) [-538.821] (-538.535) (-541.088) * (-538.830) (-541.232) (-541.783) [-538.373] -- 0:00:41
      304000 -- (-541.072) (-540.976) [-539.596] (-541.390) * [-538.333] (-538.071) (-539.634) (-544.464) -- 0:00:41
      304500 -- (-541.626) [-542.615] (-540.784) (-541.115) * (-540.837) (-540.097) (-542.065) [-541.314] -- 0:00:41
      305000 -- (-542.838) [-540.745] (-539.746) (-541.063) * (-539.098) (-542.756) [-538.565] (-544.692) -- 0:00:41

      Average standard deviation of split frequencies: 0.010399

      305500 -- (-539.377) (-538.803) [-542.892] (-541.715) * (-542.249) (-542.077) [-539.284] (-541.136) -- 0:00:40
      306000 -- (-543.251) [-540.378] (-541.763) (-540.391) * (-542.756) (-542.124) [-542.045] (-538.694) -- 0:00:40
      306500 -- [-538.408] (-542.076) (-544.184) (-539.325) * (-539.606) (-538.826) [-541.457] (-539.075) -- 0:00:40
      307000 -- (-541.896) [-539.899] (-540.626) (-542.481) * (-540.387) (-540.684) [-540.620] (-538.521) -- 0:00:40
      307500 -- (-538.954) (-540.059) [-545.307] (-538.754) * (-539.299) [-538.664] (-543.533) (-540.808) -- 0:00:40
      308000 -- (-539.495) [-538.235] (-539.081) (-538.625) * (-542.724) [-540.202] (-545.857) (-541.030) -- 0:00:40
      308500 -- (-540.090) (-539.679) [-538.016] (-540.119) * (-539.269) [-539.116] (-545.776) (-542.966) -- 0:00:40
      309000 -- (-542.460) (-540.527) (-542.090) [-541.039] * [-539.139] (-545.566) (-542.604) (-541.232) -- 0:00:40
      309500 -- [-539.103] (-541.876) (-541.032) (-538.721) * (-539.685) (-540.769) (-545.038) [-541.099] -- 0:00:40
      310000 -- (-540.063) (-541.055) (-539.494) [-538.065] * [-538.559] (-545.886) (-540.845) (-541.004) -- 0:00:40

      Average standard deviation of split frequencies: 0.010811

      310500 -- (-539.826) (-538.766) (-541.242) [-544.803] * [-539.243] (-541.665) (-540.142) (-540.902) -- 0:00:39
      311000 -- (-542.121) [-538.402] (-538.275) (-539.796) * (-538.963) (-541.358) (-540.157) [-538.557] -- 0:00:39
      311500 -- (-546.338) [-541.943] (-539.126) (-541.525) * [-538.099] (-540.929) (-539.472) (-540.856) -- 0:00:39
      312000 -- (-541.050) [-539.088] (-538.711) (-552.004) * [-538.637] (-545.945) (-540.877) (-540.471) -- 0:00:39
      312500 -- (-538.901) [-540.807] (-538.093) (-544.235) * (-541.277) (-539.661) (-538.286) [-542.560] -- 0:00:39
      313000 -- [-540.716] (-543.668) (-540.132) (-539.994) * (-539.578) (-551.321) [-538.687] (-546.354) -- 0:00:39
      313500 -- (-538.940) (-538.327) (-539.138) [-539.943] * (-540.426) (-540.660) (-538.844) [-540.935] -- 0:00:39
      314000 -- (-539.531) (-541.106) (-543.908) [-540.652] * (-540.105) (-539.219) [-539.488] (-541.269) -- 0:00:39
      314500 -- [-539.028] (-543.783) (-545.214) (-540.246) * [-541.241] (-538.105) (-540.231) (-541.761) -- 0:00:39
      315000 -- (-540.648) (-541.070) [-539.321] (-541.056) * (-540.937) (-545.673) [-541.348] (-541.775) -- 0:00:39

      Average standard deviation of split frequencies: 0.011095

      315500 -- (-542.435) (-539.313) [-539.458] (-542.173) * [-539.978] (-541.268) (-541.420) (-542.613) -- 0:00:39
      316000 -- (-541.344) (-540.671) [-541.081] (-544.162) * [-540.590] (-542.034) (-539.354) (-541.688) -- 0:00:38
      316500 -- (-538.944) [-539.780] (-537.780) (-539.478) * (-540.852) (-539.173) [-539.560] (-540.230) -- 0:00:38
      317000 -- (-548.157) [-540.919] (-539.460) (-539.911) * (-542.249) (-541.751) (-539.218) [-539.186] -- 0:00:38
      317500 -- (-543.350) [-540.523] (-545.602) (-541.000) * [-538.653] (-541.961) (-540.410) (-540.423) -- 0:00:38
      318000 -- (-539.781) (-540.887) [-543.396] (-538.743) * (-540.529) (-539.808) [-538.693] (-540.540) -- 0:00:38
      318500 -- (-540.353) (-545.290) [-539.069] (-545.727) * [-538.910] (-542.389) (-538.671) (-540.367) -- 0:00:38
      319000 -- (-538.908) (-543.425) (-538.730) [-540.017] * [-539.067] (-539.192) (-539.488) (-540.351) -- 0:00:38
      319500 -- (-548.894) (-542.272) (-541.190) [-538.131] * (-543.056) [-539.423] (-539.884) (-540.085) -- 0:00:38
      320000 -- [-539.182] (-538.543) (-539.309) (-539.785) * (-544.202) [-538.474] (-539.092) (-538.620) -- 0:00:38

      Average standard deviation of split frequencies: 0.013231

      320500 -- (-541.084) (-539.484) [-542.863] (-538.853) * (-543.835) [-538.716] (-539.539) (-545.486) -- 0:00:40
      321000 -- (-539.486) (-540.078) (-540.113) [-541.790] * (-543.448) (-540.971) [-540.583] (-539.450) -- 0:00:40
      321500 -- (-539.099) (-541.867) (-542.311) [-539.538] * [-539.803] (-543.161) (-541.079) (-543.853) -- 0:00:40
      322000 -- (-541.634) (-540.489) [-538.763] (-538.786) * (-541.022) [-539.740] (-539.762) (-538.889) -- 0:00:40
      322500 -- (-541.200) (-543.135) (-540.222) [-539.519] * (-541.913) [-540.395] (-538.426) (-538.880) -- 0:00:39
      323000 -- [-540.337] (-540.297) (-541.767) (-539.569) * [-540.565] (-540.408) (-540.432) (-539.538) -- 0:00:39
      323500 -- [-539.807] (-542.342) (-540.800) (-542.534) * (-540.172) [-539.727] (-538.703) (-543.164) -- 0:00:39
      324000 -- [-539.152] (-539.547) (-538.511) (-538.635) * (-540.740) (-542.374) (-538.240) [-539.297] -- 0:00:39
      324500 -- [-538.989] (-538.409) (-540.813) (-540.222) * (-538.757) (-540.450) (-538.659) [-537.904] -- 0:00:39
      325000 -- (-538.326) (-540.669) (-546.444) [-539.315] * (-538.405) (-542.818) [-546.210] (-539.295) -- 0:00:39

      Average standard deviation of split frequencies: 0.013285

      325500 -- [-538.141] (-538.909) (-539.778) (-542.876) * (-538.597) [-539.518] (-540.975) (-540.426) -- 0:00:39
      326000 -- [-539.944] (-541.283) (-540.051) (-541.210) * (-539.915) [-539.386] (-543.972) (-542.302) -- 0:00:39
      326500 -- [-541.228] (-540.721) (-538.853) (-538.568) * (-538.937) [-539.147] (-540.165) (-540.681) -- 0:00:39
      327000 -- (-545.343) (-541.509) [-539.964] (-540.034) * (-539.868) (-538.262) [-540.904] (-538.978) -- 0:00:39
      327500 -- (-540.143) [-541.429] (-538.734) (-540.157) * (-540.893) [-540.273] (-541.185) (-542.010) -- 0:00:39
      328000 -- (-541.034) (-541.648) [-542.259] (-539.597) * (-540.874) (-539.949) (-538.888) [-539.637] -- 0:00:38
      328500 -- (-542.743) (-544.077) (-540.966) [-539.693] * (-545.445) (-542.933) [-538.398] (-539.248) -- 0:00:38
      329000 -- [-538.718] (-539.420) (-541.738) (-540.841) * (-539.951) (-543.402) (-538.862) [-543.047] -- 0:00:38
      329500 -- (-538.458) (-540.177) (-541.336) [-540.288] * (-540.789) (-538.626) (-538.372) [-544.247] -- 0:00:38
      330000 -- (-538.458) (-540.214) (-538.538) [-543.623] * (-540.740) [-538.585] (-540.014) (-541.317) -- 0:00:38

      Average standard deviation of split frequencies: 0.013686

      330500 -- (-538.729) (-545.001) (-543.858) [-542.282] * (-540.317) (-539.496) (-540.905) [-543.575] -- 0:00:38
      331000 -- (-540.928) [-539.404] (-544.941) (-540.749) * (-540.290) [-538.560] (-539.467) (-543.512) -- 0:00:38
      331500 -- (-540.518) [-538.351] (-538.220) (-542.152) * (-540.703) (-539.692) [-542.072] (-541.230) -- 0:00:38
      332000 -- (-540.343) [-540.484] (-539.988) (-539.233) * (-540.133) (-538.798) (-540.514) [-542.277] -- 0:00:38
      332500 -- (-542.217) (-538.066) (-541.408) [-538.516] * [-539.270] (-537.984) (-539.554) (-541.067) -- 0:00:38
      333000 -- [-540.742] (-541.209) (-542.006) (-539.069) * (-539.880) [-540.974] (-538.570) (-542.303) -- 0:00:38
      333500 -- (-539.480) (-544.146) [-540.611] (-538.368) * [-541.147] (-540.703) (-539.616) (-541.271) -- 0:00:37
      334000 -- [-542.107] (-542.862) (-540.702) (-540.659) * (-545.635) (-540.830) (-538.296) [-540.098] -- 0:00:37
      334500 -- (-538.187) (-541.297) (-540.222) [-540.364] * (-538.728) (-544.638) (-539.149) [-541.818] -- 0:00:37
      335000 -- (-538.626) [-538.257] (-540.583) (-542.058) * (-543.553) (-539.386) (-539.824) [-539.718] -- 0:00:37

      Average standard deviation of split frequencies: 0.013241

      335500 -- (-539.166) (-538.857) (-543.124) [-540.278] * (-540.533) (-542.809) (-539.482) [-543.325] -- 0:00:37
      336000 -- (-539.008) [-538.846] (-539.564) (-538.075) * (-540.895) (-540.158) [-540.142] (-541.326) -- 0:00:37
      336500 -- (-538.849) (-539.130) [-538.826] (-539.875) * (-541.440) (-541.129) (-539.945) [-540.951] -- 0:00:37
      337000 -- (-538.481) [-540.408] (-539.420) (-538.240) * (-542.147) (-539.695) (-541.818) [-540.536] -- 0:00:37
      337500 -- [-538.845] (-539.339) (-539.590) (-540.481) * [-538.583] (-540.647) (-540.397) (-542.050) -- 0:00:37
      338000 -- (-540.999) [-540.034] (-543.260) (-548.641) * (-540.565) [-543.698] (-542.851) (-539.461) -- 0:00:39
      338500 -- (-542.023) (-539.996) [-540.673] (-540.594) * (-538.667) (-543.204) (-540.466) [-540.204] -- 0:00:39
      339000 -- (-540.340) (-542.436) (-539.994) [-542.201] * (-539.441) (-539.646) (-544.551) [-538.913] -- 0:00:38
      339500 -- (-542.525) (-548.701) [-538.933] (-540.886) * (-539.466) [-538.048] (-540.956) (-542.937) -- 0:00:38
      340000 -- [-538.912] (-544.825) (-540.470) (-540.367) * [-540.756] (-540.097) (-542.932) (-540.436) -- 0:00:38

      Average standard deviation of split frequencies: 0.013405

      340500 -- (-540.802) (-544.493) [-540.662] (-543.309) * (-539.177) (-540.841) (-539.810) [-540.689] -- 0:00:38
      341000 -- [-540.231] (-540.704) (-540.612) (-542.422) * (-543.658) (-540.309) (-538.970) [-540.568] -- 0:00:38
      341500 -- [-541.562] (-539.947) (-542.265) (-539.769) * [-540.162] (-541.626) (-540.036) (-540.535) -- 0:00:38
      342000 -- (-541.942) (-541.415) [-541.659] (-539.376) * (-542.538) (-545.453) [-539.379] (-542.182) -- 0:00:38
      342500 -- (-539.398) (-541.403) [-540.362] (-539.996) * [-544.157] (-541.081) (-538.981) (-543.528) -- 0:00:38
      343000 -- (-539.214) [-539.667] (-539.141) (-540.641) * (-541.156) (-540.191) [-540.090] (-541.884) -- 0:00:38
      343500 -- (-542.915) (-540.670) [-540.631] (-539.380) * (-543.750) (-541.632) (-540.570) [-541.160] -- 0:00:38
      344000 -- (-538.520) (-539.523) [-539.755] (-540.274) * (-541.602) (-540.241) [-539.251] (-540.171) -- 0:00:38
      344500 -- [-541.186] (-539.232) (-543.718) (-542.829) * (-538.926) (-539.751) [-539.603] (-541.339) -- 0:00:38
      345000 -- (-538.000) (-540.287) [-540.102] (-541.776) * [-541.648] (-541.728) (-538.677) (-539.945) -- 0:00:37

      Average standard deviation of split frequencies: 0.013710

      345500 -- (-539.334) (-538.894) [-540.844] (-538.751) * (-545.594) [-543.822] (-543.741) (-539.589) -- 0:00:37
      346000 -- (-545.521) [-538.790] (-538.554) (-540.097) * [-543.169] (-540.316) (-541.136) (-540.397) -- 0:00:37
      346500 -- (-545.988) (-539.774) [-541.388] (-539.707) * [-540.476] (-543.393) (-540.463) (-538.726) -- 0:00:37
      347000 -- (-542.190) (-540.936) (-541.080) [-542.834] * [-539.590] (-540.983) (-541.965) (-538.424) -- 0:00:37
      347500 -- [-539.331] (-540.247) (-539.899) (-541.872) * (-538.243) (-541.491) (-541.502) [-541.589] -- 0:00:37
      348000 -- (-541.977) [-539.416] (-538.945) (-539.029) * [-538.606] (-539.337) (-542.633) (-538.629) -- 0:00:37
      348500 -- (-539.460) (-540.366) (-540.245) [-539.911] * (-538.362) [-542.457] (-539.127) (-538.991) -- 0:00:37
      349000 -- (-541.777) (-540.076) (-539.181) [-540.931] * (-539.672) (-539.616) [-539.627] (-542.079) -- 0:00:37
      349500 -- (-541.957) (-538.843) (-539.125) [-545.136] * (-539.234) (-542.704) (-540.989) [-540.496] -- 0:00:37
      350000 -- (-539.900) (-539.053) [-539.055] (-543.252) * (-541.542) (-545.586) [-540.368] (-538.307) -- 0:00:37

      Average standard deviation of split frequencies: 0.013107

      350500 -- (-541.403) [-542.339] (-539.780) (-541.911) * (-540.322) (-541.247) [-540.237] (-538.645) -- 0:00:37
      351000 -- (-540.613) (-539.253) [-540.454] (-544.087) * (-542.088) (-539.716) (-538.963) [-538.448] -- 0:00:36
      351500 -- (-539.628) (-538.939) [-538.072] (-545.287) * [-543.146] (-538.618) (-538.659) (-541.875) -- 0:00:36
      352000 -- [-544.012] (-538.398) (-540.854) (-540.330) * (-538.969) [-537.998] (-540.970) (-539.314) -- 0:00:36
      352500 -- (-538.496) [-538.678] (-543.650) (-540.075) * (-538.965) (-539.667) (-539.376) [-539.680] -- 0:00:36
      353000 -- (-538.540) (-540.590) (-541.126) [-539.083] * (-538.558) (-539.949) (-539.420) [-538.712] -- 0:00:36
      353500 -- [-539.347] (-539.014) (-540.177) (-539.296) * (-538.355) (-546.731) [-544.412] (-539.325) -- 0:00:36
      354000 -- (-540.713) [-538.712] (-542.495) (-538.876) * [-539.849] (-542.041) (-543.062) (-541.382) -- 0:00:38
      354500 -- (-539.428) [-539.728] (-540.152) (-540.470) * [-538.126] (-540.549) (-539.328) (-541.325) -- 0:00:38
      355000 -- (-541.610) (-539.541) [-539.620] (-541.354) * (-538.457) (-540.894) (-541.516) [-540.974] -- 0:00:38

      Average standard deviation of split frequencies: 0.013904

      355500 -- (-541.217) [-544.664] (-540.331) (-538.173) * (-540.099) [-539.794] (-546.193) (-539.746) -- 0:00:38
      356000 -- (-543.829) (-541.242) (-539.696) [-540.665] * [-539.980] (-540.021) (-538.308) (-542.712) -- 0:00:37
      356500 -- (-540.006) (-541.220) (-540.007) [-539.864] * (-541.138) (-541.032) [-541.394] (-539.371) -- 0:00:37
      357000 -- [-539.727] (-542.558) (-539.946) (-539.604) * (-539.856) (-542.479) [-541.432] (-543.277) -- 0:00:37
      357500 -- (-539.058) (-539.326) (-541.210) [-540.643] * (-541.028) (-540.874) (-539.201) [-538.791] -- 0:00:37
      358000 -- (-540.877) (-543.006) (-540.319) [-538.183] * (-545.047) (-542.348) (-538.462) [-538.310] -- 0:00:37
      358500 -- [-541.351] (-541.177) (-543.785) (-540.426) * (-540.846) [-541.550] (-540.355) (-540.603) -- 0:00:37
      359000 -- (-539.468) (-541.410) (-540.457) [-540.961] * (-542.481) [-540.173] (-542.331) (-540.404) -- 0:00:37
      359500 -- (-539.096) (-539.576) [-537.912] (-538.951) * [-541.960] (-541.836) (-543.986) (-540.817) -- 0:00:37
      360000 -- (-539.040) [-538.085] (-541.454) (-538.638) * (-542.395) (-540.974) [-543.916] (-539.454) -- 0:00:37

      Average standard deviation of split frequencies: 0.014051

      360500 -- [-540.714] (-538.209) (-540.555) (-539.441) * (-542.571) [-541.551] (-538.345) (-540.991) -- 0:00:37
      361000 -- (-540.757) [-543.239] (-538.177) (-537.999) * (-539.417) (-540.047) (-539.478) [-539.336] -- 0:00:37
      361500 -- (-539.891) (-544.749) [-540.964] (-538.445) * (-540.381) (-540.576) (-539.509) [-540.175] -- 0:00:37
      362000 -- (-540.910) [-539.551] (-541.534) (-538.718) * (-543.760) [-539.296] (-540.967) (-538.775) -- 0:00:37
      362500 -- (-542.204) (-539.047) (-538.106) [-539.719] * (-543.899) (-541.910) [-542.360] (-544.011) -- 0:00:36
      363000 -- (-538.909) (-538.626) [-539.353] (-540.074) * [-542.237] (-539.097) (-541.512) (-541.144) -- 0:00:36
      363500 -- [-541.639] (-538.741) (-539.101) (-543.766) * [-538.525] (-538.503) (-543.341) (-541.641) -- 0:00:36
      364000 -- [-540.220] (-538.718) (-540.095) (-543.071) * (-545.032) (-538.151) [-543.748] (-539.160) -- 0:00:36
      364500 -- (-538.724) (-539.786) [-538.921] (-543.095) * (-540.947) [-538.635] (-553.290) (-538.616) -- 0:00:36
      365000 -- (-539.007) (-542.215) (-540.011) [-542.765] * [-538.678] (-541.396) (-541.201) (-539.987) -- 0:00:36

      Average standard deviation of split frequencies: 0.014973

      365500 -- (-539.100) (-540.646) [-538.122] (-542.514) * (-538.609) [-539.870] (-540.524) (-541.470) -- 0:00:36
      366000 -- [-537.702] (-540.141) (-543.894) (-539.210) * [-539.331] (-539.817) (-539.422) (-538.389) -- 0:00:36
      366500 -- (-538.217) (-541.229) (-542.452) [-538.428] * (-540.504) [-539.787] (-539.260) (-539.094) -- 0:00:36
      367000 -- (-541.658) (-539.309) (-540.470) [-541.504] * (-539.091) (-543.454) [-541.270] (-540.669) -- 0:00:36
      367500 -- (-546.272) (-539.285) [-540.134] (-538.769) * (-540.499) (-539.555) [-541.360] (-540.561) -- 0:00:36
      368000 -- [-539.214] (-540.141) (-540.553) (-539.704) * (-540.225) (-538.975) (-538.248) [-539.096] -- 0:00:36
      368500 -- (-541.860) (-538.562) [-542.053] (-544.199) * (-540.666) (-540.331) (-539.243) [-539.128] -- 0:00:37
      369000 -- (-540.847) (-538.543) (-540.502) [-538.170] * (-540.557) (-541.431) [-539.109] (-541.664) -- 0:00:37
      369500 -- [-540.419] (-539.740) (-540.877) (-540.023) * [-543.420] (-541.249) (-541.227) (-541.629) -- 0:00:37
      370000 -- (-538.679) (-539.211) [-539.254] (-541.117) * (-540.799) (-540.265) [-541.164] (-539.658) -- 0:00:37

      Average standard deviation of split frequencies: 0.015023

      370500 -- (-540.704) [-540.707] (-538.818) (-538.831) * [-541.780] (-545.492) (-540.807) (-538.180) -- 0:00:37
      371000 -- (-540.748) (-541.688) [-538.657] (-539.064) * (-543.791) (-543.985) (-542.988) [-539.474] -- 0:00:37
      371500 -- (-541.198) (-546.133) (-538.375) [-538.841] * (-543.821) [-542.375] (-539.748) (-538.587) -- 0:00:37
      372000 -- (-541.330) (-539.735) (-542.530) [-540.538] * [-542.785] (-541.654) (-540.335) (-539.912) -- 0:00:37
      372500 -- (-539.936) (-541.188) (-540.703) [-540.522] * [-538.834] (-540.756) (-541.078) (-540.949) -- 0:00:37
      373000 -- (-539.946) (-539.610) (-540.882) [-542.840] * [-538.716] (-540.601) (-540.640) (-539.739) -- 0:00:36
      373500 -- (-540.647) (-541.414) [-540.058] (-539.483) * (-538.457) (-541.240) [-539.684] (-541.381) -- 0:00:36
      374000 -- [-539.014] (-543.100) (-541.115) (-539.652) * (-538.520) (-541.135) (-543.728) [-539.716] -- 0:00:36
      374500 -- (-540.344) (-539.326) [-541.015] (-540.395) * (-539.473) (-542.252) [-540.568] (-540.376) -- 0:00:36
      375000 -- (-542.117) [-542.915] (-543.449) (-539.995) * (-541.416) (-541.385) (-542.063) [-540.927] -- 0:00:36

      Average standard deviation of split frequencies: 0.014731

      375500 -- [-545.196] (-541.205) (-541.522) (-538.933) * (-539.059) (-540.386) (-543.281) [-539.347] -- 0:00:36
      376000 -- (-538.920) (-539.601) [-542.078] (-540.639) * (-538.693) [-539.143] (-543.604) (-543.037) -- 0:00:36
      376500 -- (-538.324) [-539.865] (-538.433) (-540.833) * [-537.814] (-540.867) (-538.855) (-540.691) -- 0:00:36
      377000 -- (-540.293) [-538.946] (-540.404) (-541.848) * [-541.235] (-540.844) (-547.337) (-539.702) -- 0:00:36
      377500 -- (-538.112) [-537.917] (-543.011) (-540.376) * (-541.762) [-541.446] (-540.700) (-539.167) -- 0:00:36
      378000 -- (-543.208) [-538.821] (-545.468) (-538.671) * (-538.613) (-541.897) (-541.715) [-541.800] -- 0:00:36
      378500 -- (-538.381) (-542.866) (-546.015) [-539.240] * (-539.300) [-539.349] (-542.844) (-540.345) -- 0:00:36
      379000 -- (-540.542) (-540.819) (-539.413) [-537.761] * (-539.812) (-539.723) [-539.220] (-539.091) -- 0:00:36
      379500 -- (-541.247) (-543.474) [-538.603] (-539.366) * [-538.144] (-544.815) (-539.244) (-540.184) -- 0:00:35
      380000 -- (-541.655) (-540.282) (-538.438) [-542.364] * [-539.570] (-540.455) (-537.946) (-540.506) -- 0:00:35

      Average standard deviation of split frequencies: 0.014009

      380500 -- (-540.027) [-539.035] (-540.043) (-541.074) * (-545.274) [-541.793] (-541.139) (-538.209) -- 0:00:35
      381000 -- (-542.109) [-539.735] (-538.286) (-542.984) * (-546.544) [-542.247] (-539.702) (-540.442) -- 0:00:35
      381500 -- (-540.218) (-540.077) [-538.440] (-539.509) * [-539.265] (-540.516) (-539.697) (-540.441) -- 0:00:35
      382000 -- [-538.921] (-540.726) (-541.646) (-538.391) * (-541.237) [-543.293] (-539.708) (-539.565) -- 0:00:35
      382500 -- [-538.776] (-538.504) (-539.496) (-539.271) * (-544.530) (-541.906) [-543.145] (-542.322) -- 0:00:35
      383000 -- [-538.335] (-541.435) (-539.580) (-539.405) * (-539.143) [-538.293] (-538.945) (-541.398) -- 0:00:37
      383500 -- (-539.298) (-540.563) [-541.020] (-538.250) * (-538.824) [-540.323] (-543.036) (-539.803) -- 0:00:36
      384000 -- (-539.627) (-538.690) [-540.268] (-541.095) * (-539.217) [-539.764] (-538.650) (-540.546) -- 0:00:36
      384500 -- [-539.332] (-539.276) (-540.440) (-541.423) * (-540.168) [-538.786] (-539.879) (-539.735) -- 0:00:36
      385000 -- (-541.673) [-540.583] (-543.582) (-540.192) * (-542.326) [-538.288] (-541.570) (-539.952) -- 0:00:36

      Average standard deviation of split frequencies: 0.014197

      385500 -- (-540.796) [-538.268] (-545.865) (-542.646) * (-539.439) (-540.493) (-541.062) [-539.980] -- 0:00:36
      386000 -- (-541.221) (-540.837) [-539.497] (-547.758) * (-537.841) (-541.515) [-540.577] (-538.958) -- 0:00:36
      386500 -- (-541.123) (-537.927) (-540.669) [-539.906] * (-539.892) (-540.778) [-541.502] (-540.905) -- 0:00:36
      387000 -- [-540.945] (-539.762) (-540.713) (-540.424) * [-541.738] (-541.417) (-538.510) (-539.693) -- 0:00:36
      387500 -- (-538.069) [-539.582] (-538.678) (-540.175) * (-539.793) (-543.196) [-540.466] (-541.598) -- 0:00:36
      388000 -- [-538.763] (-539.510) (-540.470) (-540.955) * (-540.003) (-538.922) (-539.465) [-542.436] -- 0:00:36
      388500 -- (-538.432) [-540.218] (-542.763) (-541.856) * [-541.059] (-543.878) (-541.721) (-540.736) -- 0:00:36
      389000 -- (-539.913) [-539.357] (-539.568) (-544.178) * (-538.839) [-538.424] (-541.838) (-543.338) -- 0:00:36
      389500 -- [-540.460] (-539.546) (-543.715) (-539.516) * (-539.738) (-540.442) [-541.270] (-544.042) -- 0:00:36
      390000 -- (-538.658) [-541.846] (-540.299) (-538.029) * (-539.088) (-539.794) [-541.418] (-539.206) -- 0:00:35

      Average standard deviation of split frequencies: 0.014782

      390500 -- (-539.595) (-539.296) (-538.538) [-538.310] * (-541.069) [-539.298] (-539.092) (-541.345) -- 0:00:35
      391000 -- (-540.214) (-542.456) [-539.556] (-541.150) * (-543.299) (-540.711) (-541.290) [-540.140] -- 0:00:35
      391500 -- [-539.948] (-541.232) (-537.932) (-545.112) * [-542.137] (-539.700) (-539.213) (-541.870) -- 0:00:35
      392000 -- (-538.411) (-538.901) [-537.748] (-539.426) * [-538.866] (-538.930) (-542.101) (-541.094) -- 0:00:35
      392500 -- (-539.666) (-538.380) [-539.724] (-547.469) * (-541.183) (-540.788) (-540.252) [-541.581] -- 0:00:35
      393000 -- (-538.722) [-538.571] (-540.697) (-541.691) * (-546.998) (-538.934) [-540.271] (-540.758) -- 0:00:35
      393500 -- (-541.404) [-540.114] (-541.195) (-539.959) * (-548.844) (-539.530) (-538.392) [-538.819] -- 0:00:35
      394000 -- (-541.919) (-539.055) [-539.727] (-539.270) * (-550.166) (-539.204) [-539.119] (-538.840) -- 0:00:35
      394500 -- [-540.476] (-538.265) (-540.052) (-540.341) * (-542.853) (-542.817) (-540.037) [-537.907] -- 0:00:35
      395000 -- (-541.507) (-539.320) (-540.021) [-538.800] * (-543.972) (-539.349) (-540.684) [-541.163] -- 0:00:35

      Average standard deviation of split frequencies: 0.014880

      395500 -- [-540.338] (-539.071) (-542.029) (-538.604) * (-542.144) (-538.646) (-542.145) [-540.082] -- 0:00:35
      396000 -- [-543.313] (-538.086) (-539.005) (-540.403) * (-539.371) (-539.866) (-541.622) [-538.892] -- 0:00:35
      396500 -- (-540.906) (-539.828) (-538.802) [-539.067] * [-539.425] (-538.720) (-540.521) (-541.264) -- 0:00:35
      397000 -- [-540.196] (-540.182) (-539.235) (-543.101) * [-539.589] (-537.815) (-538.273) (-541.200) -- 0:00:36
      397500 -- (-543.559) [-537.969] (-538.481) (-542.142) * (-538.885) (-538.089) [-539.295] (-541.425) -- 0:00:36
      398000 -- [-542.384] (-541.188) (-538.376) (-540.534) * (-540.775) (-539.424) [-538.210] (-541.526) -- 0:00:36
      398500 -- (-538.651) (-540.999) [-538.385] (-538.818) * [-539.587] (-539.695) (-539.431) (-540.121) -- 0:00:36
      399000 -- (-541.396) (-542.856) [-539.807] (-538.697) * (-544.652) [-538.999] (-542.341) (-543.584) -- 0:00:36
      399500 -- (-539.788) (-539.801) [-542.472] (-538.933) * (-540.345) (-539.689) [-539.049] (-539.158) -- 0:00:36
      400000 -- (-545.155) (-543.183) (-540.005) [-542.348] * [-540.663] (-538.903) (-541.939) (-539.035) -- 0:00:36

      Average standard deviation of split frequencies: 0.014413

      400500 -- (-541.289) (-540.505) [-540.873] (-542.837) * (-539.897) (-539.979) (-538.672) [-539.572] -- 0:00:35
      401000 -- (-539.651) [-540.970] (-540.665) (-542.006) * (-541.247) (-538.782) (-544.456) [-540.636] -- 0:00:35
      401500 -- (-540.960) (-541.189) [-539.944] (-538.438) * (-544.389) (-540.525) [-540.267] (-538.619) -- 0:00:35
      402000 -- (-541.369) (-540.242) (-539.725) [-538.684] * (-542.738) (-538.906) [-539.638] (-539.518) -- 0:00:35
      402500 -- (-538.916) (-538.601) (-544.339) [-538.999] * [-539.968] (-539.950) (-539.476) (-539.307) -- 0:00:35
      403000 -- [-539.122] (-541.702) (-543.114) (-539.457) * (-538.847) (-541.430) [-540.335] (-540.564) -- 0:00:35
      403500 -- [-539.420] (-541.355) (-538.962) (-538.448) * [-542.302] (-540.837) (-541.112) (-539.631) -- 0:00:35
      404000 -- (-539.056) (-538.759) (-539.567) [-541.157] * [-539.888] (-539.311) (-539.185) (-542.228) -- 0:00:35
      404500 -- (-539.705) (-544.561) [-541.623] (-541.622) * (-539.023) (-539.473) (-538.859) [-539.263] -- 0:00:35
      405000 -- [-538.995] (-542.286) (-540.700) (-539.515) * (-539.557) (-538.769) (-538.836) [-541.675] -- 0:00:35

      Average standard deviation of split frequencies: 0.014731

      405500 -- (-545.630) (-539.320) (-538.753) [-543.269] * (-539.752) (-547.652) [-544.530] (-543.418) -- 0:00:35
      406000 -- (-539.870) (-538.869) [-538.801] (-542.526) * (-541.825) (-540.425) (-541.485) [-538.193] -- 0:00:35
      406500 -- (-540.915) (-540.562) (-538.194) [-539.096] * (-546.482) [-539.358] (-545.100) (-539.259) -- 0:00:35
      407000 -- (-540.063) [-541.631] (-538.565) (-540.749) * (-541.933) (-543.040) (-544.466) [-538.744] -- 0:00:34
      407500 -- (-539.707) [-541.976] (-539.478) (-541.182) * [-540.350] (-539.678) (-543.006) (-548.518) -- 0:00:34
      408000 -- (-541.130) (-539.739) [-539.961] (-538.862) * [-540.787] (-540.785) (-540.751) (-540.863) -- 0:00:34
      408500 -- [-540.075] (-542.644) (-543.600) (-538.889) * (-543.147) (-539.145) (-542.275) [-541.317] -- 0:00:34
      409000 -- (-539.753) [-541.757] (-539.426) (-538.030) * (-539.550) (-538.977) [-540.649] (-540.835) -- 0:00:34
      409500 -- (-539.411) (-545.803) (-539.824) [-537.981] * (-538.225) (-538.861) [-539.280] (-538.665) -- 0:00:34
      410000 -- (-543.012) [-539.210] (-539.071) (-541.095) * (-538.942) (-540.681) (-540.645) [-539.031] -- 0:00:34

      Average standard deviation of split frequencies: 0.014923

      410500 -- (-540.380) (-542.084) (-545.650) [-539.322] * (-538.847) (-541.664) (-541.214) [-541.499] -- 0:00:34
      411000 -- (-541.643) [-540.242] (-546.919) (-540.513) * (-538.571) (-545.229) [-538.908] (-545.169) -- 0:00:34
      411500 -- (-540.928) (-545.121) [-540.584] (-540.655) * (-540.902) [-539.849] (-539.935) (-538.731) -- 0:00:34
      412000 -- (-541.099) (-546.390) (-540.004) [-538.999] * (-538.696) (-538.324) (-544.026) [-538.666] -- 0:00:35
      412500 -- [-540.739] (-539.861) (-540.833) (-541.399) * (-538.780) (-542.446) [-541.105] (-539.365) -- 0:00:35
      413000 -- (-541.031) (-539.365) (-539.621) [-539.802] * (-538.579) (-541.985) (-539.784) [-539.978] -- 0:00:35
      413500 -- (-539.205) (-539.912) [-541.785] (-541.226) * [-540.569] (-539.890) (-542.715) (-539.406) -- 0:00:35
      414000 -- (-538.876) [-537.702] (-541.514) (-544.292) * [-538.408] (-538.212) (-539.447) (-539.664) -- 0:00:35
      414500 -- [-540.388] (-539.590) (-540.778) (-539.473) * (-540.381) [-539.151] (-543.027) (-546.546) -- 0:00:35
      415000 -- (-539.356) (-539.159) [-539.966] (-539.124) * (-540.745) [-539.266] (-542.647) (-541.081) -- 0:00:35

      Average standard deviation of split frequencies: 0.014448

      415500 -- (-542.841) (-543.794) (-538.325) [-539.835] * (-539.894) (-543.078) (-538.405) [-540.730] -- 0:00:35
      416000 -- [-542.010] (-540.225) (-538.986) (-539.377) * (-543.456) (-541.407) [-538.504] (-540.330) -- 0:00:35
      416500 -- (-538.746) (-540.105) [-539.129] (-544.924) * (-540.387) (-540.700) (-539.635) [-539.124] -- 0:00:35
      417000 -- (-539.161) (-542.011) (-538.212) [-539.855] * (-538.907) [-540.568] (-539.355) (-541.975) -- 0:00:34
      417500 -- (-540.106) (-538.073) [-543.262] (-540.434) * (-539.921) [-539.951] (-539.019) (-540.883) -- 0:00:34
      418000 -- [-537.889] (-538.081) (-543.133) (-539.795) * [-542.670] (-540.239) (-538.424) (-539.417) -- 0:00:34
      418500 -- (-542.407) (-538.424) (-540.302) [-540.202] * [-540.284] (-541.625) (-540.910) (-538.831) -- 0:00:34
      419000 -- [-539.987] (-539.008) (-539.327) (-540.821) * (-540.756) (-542.750) (-541.295) [-538.702] -- 0:00:34
      419500 -- (-540.728) (-540.060) [-540.221] (-541.096) * [-539.641] (-542.484) (-540.899) (-538.740) -- 0:00:34
      420000 -- (-539.899) (-537.883) (-540.191) [-538.335] * (-540.036) [-546.835] (-543.910) (-539.926) -- 0:00:34

      Average standard deviation of split frequencies: 0.014848

      420500 -- (-539.922) [-539.061] (-541.026) (-539.338) * [-541.365] (-540.572) (-545.725) (-541.189) -- 0:00:34
      421000 -- (-539.205) (-541.948) (-540.422) [-538.435] * (-540.129) [-537.964] (-542.629) (-539.863) -- 0:00:34
      421500 -- [-541.680] (-539.887) (-542.167) (-538.447) * (-539.085) (-538.080) [-539.115] (-538.487) -- 0:00:34
      422000 -- [-538.989] (-539.413) (-539.144) (-538.263) * (-538.326) (-538.641) (-541.182) [-538.471] -- 0:00:34
      422500 -- (-540.747) [-538.321] (-539.185) (-539.351) * (-550.346) (-543.690) (-539.791) [-539.838] -- 0:00:34
      423000 -- [-542.153] (-542.596) (-540.593) (-542.279) * (-540.729) (-540.771) [-542.630] (-539.668) -- 0:00:34
      423500 -- [-539.509] (-539.731) (-539.306) (-543.562) * (-540.247) (-540.225) [-538.623] (-539.526) -- 0:00:34
      424000 -- (-539.377) [-539.740] (-541.066) (-539.240) * (-538.110) [-541.806] (-539.196) (-539.934) -- 0:00:33
      424500 -- (-542.954) (-541.499) (-542.403) [-538.158] * [-540.530] (-538.637) (-540.178) (-538.565) -- 0:00:33
      425000 -- (-539.517) [-539.903] (-541.360) (-540.291) * (-544.762) (-541.149) (-542.396) [-538.666] -- 0:00:33

      Average standard deviation of split frequencies: 0.015561

      425500 -- (-540.403) (-540.023) (-538.720) [-542.977] * (-545.962) [-542.948] (-542.038) (-539.099) -- 0:00:33
      426000 -- (-538.666) (-539.973) (-542.307) [-542.889] * (-539.241) (-542.305) (-539.200) [-541.777] -- 0:00:33
      426500 -- (-540.157) (-545.568) (-540.586) [-539.003] * (-540.699) (-544.487) (-542.981) [-540.263] -- 0:00:34
      427000 -- (-540.024) (-545.729) (-539.060) [-538.377] * [-540.824] (-541.086) (-543.079) (-543.253) -- 0:00:34
      427500 -- (-538.482) (-542.316) (-540.024) [-538.541] * (-540.631) [-537.937] (-538.912) (-542.258) -- 0:00:34
      428000 -- (-539.421) [-538.783] (-538.767) (-538.490) * (-540.696) (-538.864) [-540.580] (-539.142) -- 0:00:34
      428500 -- [-540.279] (-542.110) (-540.808) (-539.195) * [-539.797] (-542.324) (-538.592) (-540.142) -- 0:00:34
      429000 -- (-539.868) [-550.126] (-541.143) (-542.392) * (-540.287) [-545.943] (-541.599) (-538.975) -- 0:00:34
      429500 -- [-538.628] (-540.207) (-546.180) (-539.374) * [-541.297] (-543.554) (-546.022) (-544.024) -- 0:00:34
      430000 -- (-540.082) [-539.318] (-540.249) (-540.773) * (-542.016) (-540.887) (-540.944) [-539.974] -- 0:00:34

      Average standard deviation of split frequencies: 0.015530

      430500 -- [-538.763] (-538.749) (-537.929) (-539.639) * (-540.421) (-539.766) [-539.775] (-544.506) -- 0:00:34
      431000 -- [-540.430] (-541.433) (-538.622) (-541.422) * (-541.800) (-538.841) [-538.687] (-542.299) -- 0:00:34
      431500 -- (-539.336) (-544.802) (-539.737) [-541.578] * [-537.718] (-541.250) (-539.268) (-539.666) -- 0:00:34
      432000 -- (-539.493) (-539.443) [-539.997] (-542.766) * [-540.058] (-544.773) (-540.459) (-540.503) -- 0:00:34
      432500 -- (-540.246) [-540.558] (-540.167) (-540.822) * [-538.858] (-544.804) (-541.478) (-541.218) -- 0:00:34
      433000 -- (-538.139) [-545.298] (-543.299) (-541.521) * (-538.731) (-539.373) (-539.385) [-541.013] -- 0:00:34
      433500 -- [-539.265] (-538.703) (-541.767) (-537.678) * (-540.638) (-542.208) [-546.911] (-540.031) -- 0:00:33
      434000 -- [-538.197] (-538.852) (-538.925) (-539.933) * [-541.653] (-539.950) (-542.513) (-542.458) -- 0:00:33
      434500 -- (-538.714) (-538.620) (-539.499) [-538.450] * (-540.477) [-539.066] (-541.235) (-541.569) -- 0:00:33
      435000 -- (-538.623) (-540.086) (-540.999) [-538.394] * [-539.625] (-537.901) (-541.268) (-542.380) -- 0:00:33

      Average standard deviation of split frequencies: 0.015137

      435500 -- (-538.520) [-539.855] (-538.463) (-539.414) * (-539.082) (-541.816) (-540.902) [-542.655] -- 0:00:33
      436000 -- (-538.322) [-541.786] (-539.767) (-541.048) * (-538.257) (-539.902) (-542.659) [-540.961] -- 0:00:33
      436500 -- (-538.583) [-539.513] (-541.255) (-540.752) * [-541.633] (-545.084) (-539.747) (-544.481) -- 0:00:33
      437000 -- (-543.100) (-542.989) [-540.872] (-538.762) * (-539.950) (-544.395) [-539.221] (-539.299) -- 0:00:33
      437500 -- [-539.590] (-543.355) (-540.053) (-541.110) * (-539.077) (-540.790) [-541.125] (-539.755) -- 0:00:33
      438000 -- (-543.492) [-542.665] (-539.086) (-539.528) * (-539.681) (-539.255) (-538.626) [-539.390] -- 0:00:33
      438500 -- (-541.119) (-543.189) [-539.213] (-539.900) * [-539.111] (-539.696) (-539.664) (-540.317) -- 0:00:33
      439000 -- [-541.393] (-539.259) (-540.319) (-542.967) * (-539.780) [-539.286] (-539.656) (-539.108) -- 0:00:33
      439500 -- (-539.607) [-540.122] (-539.774) (-542.193) * [-541.332] (-541.440) (-542.420) (-540.970) -- 0:00:33
      440000 -- (-541.521) [-538.408] (-541.526) (-540.230) * (-540.670) (-539.459) [-541.437] (-539.095) -- 0:00:33

      Average standard deviation of split frequencies: 0.015244

      440500 -- (-539.443) (-538.229) (-539.873) [-540.389] * (-538.589) [-539.371] (-538.891) (-541.357) -- 0:00:33
      441000 -- (-542.460) (-540.387) (-539.378) [-538.454] * [-538.841] (-539.789) (-538.814) (-539.756) -- 0:00:32
      441500 -- [-539.719] (-539.387) (-538.147) (-544.420) * (-541.922) [-538.705] (-539.777) (-542.066) -- 0:00:32
      442000 -- (-539.123) (-540.066) (-538.745) [-543.468] * [-539.952] (-540.641) (-538.106) (-542.159) -- 0:00:32
      442500 -- [-542.806] (-538.446) (-540.075) (-539.614) * (-544.257) (-538.923) (-542.395) [-539.944] -- 0:00:32
      443000 -- (-540.820) (-539.666) [-539.679] (-538.249) * (-544.780) (-540.220) (-538.977) [-539.663] -- 0:00:32
      443500 -- (-540.167) [-540.894] (-540.509) (-539.805) * (-544.024) [-542.076] (-539.809) (-541.020) -- 0:00:32
      444000 -- (-541.769) (-540.983) [-538.357] (-541.699) * (-539.789) (-538.398) [-542.227] (-540.432) -- 0:00:33
      444500 -- (-539.829) [-539.131] (-546.567) (-539.220) * (-538.614) (-539.867) [-540.621] (-539.595) -- 0:00:33
      445000 -- (-543.493) (-541.837) [-542.042] (-543.356) * (-538.434) (-542.162) [-540.483] (-540.910) -- 0:00:33

      Average standard deviation of split frequencies: 0.015854

      445500 -- [-538.306] (-538.519) (-540.209) (-539.320) * (-538.436) (-541.969) [-540.597] (-542.002) -- 0:00:33
      446000 -- (-540.441) (-542.221) (-538.444) [-540.079] * (-542.045) (-542.320) (-540.214) [-541.846] -- 0:00:33
      446500 -- (-541.112) (-539.750) [-538.341] (-539.060) * (-541.412) (-540.957) [-539.935] (-538.456) -- 0:00:33
      447000 -- (-543.470) (-540.920) (-545.783) [-539.898] * (-539.905) (-543.328) [-542.788] (-539.519) -- 0:00:33
      447500 -- (-542.824) (-540.396) [-542.030] (-550.402) * (-538.853) [-540.134] (-542.817) (-538.413) -- 0:00:33
      448000 -- (-538.602) (-541.233) [-540.197] (-545.307) * [-538.724] (-538.628) (-541.628) (-539.832) -- 0:00:33
      448500 -- (-539.687) (-542.303) [-540.573] (-542.470) * (-539.201) (-538.441) (-539.502) [-538.862] -- 0:00:33
      449000 -- [-539.676] (-540.025) (-539.301) (-539.813) * (-540.205) (-541.979) [-542.218] (-539.524) -- 0:00:33
      449500 -- (-541.066) (-540.950) (-540.351) [-538.952] * (-540.889) (-542.090) (-542.111) [-541.169] -- 0:00:33
      450000 -- [-541.991] (-542.946) (-541.250) (-538.909) * (-540.728) [-539.032] (-539.418) (-544.831) -- 0:00:33

      Average standard deviation of split frequencies: 0.015875

      450500 -- (-540.444) (-540.866) [-540.474] (-538.189) * (-540.052) (-540.164) (-538.712) [-538.963] -- 0:00:32
      451000 -- (-538.959) (-542.823) [-540.459] (-541.816) * (-544.902) (-540.118) [-538.233] (-539.334) -- 0:00:32
      451500 -- (-539.115) [-540.578] (-539.550) (-540.737) * (-540.290) (-538.873) [-538.350] (-538.055) -- 0:00:32
      452000 -- (-545.644) (-541.296) [-540.244] (-541.838) * (-540.651) (-541.828) [-539.435] (-538.627) -- 0:00:32
      452500 -- (-543.290) (-539.581) [-540.389] (-540.830) * (-540.794) (-541.919) [-538.515] (-540.655) -- 0:00:32
      453000 -- (-539.319) (-541.501) [-540.660] (-538.804) * (-540.208) (-539.520) [-538.958] (-539.914) -- 0:00:32
      453500 -- (-543.143) [-543.430] (-538.159) (-538.281) * (-539.165) [-540.349] (-542.483) (-541.986) -- 0:00:32
      454000 -- (-543.026) [-542.573] (-543.464) (-539.193) * (-539.767) [-538.922] (-543.754) (-542.345) -- 0:00:32
      454500 -- (-538.576) [-538.422] (-547.924) (-540.937) * (-542.056) (-539.766) [-539.701] (-541.293) -- 0:00:32
      455000 -- (-540.975) (-539.951) [-539.369] (-540.148) * (-540.413) (-540.753) [-539.630] (-542.636) -- 0:00:32

      Average standard deviation of split frequencies: 0.016054

      455500 -- (-540.545) (-540.333) (-542.746) [-540.374] * [-539.185] (-539.830) (-545.252) (-539.936) -- 0:00:32
      456000 -- (-538.491) (-540.265) [-539.088] (-539.254) * [-540.517] (-537.980) (-543.169) (-544.340) -- 0:00:32
      456500 -- (-540.596) (-539.644) [-540.433] (-542.430) * (-538.679) (-539.314) (-543.172) [-539.035] -- 0:00:32
      457000 -- [-538.974] (-544.156) (-543.568) (-539.102) * (-538.530) [-538.835] (-538.507) (-538.964) -- 0:00:32
      457500 -- (-540.820) (-538.890) (-539.192) [-540.670] * [-540.279] (-540.145) (-542.875) (-541.590) -- 0:00:32
      458000 -- (-543.744) (-539.868) [-538.932] (-543.656) * [-540.690] (-539.442) (-543.759) (-541.912) -- 0:00:31
      458500 -- (-544.431) (-545.240) (-538.933) [-538.491] * [-538.396] (-540.165) (-548.634) (-540.423) -- 0:00:31
      459000 -- [-538.368] (-542.978) (-538.284) (-545.042) * (-546.780) (-540.504) (-543.407) [-540.906] -- 0:00:31
      459500 -- (-539.601) (-538.560) (-543.316) [-544.013] * [-542.171] (-544.111) (-542.799) (-541.924) -- 0:00:31
      460000 -- (-540.001) [-540.044] (-539.552) (-543.157) * (-539.556) (-540.605) (-541.151) [-540.569] -- 0:00:31

      Average standard deviation of split frequencies: 0.015771

      460500 -- (-538.482) (-542.203) (-540.795) [-540.233] * (-541.208) (-538.462) [-544.660] (-540.825) -- 0:00:31
      461000 -- (-539.341) (-540.776) (-539.489) [-538.906] * [-539.436] (-540.958) (-543.459) (-539.062) -- 0:00:32
      461500 -- [-540.975] (-538.800) (-538.949) (-538.935) * (-540.936) (-539.157) (-544.840) [-541.143] -- 0:00:32
      462000 -- (-541.262) (-539.611) (-538.546) [-538.445] * [-540.620] (-539.266) (-539.958) (-541.823) -- 0:00:32
      462500 -- (-540.725) (-539.599) [-539.239] (-539.038) * [-543.661] (-541.217) (-541.500) (-540.192) -- 0:00:32
      463000 -- (-538.695) [-540.243] (-541.997) (-541.798) * [-539.451] (-540.605) (-538.847) (-539.278) -- 0:00:32
      463500 -- (-540.470) (-538.323) [-542.400] (-539.580) * [-539.967] (-539.556) (-540.942) (-539.394) -- 0:00:32
      464000 -- (-544.560) (-544.005) [-539.778] (-542.416) * (-539.150) [-538.995] (-539.809) (-538.663) -- 0:00:32
      464500 -- [-540.346] (-539.036) (-542.142) (-540.465) * (-537.839) (-540.546) [-547.118] (-538.173) -- 0:00:32
      465000 -- [-538.465] (-540.030) (-540.153) (-541.766) * (-541.353) (-538.819) (-545.447) [-538.729] -- 0:00:32

      Average standard deviation of split frequencies: 0.015948

      465500 -- (-537.885) [-539.787] (-540.174) (-542.411) * (-538.417) (-538.381) [-539.184] (-539.326) -- 0:00:32
      466000 -- (-537.884) [-539.425] (-543.650) (-538.424) * (-541.444) (-544.463) [-539.200] (-540.244) -- 0:00:32
      466500 -- [-541.603] (-538.596) (-542.945) (-540.326) * (-541.685) [-537.955] (-540.071) (-539.892) -- 0:00:32
      467000 -- [-538.970] (-540.763) (-540.066) (-539.384) * (-542.115) (-539.270) (-543.270) [-539.179] -- 0:00:31
      467500 -- [-539.955] (-541.429) (-539.319) (-540.267) * (-541.168) [-539.246] (-542.026) (-539.593) -- 0:00:31
      468000 -- [-540.227] (-539.541) (-542.234) (-538.907) * (-543.887) [-540.751] (-538.571) (-538.248) -- 0:00:31
      468500 -- (-538.876) [-542.182] (-539.135) (-541.742) * (-541.081) (-539.561) (-539.811) [-538.393] -- 0:00:31
      469000 -- (-539.946) [-539.584] (-538.414) (-541.481) * [-538.553] (-540.944) (-541.060) (-542.680) -- 0:00:31
      469500 -- [-539.026] (-539.016) (-539.735) (-539.351) * (-540.244) (-540.840) (-539.309) [-542.697] -- 0:00:31
      470000 -- [-539.877] (-539.832) (-541.077) (-543.435) * (-541.590) [-537.978] (-543.576) (-543.872) -- 0:00:31

      Average standard deviation of split frequencies: 0.015377

      470500 -- (-538.301) (-538.145) (-538.916) [-542.096] * [-538.956] (-540.033) (-539.815) (-544.653) -- 0:00:31
      471000 -- (-539.418) (-538.717) (-540.858) [-540.850] * (-538.854) [-541.099] (-542.280) (-544.601) -- 0:00:31
      471500 -- (-540.516) [-538.283] (-541.478) (-538.887) * (-540.985) [-541.639] (-539.843) (-548.574) -- 0:00:31
      472000 -- (-541.730) [-538.860] (-539.893) (-543.942) * (-540.891) (-538.780) [-543.051] (-542.514) -- 0:00:31
      472500 -- [-542.831] (-539.768) (-541.903) (-543.365) * (-542.438) (-538.498) (-541.737) [-541.977] -- 0:00:31
      473000 -- [-538.543] (-538.894) (-540.935) (-543.503) * (-543.135) (-539.432) (-545.347) [-540.776] -- 0:00:31
      473500 -- (-539.200) [-540.017] (-538.731) (-541.952) * (-540.495) (-540.371) [-541.031] (-540.128) -- 0:00:31
      474000 -- (-538.514) (-539.362) [-541.427] (-541.472) * (-538.797) (-538.932) [-538.517] (-540.719) -- 0:00:31
      474500 -- [-540.117] (-538.891) (-541.991) (-539.935) * (-542.123) (-540.899) (-540.111) [-538.716] -- 0:00:31
      475000 -- [-543.368] (-538.875) (-540.076) (-539.891) * (-542.462) [-540.679] (-539.991) (-538.955) -- 0:00:30

      Average standard deviation of split frequencies: 0.015379

      475500 -- [-539.437] (-542.429) (-538.848) (-540.831) * (-538.471) (-541.711) (-541.539) [-539.371] -- 0:00:30
      476000 -- (-542.195) (-541.881) [-539.353] (-541.862) * (-538.946) [-539.996] (-542.463) (-538.854) -- 0:00:30
      476500 -- [-539.216] (-539.036) (-538.862) (-541.516) * (-541.153) (-540.724) [-541.335] (-540.133) -- 0:00:30
      477000 -- [-542.275] (-540.725) (-541.047) (-544.474) * (-540.253) [-539.021] (-539.841) (-544.346) -- 0:00:30
      477500 -- (-541.266) (-539.923) [-540.842] (-540.033) * (-540.600) (-540.711) [-542.803] (-539.231) -- 0:00:30
      478000 -- [-539.188] (-541.832) (-539.424) (-538.566) * (-539.343) (-539.576) (-540.236) [-538.083] -- 0:00:31
      478500 -- (-538.973) (-540.053) [-539.627] (-540.600) * (-540.545) (-542.346) [-539.747] (-538.844) -- 0:00:31
      479000 -- [-540.288] (-539.206) (-540.045) (-539.153) * [-540.513] (-541.863) (-539.536) (-539.238) -- 0:00:31
      479500 -- [-539.141] (-540.511) (-541.645) (-541.735) * (-539.667) (-543.144) (-539.663) [-542.631] -- 0:00:31
      480000 -- (-538.450) (-542.270) (-541.533) [-539.461] * (-540.188) (-541.982) [-539.790] (-544.608) -- 0:00:31

      Average standard deviation of split frequencies: 0.014999

      480500 -- (-538.659) (-539.986) [-540.254] (-541.693) * (-538.591) (-540.904) (-538.744) [-541.151] -- 0:00:31
      481000 -- (-538.929) (-540.014) [-539.528] (-538.858) * (-538.004) (-538.997) (-539.079) [-541.565] -- 0:00:31
      481500 -- [-540.994] (-539.057) (-538.565) (-539.197) * (-538.415) [-540.335] (-538.701) (-541.806) -- 0:00:31
      482000 -- (-540.247) (-539.988) [-539.007] (-542.970) * (-541.981) (-541.450) [-538.802] (-540.070) -- 0:00:31
      482500 -- [-540.087] (-539.683) (-539.298) (-544.144) * (-540.751) [-539.274] (-538.906) (-540.760) -- 0:00:31
      483000 -- (-541.137) [-538.953] (-540.340) (-543.461) * (-539.127) (-540.150) [-542.775] (-541.434) -- 0:00:31
      483500 -- (-538.579) (-540.053) [-540.248] (-538.820) * (-539.305) [-538.445] (-538.877) (-540.569) -- 0:00:30
      484000 -- (-541.037) (-539.856) [-538.984] (-547.753) * (-542.209) [-540.088] (-539.557) (-540.344) -- 0:00:30
      484500 -- (-541.624) (-540.042) (-540.289) [-539.460] * (-541.142) (-538.674) (-543.866) [-539.109] -- 0:00:30
      485000 -- (-542.537) (-539.250) (-541.318) [-540.996] * (-539.975) (-539.783) [-539.168] (-539.113) -- 0:00:30

      Average standard deviation of split frequencies: 0.015462

      485500 -- [-539.985] (-542.271) (-540.619) (-545.398) * (-538.683) (-539.288) (-539.163) [-539.369] -- 0:00:30
      486000 -- [-540.579] (-540.473) (-537.806) (-541.515) * [-540.290] (-540.542) (-538.535) (-538.850) -- 0:00:30
      486500 -- (-541.983) [-538.232] (-542.427) (-544.065) * (-539.910) (-539.884) (-539.791) [-538.143] -- 0:00:30
      487000 -- (-540.061) (-541.098) [-540.070] (-545.170) * (-543.084) [-541.731] (-539.450) (-544.252) -- 0:00:30
      487500 -- (-539.331) (-540.633) (-540.224) [-541.620] * (-542.715) [-540.422] (-544.427) (-541.846) -- 0:00:30
      488000 -- (-540.292) [-539.142] (-544.141) (-538.978) * [-541.309] (-541.840) (-543.400) (-542.222) -- 0:00:30
      488500 -- (-539.508) (-544.278) [-541.974] (-538.759) * (-538.908) (-541.549) (-540.791) [-538.599] -- 0:00:30
      489000 -- (-538.918) [-538.783] (-542.496) (-542.657) * (-539.609) (-541.729) (-539.427) [-539.574] -- 0:00:30
      489500 -- (-538.283) (-537.893) (-538.614) [-540.140] * (-542.145) (-540.032) (-544.426) [-542.155] -- 0:00:30
      490000 -- (-540.958) (-541.212) [-540.196] (-542.660) * (-539.569) [-540.091] (-540.191) (-539.789) -- 0:00:30

      Average standard deviation of split frequencies: 0.015259

      490500 -- [-541.237] (-542.006) (-540.629) (-538.525) * (-540.708) [-541.690] (-543.335) (-539.243) -- 0:00:30
      491000 -- (-540.172) (-540.716) (-540.430) [-538.156] * (-538.124) (-544.817) (-542.403) [-539.027] -- 0:00:30
      491500 -- (-538.597) [-540.709] (-539.570) (-538.502) * (-539.771) [-540.266] (-540.368) (-540.693) -- 0:00:30
      492000 -- (-545.652) (-541.261) [-542.062] (-540.763) * (-539.383) (-540.474) (-541.561) [-541.074] -- 0:00:29
      492500 -- (-540.620) [-540.548] (-542.031) (-545.045) * (-541.900) (-542.771) [-541.442] (-539.830) -- 0:00:29
      493000 -- (-541.626) (-540.432) [-539.508] (-538.000) * (-541.123) (-540.049) (-539.288) [-539.656] -- 0:00:29
      493500 -- [-543.396] (-543.576) (-541.164) (-540.313) * (-542.404) [-541.572] (-538.839) (-542.112) -- 0:00:29
      494000 -- (-541.351) (-538.622) [-541.670] (-539.685) * (-545.490) (-544.224) [-541.514] (-541.558) -- 0:00:29
      494500 -- (-541.469) [-540.320] (-540.340) (-539.687) * [-542.627] (-541.766) (-542.596) (-539.706) -- 0:00:29
      495000 -- (-544.368) (-541.484) (-540.127) [-539.103] * (-540.384) (-539.086) [-540.178] (-543.187) -- 0:00:29

      Average standard deviation of split frequencies: 0.014703

      495500 -- (-540.738) (-543.310) (-540.691) [-542.165] * (-547.458) (-538.516) (-542.476) [-540.876] -- 0:00:30
      496000 -- (-539.322) [-541.618] (-539.381) (-540.424) * (-540.039) (-538.803) [-542.569] (-545.350) -- 0:00:30
      496500 -- (-539.506) [-540.052] (-538.469) (-544.213) * (-540.455) (-538.268) [-540.603] (-543.939) -- 0:00:30
      497000 -- (-538.531) [-539.445] (-539.805) (-538.638) * (-540.639) (-538.015) [-541.850] (-539.024) -- 0:00:30
      497500 -- (-539.431) (-541.911) [-543.608] (-539.459) * (-539.057) (-538.406) (-541.220) [-540.103] -- 0:00:30
      498000 -- [-538.544] (-539.264) (-540.916) (-541.963) * (-538.928) [-538.377] (-541.499) (-539.139) -- 0:00:30
      498500 -- (-538.975) [-539.765] (-539.203) (-541.065) * [-539.827] (-538.903) (-540.357) (-541.673) -- 0:00:30
      499000 -- (-540.436) (-542.232) [-540.013] (-540.051) * (-539.386) (-539.938) [-541.357] (-540.602) -- 0:00:30
      499500 -- (-538.836) (-539.854) [-541.193] (-542.234) * (-538.981) [-540.010] (-541.170) (-539.688) -- 0:00:30
      500000 -- [-539.490] (-539.124) (-544.172) (-547.453) * (-539.622) (-541.796) (-538.670) [-538.494] -- 0:00:30

      Average standard deviation of split frequencies: 0.014788

      500500 -- (-538.845) [-540.377] (-540.169) (-541.322) * (-539.112) (-540.118) [-542.828] (-539.477) -- 0:00:29
      501000 -- [-541.409] (-538.443) (-540.427) (-538.700) * (-539.849) (-538.914) (-540.243) [-540.110] -- 0:00:29
      501500 -- (-542.843) (-543.629) (-540.259) [-538.148] * (-538.960) (-538.532) (-540.080) [-543.260] -- 0:00:29
      502000 -- (-544.282) [-539.769] (-540.258) (-539.128) * [-538.261] (-541.214) (-540.668) (-540.993) -- 0:00:29
      502500 -- (-540.174) (-538.787) [-538.519] (-539.589) * (-543.885) (-538.639) [-538.377] (-541.106) -- 0:00:29
      503000 -- [-539.691] (-542.939) (-540.442) (-540.398) * (-544.265) (-539.405) [-539.011] (-542.345) -- 0:00:29
      503500 -- (-539.026) (-541.314) [-542.195] (-544.925) * (-542.826) [-540.834] (-539.690) (-547.606) -- 0:00:29
      504000 -- (-538.236) [-541.228] (-541.755) (-541.518) * (-540.437) (-540.292) [-538.763] (-541.465) -- 0:00:29
      504500 -- (-538.579) (-538.762) [-539.295] (-545.000) * [-537.971] (-543.141) (-540.996) (-542.193) -- 0:00:29
      505000 -- [-541.753] (-539.034) (-539.780) (-540.313) * (-538.539) (-539.218) (-541.492) [-539.924] -- 0:00:29

      Average standard deviation of split frequencies: 0.014577

      505500 -- (-543.664) [-540.983] (-540.407) (-539.247) * (-541.916) (-541.426) (-539.812) [-538.973] -- 0:00:29
      506000 -- (-539.812) [-539.112] (-539.447) (-538.203) * (-539.339) (-540.961) [-541.493] (-539.402) -- 0:00:29
      506500 -- (-539.882) [-538.787] (-542.616) (-540.226) * [-538.846] (-540.888) (-538.313) (-540.895) -- 0:00:29
      507000 -- (-545.007) (-542.112) (-539.019) [-540.522] * [-538.952] (-540.011) (-540.440) (-539.776) -- 0:00:29
      507500 -- [-538.651] (-541.623) (-542.412) (-542.261) * (-538.841) (-542.040) [-539.819] (-540.988) -- 0:00:29
      508000 -- (-540.018) (-539.010) [-541.303] (-541.835) * [-540.746] (-541.730) (-542.064) (-539.520) -- 0:00:29
      508500 -- (-539.421) (-538.403) (-539.679) [-538.759] * (-539.527) (-545.860) [-544.309] (-539.862) -- 0:00:28
      509000 -- (-539.676) (-539.719) [-538.640] (-542.823) * (-538.638) [-540.769] (-543.546) (-541.591) -- 0:00:28
      509500 -- (-539.791) (-538.225) (-541.086) [-540.086] * (-540.702) [-543.847] (-540.415) (-542.505) -- 0:00:28
      510000 -- (-545.504) (-542.440) [-539.585] (-538.581) * (-540.674) (-540.549) (-538.928) [-538.756] -- 0:00:28

      Average standard deviation of split frequencies: 0.014390

      510500 -- [-539.036] (-541.696) (-542.938) (-542.446) * [-539.524] (-542.542) (-538.065) (-539.202) -- 0:00:28
      511000 -- (-539.862) (-542.393) (-541.072) [-539.427] * [-542.069] (-539.307) (-539.486) (-540.764) -- 0:00:28
      511500 -- [-539.246] (-545.989) (-538.211) (-539.243) * [-540.736] (-540.944) (-539.752) (-540.589) -- 0:00:29
      512000 -- (-542.075) (-541.056) (-542.863) [-541.354] * (-540.170) [-539.053] (-539.792) (-539.417) -- 0:00:29
      512500 -- [-543.454] (-540.412) (-539.669) (-540.669) * (-546.421) [-538.751] (-545.493) (-539.775) -- 0:00:29
      513000 -- [-542.333] (-538.747) (-539.459) (-541.480) * (-541.879) (-539.625) (-545.350) [-541.680] -- 0:00:29
      513500 -- [-544.909] (-541.540) (-540.595) (-540.734) * [-540.430] (-539.412) (-540.608) (-540.163) -- 0:00:29
      514000 -- (-541.976) (-539.903) (-544.528) [-540.011] * (-540.881) (-540.826) (-539.450) [-539.051] -- 0:00:29
      514500 -- [-538.986] (-539.818) (-540.495) (-540.811) * (-543.978) [-540.312] (-538.380) (-541.455) -- 0:00:29
      515000 -- (-543.105) [-539.706] (-540.088) (-543.707) * (-540.969) (-539.696) [-540.053] (-543.857) -- 0:00:29

      Average standard deviation of split frequencies: 0.014563

      515500 -- [-538.839] (-538.830) (-540.526) (-540.486) * (-543.803) (-539.678) (-539.938) [-540.158] -- 0:00:29
      516000 -- (-543.050) (-541.239) (-539.315) [-539.415] * (-540.077) (-538.323) [-540.278] (-542.990) -- 0:00:29
      516500 -- (-538.891) (-548.000) (-540.811) [-539.292] * [-538.696] (-538.703) (-540.459) (-540.246) -- 0:00:29
      517000 -- (-538.129) (-539.826) (-541.755) [-538.909] * (-538.951) (-538.441) (-538.505) [-540.912] -- 0:00:28
      517500 -- [-539.231] (-542.172) (-539.150) (-540.735) * [-540.817] (-544.346) (-539.392) (-540.558) -- 0:00:28
      518000 -- [-540.331] (-541.695) (-538.312) (-539.032) * [-541.277] (-538.399) (-543.103) (-539.815) -- 0:00:28
      518500 -- (-543.195) [-539.445] (-541.155) (-542.783) * (-541.132) (-540.331) (-541.132) [-540.544] -- 0:00:28
      519000 -- [-540.791] (-541.116) (-540.639) (-542.686) * [-539.922] (-545.053) (-541.238) (-539.145) -- 0:00:28
      519500 -- (-539.725) (-539.218) (-541.150) [-539.597] * (-540.650) (-538.855) (-542.392) [-539.550] -- 0:00:28
      520000 -- (-539.288) [-538.208] (-539.727) (-540.053) * (-539.919) (-538.749) [-539.510] (-539.233) -- 0:00:28

      Average standard deviation of split frequencies: 0.014373

      520500 -- [-539.201] (-538.786) (-539.360) (-538.681) * (-539.648) (-538.723) (-539.848) [-540.037] -- 0:00:28
      521000 -- (-544.146) (-539.863) (-539.661) [-539.587] * (-540.176) (-539.624) [-538.971] (-539.267) -- 0:00:28
      521500 -- (-539.307) [-539.754] (-541.477) (-538.733) * (-543.553) [-539.022] (-541.013) (-541.303) -- 0:00:28
      522000 -- (-541.204) [-539.780] (-544.142) (-537.852) * (-543.330) (-540.868) [-544.486] (-542.987) -- 0:00:28
      522500 -- (-541.240) (-541.268) (-544.532) [-538.580] * (-541.449) [-540.629] (-541.069) (-546.120) -- 0:00:28
      523000 -- (-539.510) [-540.457] (-544.372) (-541.836) * [-538.200] (-539.683) (-541.746) (-539.399) -- 0:00:28
      523500 -- (-538.823) (-539.516) (-540.295) [-545.484] * [-538.893] (-538.639) (-540.042) (-538.733) -- 0:00:28
      524000 -- [-540.556] (-539.156) (-539.983) (-539.302) * (-539.568) [-539.382] (-538.840) (-540.359) -- 0:00:28
      524500 -- (-540.493) (-542.355) (-541.875) [-540.742] * (-538.190) (-538.190) [-538.941] (-540.449) -- 0:00:28
      525000 -- [-540.255] (-540.397) (-539.419) (-539.052) * [-539.493] (-539.840) (-539.556) (-539.784) -- 0:00:28

      Average standard deviation of split frequencies: 0.013622

      525500 -- [-540.289] (-541.045) (-539.390) (-538.567) * (-539.786) [-538.447] (-540.940) (-540.404) -- 0:00:27
      526000 -- (-545.186) (-540.208) [-538.826] (-543.716) * [-539.856] (-538.591) (-541.870) (-541.903) -- 0:00:27
      526500 -- (-540.637) (-539.217) (-540.494) [-539.310] * [-539.835] (-540.444) (-543.858) (-543.033) -- 0:00:27
      527000 -- (-539.254) (-540.792) [-538.933] (-539.480) * (-538.956) (-540.122) [-538.965] (-543.423) -- 0:00:27
      527500 -- (-539.864) (-538.864) (-539.083) [-539.492] * (-539.936) [-542.182] (-538.710) (-539.553) -- 0:00:27
      528000 -- (-542.689) (-539.183) [-538.545] (-541.947) * (-538.133) (-540.289) (-542.924) [-540.324] -- 0:00:27
      528500 -- (-539.044) (-539.832) (-540.434) [-541.379] * (-539.243) [-541.892] (-539.392) (-540.457) -- 0:00:28
      529000 -- (-538.808) (-539.867) (-540.107) [-540.454] * (-538.377) [-539.958] (-539.252) (-542.406) -- 0:00:28
      529500 -- (-540.879) [-542.377] (-539.751) (-542.498) * (-538.399) [-539.737] (-539.689) (-541.524) -- 0:00:28
      530000 -- (-540.461) (-539.324) [-538.453] (-544.659) * (-538.863) [-539.540] (-540.422) (-541.315) -- 0:00:28

      Average standard deviation of split frequencies: 0.013562

      530500 -- [-539.872] (-539.947) (-540.555) (-540.936) * (-544.273) (-541.304) [-538.886] (-539.224) -- 0:00:28
      531000 -- (-540.530) (-538.932) (-539.302) [-539.904] * (-540.610) (-540.018) [-542.133] (-539.526) -- 0:00:28
      531500 -- [-541.941] (-543.065) (-539.551) (-541.462) * (-541.795) (-538.473) (-541.856) [-539.147] -- 0:00:28
      532000 -- (-539.918) (-542.911) [-541.165] (-540.092) * (-540.473) (-539.944) [-540.103] (-544.353) -- 0:00:28
      532500 -- [-540.138] (-539.973) (-540.043) (-539.104) * (-540.326) (-541.393) (-544.215) [-538.895] -- 0:00:28
      533000 -- (-540.431) (-542.791) [-542.691] (-542.355) * (-539.667) (-540.632) [-539.017] (-544.183) -- 0:00:28
      533500 -- (-540.283) (-539.219) [-539.020] (-538.044) * (-539.161) (-543.331) (-540.613) [-538.448] -- 0:00:27
      534000 -- [-540.514] (-538.528) (-544.316) (-538.740) * (-543.097) (-544.502) [-539.277] (-544.159) -- 0:00:27
      534500 -- [-542.076] (-540.295) (-538.682) (-538.868) * (-539.737) (-539.835) (-539.598) [-543.464] -- 0:00:27
      535000 -- [-542.394] (-540.535) (-539.443) (-538.726) * (-542.396) [-538.948] (-541.424) (-542.841) -- 0:00:27

      Average standard deviation of split frequencies: 0.013016

      535500 -- [-538.978] (-540.002) (-538.720) (-543.227) * [-541.192] (-542.682) (-539.958) (-541.469) -- 0:00:27
      536000 -- [-538.912] (-538.106) (-541.233) (-542.924) * [-538.154] (-549.333) (-538.867) (-541.239) -- 0:00:27
      536500 -- (-540.454) [-541.674] (-541.058) (-545.241) * (-539.517) [-541.765] (-538.116) (-539.493) -- 0:00:27
      537000 -- (-541.915) [-538.402] (-539.793) (-540.052) * (-541.957) (-539.956) (-539.068) [-538.159] -- 0:00:27
      537500 -- [-541.521] (-538.134) (-539.072) (-538.235) * (-541.980) (-541.973) (-542.509) [-540.401] -- 0:00:27
      538000 -- [-539.572] (-538.247) (-540.498) (-540.107) * [-539.247] (-538.685) (-539.111) (-539.392) -- 0:00:27
      538500 -- (-539.260) (-539.585) [-541.866] (-541.333) * (-541.715) (-540.998) (-546.779) [-539.312] -- 0:00:27
      539000 -- [-540.856] (-540.255) (-539.648) (-539.848) * (-540.942) (-542.917) [-541.548] (-540.439) -- 0:00:27
      539500 -- [-540.573] (-538.660) (-538.637) (-538.303) * [-539.021] (-540.874) (-539.248) (-539.514) -- 0:00:27
      540000 -- (-539.737) (-538.583) (-539.330) [-538.690] * (-540.086) (-540.669) (-539.232) [-540.658] -- 0:00:27

      Average standard deviation of split frequencies: 0.012323

      540500 -- (-540.357) (-539.475) (-538.684) [-541.022] * (-538.715) (-538.709) [-541.125] (-540.948) -- 0:00:27
      541000 -- (-539.375) (-542.027) [-540.557] (-541.120) * [-538.983] (-542.791) (-539.200) (-538.333) -- 0:00:27
      541500 -- (-537.991) (-541.913) [-539.542] (-538.806) * (-539.960) (-540.513) [-540.389] (-550.648) -- 0:00:27
      542000 -- (-537.991) (-538.713) (-538.404) [-542.909] * [-540.622] (-541.623) (-539.619) (-542.220) -- 0:00:27
      542500 -- (-541.237) [-544.025] (-542.317) (-539.446) * (-544.285) (-542.426) [-539.425] (-541.136) -- 0:00:26
      543000 -- (-538.930) [-540.190] (-540.987) (-543.327) * [-539.016] (-540.271) (-540.013) (-540.926) -- 0:00:26
      543500 -- (-539.006) [-541.714] (-540.549) (-543.176) * [-540.390] (-540.127) (-543.731) (-540.646) -- 0:00:26
      544000 -- (-541.047) (-539.747) [-542.974] (-541.877) * (-543.852) (-539.598) [-538.770] (-542.834) -- 0:00:26
      544500 -- [-538.970] (-539.784) (-538.957) (-539.957) * (-539.550) [-539.063] (-543.639) (-539.757) -- 0:00:26
      545000 -- [-543.273] (-540.306) (-541.409) (-539.562) * (-538.727) (-539.281) [-538.669] (-540.141) -- 0:00:26

      Average standard deviation of split frequencies: 0.012893

      545500 -- (-543.220) [-537.744] (-539.507) (-541.300) * (-539.192) [-539.855] (-539.033) (-539.705) -- 0:00:26
      546000 -- (-540.022) (-537.787) (-540.860) [-538.136] * (-538.439) [-543.700] (-546.582) (-541.683) -- 0:00:27
      546500 -- (-539.709) (-537.783) [-538.466] (-540.494) * [-538.555] (-538.660) (-538.819) (-543.032) -- 0:00:27
      547000 -- (-538.889) [-537.757] (-540.071) (-540.155) * (-541.969) (-539.803) (-540.691) [-541.521] -- 0:00:27
      547500 -- (-538.824) (-540.380) (-541.074) [-540.462] * [-539.217] (-538.907) (-539.283) (-543.329) -- 0:00:27
      548000 -- [-539.836] (-538.387) (-541.872) (-542.110) * (-539.505) [-540.963] (-538.704) (-541.150) -- 0:00:27
      548500 -- [-540.167] (-539.958) (-543.898) (-540.762) * (-540.837) (-540.123) [-538.735] (-541.934) -- 0:00:27
      549000 -- (-540.220) [-540.974] (-539.430) (-541.408) * (-540.871) [-538.826] (-540.999) (-539.509) -- 0:00:27
      549500 -- (-540.709) (-540.574) (-539.096) [-541.584] * (-542.823) (-539.204) [-540.448] (-540.365) -- 0:00:27
      550000 -- (-539.652) (-541.419) (-540.887) [-539.770] * (-539.428) (-540.131) [-541.008] (-539.080) -- 0:00:27

      Average standard deviation of split frequencies: 0.012384

      550500 -- [-538.396] (-539.988) (-539.468) (-541.814) * (-541.452) (-539.601) (-538.953) [-539.713] -- 0:00:26
      551000 -- (-540.212) [-541.198] (-543.618) (-539.176) * (-538.096) (-538.333) [-538.252] (-539.497) -- 0:00:26
      551500 -- (-539.285) [-543.509] (-542.227) (-538.577) * (-540.486) (-540.991) (-540.134) [-538.586] -- 0:00:26
      552000 -- [-538.667] (-540.223) (-542.027) (-538.742) * (-539.475) [-538.616] (-540.466) (-540.572) -- 0:00:26
      552500 -- (-541.334) [-538.506] (-545.862) (-541.172) * (-541.286) (-540.616) (-543.893) [-540.066] -- 0:00:26
      553000 -- [-542.671] (-538.769) (-541.467) (-542.939) * (-539.712) (-540.377) [-539.986] (-538.709) -- 0:00:26
      553500 -- (-546.009) (-542.485) [-538.617] (-539.551) * (-539.092) (-541.576) [-540.131] (-538.900) -- 0:00:26
      554000 -- (-545.023) (-540.163) [-539.371] (-541.988) * (-539.147) (-539.418) [-538.024] (-540.396) -- 0:00:26
      554500 -- [-538.688] (-538.969) (-540.833) (-538.802) * [-539.388] (-543.581) (-537.991) (-540.392) -- 0:00:26
      555000 -- [-538.574] (-544.079) (-539.102) (-539.870) * (-538.453) [-540.266] (-539.862) (-539.678) -- 0:00:26

      Average standard deviation of split frequencies: 0.012322

      555500 -- (-538.208) (-539.589) [-539.441] (-539.721) * [-539.599] (-541.480) (-538.318) (-539.673) -- 0:00:26
      556000 -- (-540.116) [-539.534] (-539.812) (-539.640) * (-543.130) (-539.663) (-538.976) [-538.726] -- 0:00:26
      556500 -- (-539.776) [-540.914] (-540.144) (-543.969) * (-539.548) (-542.867) (-541.740) [-539.337] -- 0:00:26
      557000 -- (-541.898) (-542.917) (-539.682) [-538.897] * (-541.392) [-540.582] (-544.923) (-541.383) -- 0:00:26
      557500 -- (-544.434) (-542.387) (-544.193) [-540.127] * (-539.555) (-539.499) (-545.134) [-542.782] -- 0:00:26
      558000 -- [-540.959] (-540.915) (-539.203) (-539.321) * (-540.180) (-539.935) (-551.080) [-541.781] -- 0:00:26
      558500 -- (-539.343) (-541.057) [-539.905] (-538.249) * (-539.041) [-538.283] (-549.117) (-544.146) -- 0:00:26
      559000 -- (-545.538) [-541.757] (-542.539) (-539.896) * (-539.309) (-541.149) (-546.032) [-540.971] -- 0:00:26
      559500 -- (-541.755) [-548.800] (-540.501) (-539.401) * (-542.928) (-539.817) [-546.083] (-539.642) -- 0:00:25
      560000 -- (-539.322) [-538.967] (-543.945) (-541.032) * (-543.848) (-538.645) (-539.830) [-542.353] -- 0:00:25

      Average standard deviation of split frequencies: 0.012163

      560500 -- (-539.440) [-541.913] (-539.594) (-537.953) * (-538.565) (-539.229) [-539.780] (-539.758) -- 0:00:25
      561000 -- [-541.160] (-543.999) (-542.922) (-538.411) * [-542.457] (-538.484) (-539.905) (-539.022) -- 0:00:25
      561500 -- (-542.368) (-543.000) [-541.523] (-538.995) * (-540.058) (-540.897) [-540.426] (-543.035) -- 0:00:25
      562000 -- [-539.839] (-539.694) (-540.797) (-541.425) * [-541.125] (-539.328) (-540.027) (-539.941) -- 0:00:25
      562500 -- (-541.997) [-539.618] (-544.527) (-541.814) * (-540.305) [-538.718] (-542.913) (-541.823) -- 0:00:25
      563000 -- (-542.355) [-541.200] (-538.379) (-539.521) * (-541.385) (-538.828) (-540.077) [-539.233] -- 0:00:26
      563500 -- (-538.508) (-539.377) [-540.075] (-538.063) * [-542.381] (-537.947) (-539.225) (-544.082) -- 0:00:26
      564000 -- (-538.187) (-537.996) (-539.203) [-538.312] * (-543.538) (-541.447) [-538.715] (-540.142) -- 0:00:26
      564500 -- [-537.962] (-544.794) (-551.227) (-538.543) * (-538.681) (-541.195) [-538.656] (-542.304) -- 0:00:26
      565000 -- [-538.039] (-544.643) (-542.014) (-541.428) * (-541.436) [-541.850] (-539.872) (-540.731) -- 0:00:26

      Average standard deviation of split frequencies: 0.012549

      565500 -- (-538.875) (-542.533) (-540.498) [-539.047] * (-539.291) [-538.096] (-540.884) (-538.817) -- 0:00:26
      566000 -- (-538.976) (-540.010) [-539.715] (-538.554) * (-538.796) [-540.656] (-538.982) (-540.846) -- 0:00:26
      566500 -- [-541.250] (-541.195) (-540.588) (-539.675) * (-539.291) [-543.023] (-543.534) (-549.129) -- 0:00:26
      567000 -- (-544.682) [-539.766] (-540.248) (-542.364) * [-539.970] (-541.619) (-539.630) (-543.425) -- 0:00:25
      567500 -- (-540.163) (-539.280) [-539.245] (-542.347) * [-538.947] (-541.573) (-542.120) (-538.754) -- 0:00:25
      568000 -- (-539.745) (-539.156) [-539.548] (-543.264) * (-538.754) [-540.994] (-540.060) (-538.417) -- 0:00:25
      568500 -- (-540.089) [-538.731] (-544.361) (-544.577) * (-539.410) (-539.797) [-539.458] (-538.316) -- 0:00:25
      569000 -- [-540.553] (-540.476) (-546.056) (-538.531) * (-538.498) (-546.060) (-540.431) [-539.673] -- 0:00:25
      569500 -- [-540.934] (-539.978) (-539.238) (-539.100) * (-539.980) (-543.090) [-544.096] (-538.493) -- 0:00:25
      570000 -- (-538.032) (-540.154) [-540.150] (-540.678) * [-542.921] (-538.678) (-540.928) (-538.992) -- 0:00:25

      Average standard deviation of split frequencies: 0.012226

      570500 -- (-542.435) [-538.577] (-540.349) (-541.644) * (-540.342) [-539.006] (-539.528) (-539.827) -- 0:00:25
      571000 -- (-542.684) (-539.533) (-540.671) [-540.719] * (-539.993) (-541.186) (-541.027) [-537.831] -- 0:00:25
      571500 -- (-540.697) (-539.892) (-541.058) [-540.217] * (-541.957) (-538.054) (-541.620) [-537.831] -- 0:00:25
      572000 -- (-542.041) [-540.520] (-538.348) (-538.537) * (-539.543) [-539.134] (-539.588) (-540.470) -- 0:00:25
      572500 -- (-541.298) (-539.359) (-539.195) [-543.674] * [-539.743] (-540.752) (-538.924) (-542.213) -- 0:00:25
      573000 -- (-540.914) (-538.082) [-539.442] (-544.407) * (-540.489) [-540.476] (-538.243) (-540.859) -- 0:00:25
      573500 -- [-540.877] (-538.003) (-541.270) (-539.972) * [-538.633] (-538.780) (-540.325) (-542.403) -- 0:00:25
      574000 -- (-538.558) [-538.631] (-540.983) (-543.076) * [-538.578] (-542.227) (-538.482) (-539.321) -- 0:00:25
      574500 -- [-541.688] (-541.949) (-538.715) (-540.436) * (-538.871) (-539.366) (-538.973) [-538.483] -- 0:00:25
      575000 -- (-539.918) (-540.487) (-539.377) [-540.425] * (-539.913) (-538.570) [-539.150] (-542.495) -- 0:00:25

      Average standard deviation of split frequencies: 0.011894

      575500 -- [-540.359] (-538.367) (-540.472) (-541.807) * [-538.616] (-538.128) (-539.091) (-538.820) -- 0:00:25
      576000 -- (-543.993) (-539.459) [-547.601] (-538.803) * (-541.585) [-539.288] (-538.698) (-540.047) -- 0:00:25
      576500 -- (-541.171) (-540.154) (-544.364) [-538.361] * (-540.941) (-538.942) [-540.092] (-541.719) -- 0:00:24
      577000 -- [-539.460] (-541.861) (-540.633) (-539.056) * [-538.457] (-543.827) (-542.340) (-539.689) -- 0:00:24
      577500 -- (-542.431) [-539.794] (-538.805) (-540.212) * (-539.554) (-541.314) [-539.363] (-538.010) -- 0:00:24
      578000 -- (-539.516) [-538.566] (-538.910) (-540.223) * [-539.085] (-540.566) (-538.563) (-539.693) -- 0:00:24
      578500 -- (-541.529) [-538.350] (-539.248) (-539.370) * (-538.353) (-539.522) (-539.422) [-539.390] -- 0:00:24
      579000 -- [-538.410] (-539.447) (-538.780) (-540.361) * (-538.403) (-539.957) (-538.739) [-543.043] -- 0:00:24
      579500 -- (-537.959) (-539.495) (-539.100) [-538.648] * [-538.681] (-539.528) (-538.700) (-540.201) -- 0:00:24
      580000 -- [-541.487] (-538.599) (-541.570) (-540.280) * (-538.312) [-537.946] (-541.485) (-540.340) -- 0:00:25

      Average standard deviation of split frequencies: 0.011312

      580500 -- [-539.049] (-538.611) (-539.429) (-539.751) * (-542.380) (-543.343) (-541.352) [-539.511] -- 0:00:25
      581000 -- [-538.751] (-541.876) (-539.670) (-539.209) * (-541.684) [-542.443] (-539.376) (-538.802) -- 0:00:25
      581500 -- (-538.175) [-541.449] (-538.901) (-538.528) * [-539.824] (-542.063) (-538.136) (-540.791) -- 0:00:25
      582000 -- (-542.284) (-540.133) (-539.947) [-538.304] * [-542.134] (-539.424) (-540.325) (-541.479) -- 0:00:25
      582500 -- (-546.134) (-540.841) [-539.434] (-538.355) * (-539.319) (-538.752) [-540.757] (-540.785) -- 0:00:25
      583000 -- [-539.893] (-540.633) (-540.549) (-540.582) * (-539.432) (-539.248) (-538.827) [-539.727] -- 0:00:25
      583500 -- (-538.892) [-538.239] (-541.155) (-539.036) * (-538.578) [-542.012] (-539.291) (-540.359) -- 0:00:24
      584000 -- (-539.928) [-540.066] (-541.254) (-539.000) * (-539.724) (-539.326) [-540.830] (-539.165) -- 0:00:24
      584500 -- (-538.226) (-540.697) [-538.950] (-538.075) * (-540.868) (-538.767) [-542.298] (-538.989) -- 0:00:24
      585000 -- (-539.629) (-542.909) (-541.433) [-540.896] * (-539.998) [-539.031] (-539.486) (-538.968) -- 0:00:24

      Average standard deviation of split frequencies: 0.010297

      585500 -- (-541.657) (-541.027) [-540.553] (-540.286) * (-543.860) [-540.452] (-540.158) (-540.792) -- 0:00:24
      586000 -- (-543.358) (-539.132) (-539.310) [-538.116] * (-544.488) [-538.317] (-544.397) (-541.435) -- 0:00:24
      586500 -- [-542.165] (-540.921) (-539.493) (-538.222) * (-553.084) (-542.412) (-541.097) [-543.647] -- 0:00:24
      587000 -- (-540.875) (-543.211) [-539.013] (-540.187) * (-539.213) (-538.063) (-541.533) [-540.261] -- 0:00:24
      587500 -- [-539.694] (-542.764) (-542.328) (-542.484) * (-541.551) [-540.381] (-542.185) (-541.573) -- 0:00:24
      588000 -- (-542.587) [-539.835] (-539.226) (-540.575) * (-540.491) (-540.253) [-542.968] (-538.953) -- 0:00:24
      588500 -- [-541.351] (-540.333) (-540.868) (-542.041) * (-539.549) [-538.701] (-540.650) (-544.485) -- 0:00:24
      589000 -- (-543.024) (-539.592) [-542.036] (-541.901) * [-537.874] (-539.247) (-542.411) (-543.767) -- 0:00:24
      589500 -- (-540.015) (-540.175) (-539.855) [-541.860] * (-539.405) [-538.416] (-542.844) (-540.041) -- 0:00:24
      590000 -- [-540.110] (-540.265) (-541.476) (-540.173) * (-537.955) (-540.903) (-539.923) [-540.970] -- 0:00:24

      Average standard deviation of split frequencies: 0.010162

      590500 -- (-539.092) (-539.319) [-540.452] (-539.152) * [-537.996] (-538.619) (-545.268) (-538.873) -- 0:00:24
      591000 -- (-540.794) [-542.492] (-540.842) (-540.888) * [-537.942] (-541.162) (-544.774) (-539.773) -- 0:00:24
      591500 -- (-538.566) (-539.564) [-541.395] (-543.266) * (-539.015) (-540.132) (-541.024) [-540.325] -- 0:00:24
      592000 -- (-539.955) (-538.971) (-539.586) [-541.638] * (-539.986) (-542.345) (-539.535) [-540.204] -- 0:00:24
      592500 -- [-540.470] (-540.664) (-539.342) (-541.772) * [-540.589] (-543.259) (-543.142) (-540.358) -- 0:00:24
      593000 -- (-540.186) (-539.144) (-540.025) [-539.419] * [-538.533] (-547.841) (-541.273) (-540.874) -- 0:00:24
      593500 -- (-539.268) [-539.521] (-538.031) (-544.791) * (-538.323) (-548.057) (-541.037) [-538.808] -- 0:00:23
      594000 -- (-539.047) (-541.625) (-539.410) [-539.841] * (-540.136) [-543.180] (-539.459) (-538.694) -- 0:00:23
      594500 -- (-538.791) [-538.158] (-539.525) (-542.082) * (-541.894) (-538.900) (-539.606) [-538.600] -- 0:00:23
      595000 -- [-538.775] (-542.528) (-538.685) (-539.144) * (-541.746) (-538.313) (-541.068) [-537.966] -- 0:00:23

      Average standard deviation of split frequencies: 0.009860

      595500 -- (-540.677) (-540.583) (-539.785) [-541.572] * (-543.312) (-543.438) [-539.991] (-539.430) -- 0:00:23
      596000 -- [-538.698] (-539.020) (-542.369) (-538.265) * (-545.941) [-541.253] (-538.386) (-539.087) -- 0:00:23
      596500 -- [-538.563] (-542.196) (-539.291) (-538.536) * (-544.859) [-540.814] (-538.497) (-541.333) -- 0:00:23
      597000 -- (-539.248) (-539.417) (-541.670) [-539.035] * (-538.413) (-540.614) [-540.001] (-542.298) -- 0:00:24
      597500 -- [-542.979] (-541.833) (-539.195) (-542.882) * (-544.776) [-538.324] (-544.010) (-541.216) -- 0:00:24
      598000 -- (-538.902) [-539.916] (-542.153) (-541.154) * (-540.310) (-538.687) (-540.656) [-540.602] -- 0:00:24
      598500 -- (-539.813) (-539.727) (-541.623) [-543.978] * (-538.561) [-538.712] (-538.497) (-540.647) -- 0:00:24
      599000 -- (-539.386) [-544.042] (-539.864) (-540.757) * (-539.674) [-539.863] (-538.883) (-538.809) -- 0:00:24
      599500 -- (-538.919) (-539.156) [-539.203] (-542.213) * (-539.008) (-539.473) (-539.256) [-540.206] -- 0:00:24
      600000 -- (-539.675) (-539.260) [-543.542] (-542.816) * (-538.285) [-542.209] (-540.159) (-540.022) -- 0:00:24

      Average standard deviation of split frequencies: 0.010569

      600500 -- (-541.723) (-538.222) [-538.125] (-539.914) * (-538.701) (-539.392) [-541.479] (-547.058) -- 0:00:23
      601000 -- (-539.521) [-538.486] (-541.905) (-538.415) * (-540.370) (-539.533) [-541.103] (-541.801) -- 0:00:23
      601500 -- (-541.047) [-540.383] (-538.373) (-540.614) * [-538.494] (-538.160) (-537.945) (-541.224) -- 0:00:23
      602000 -- (-538.244) [-539.427] (-543.641) (-538.557) * (-539.440) (-539.357) (-539.289) [-541.219] -- 0:00:23
      602500 -- (-538.955) (-542.690) [-540.365] (-544.346) * (-539.185) [-540.929] (-539.236) (-540.621) -- 0:00:23
      603000 -- (-539.538) [-538.232] (-540.174) (-538.696) * (-540.461) (-541.839) [-544.415] (-540.982) -- 0:00:23
      603500 -- (-542.594) [-538.555] (-542.007) (-538.598) * (-540.862) (-543.294) [-540.155] (-540.854) -- 0:00:23
      604000 -- (-541.992) [-538.867] (-540.014) (-541.478) * (-540.488) [-539.956] (-539.920) (-539.521) -- 0:00:23
      604500 -- [-538.793] (-538.407) (-539.610) (-539.188) * (-542.384) (-538.869) (-540.089) [-540.231] -- 0:00:23
      605000 -- (-541.789) (-541.223) [-541.776] (-538.347) * [-539.110] (-538.401) (-540.071) (-538.740) -- 0:00:23

      Average standard deviation of split frequencies: 0.009750

      605500 -- (-543.677) [-538.432] (-539.871) (-538.716) * (-538.451) [-542.146] (-546.775) (-538.748) -- 0:00:23
      606000 -- [-542.222] (-541.728) (-543.572) (-543.647) * [-538.429] (-541.365) (-545.665) (-539.589) -- 0:00:23
      606500 -- (-538.686) [-540.062] (-542.044) (-540.180) * [-539.160] (-543.348) (-541.456) (-538.843) -- 0:00:23
      607000 -- [-538.684] (-538.133) (-539.566) (-544.547) * [-538.693] (-540.013) (-539.622) (-539.595) -- 0:00:23
      607500 -- [-538.452] (-539.050) (-539.061) (-547.619) * (-542.492) [-541.604] (-539.481) (-543.382) -- 0:00:23
      608000 -- (-542.991) (-539.051) [-541.564] (-540.520) * [-541.188] (-540.126) (-543.717) (-540.065) -- 0:00:23
      608500 -- (-538.027) [-539.591] (-542.226) (-539.216) * (-542.182) (-541.385) (-542.105) [-539.712] -- 0:00:23
      609000 -- (-537.866) (-540.688) [-540.331] (-538.884) * (-539.737) [-543.404] (-541.357) (-541.870) -- 0:00:23
      609500 -- (-538.615) (-540.716) [-539.120] (-539.528) * (-544.705) (-538.888) (-541.699) [-540.989] -- 0:00:23
      610000 -- (-538.685) (-538.993) [-539.591] (-540.816) * (-540.470) [-538.010] (-542.056) (-543.927) -- 0:00:23

      Average standard deviation of split frequencies: 0.009624

      610500 -- (-538.388) [-539.305] (-539.334) (-539.523) * (-541.977) (-538.591) [-540.675] (-539.726) -- 0:00:22
      611000 -- (-541.653) [-539.100] (-542.559) (-541.529) * (-538.414) (-540.688) [-540.294] (-539.636) -- 0:00:22
      611500 -- (-540.584) (-539.046) (-541.373) [-539.985] * (-540.275) (-538.258) (-538.914) [-541.901] -- 0:00:22
      612000 -- (-542.126) (-542.597) [-539.799] (-539.040) * [-547.067] (-538.860) (-538.971) (-542.378) -- 0:00:22
      612500 -- [-540.514] (-539.600) (-538.181) (-539.505) * (-545.644) [-541.762] (-538.173) (-538.344) -- 0:00:22
      613000 -- (-539.781) (-539.597) [-545.659] (-539.118) * (-542.348) (-544.269) (-541.287) [-539.843] -- 0:00:22
      613500 -- (-541.086) (-538.770) (-541.001) [-538.578] * [-538.250] (-539.928) (-539.480) (-538.486) -- 0:00:22
      614000 -- (-538.901) (-543.145) [-540.844] (-539.119) * (-539.084) (-541.709) (-544.007) [-538.630] -- 0:00:22
      614500 -- (-539.766) (-545.488) [-540.326] (-541.419) * [-538.959] (-546.100) (-543.755) (-539.164) -- 0:00:23
      615000 -- [-542.623] (-539.054) (-542.902) (-539.189) * (-541.164) [-541.334] (-541.212) (-541.127) -- 0:00:23

      Average standard deviation of split frequencies: 0.009591

      615500 -- (-540.767) (-540.530) (-540.249) [-541.275] * [-539.407] (-546.105) (-538.099) (-539.067) -- 0:00:23
      616000 -- (-539.514) [-539.165] (-540.007) (-543.407) * (-539.169) (-540.643) [-537.798] (-538.248) -- 0:00:23
      616500 -- [-542.153] (-539.530) (-540.366) (-540.906) * [-538.752] (-543.419) (-539.226) (-538.453) -- 0:00:23
      617000 -- [-538.754] (-539.239) (-540.951) (-539.531) * (-538.445) [-539.271] (-538.570) (-538.301) -- 0:00:22
      617500 -- (-538.441) [-540.670] (-545.763) (-540.346) * (-540.456) (-540.996) [-538.193] (-539.148) -- 0:00:22
      618000 -- (-541.458) [-539.028] (-539.362) (-539.547) * (-538.676) (-542.843) [-540.445] (-541.419) -- 0:00:22
      618500 -- (-541.973) (-542.200) [-538.969] (-540.519) * (-539.965) (-541.588) (-542.324) [-539.391] -- 0:00:22
      619000 -- [-542.561] (-543.302) (-542.985) (-543.290) * (-541.857) (-538.361) [-538.202] (-543.484) -- 0:00:22
      619500 -- [-541.552] (-539.954) (-542.689) (-539.572) * (-540.381) [-539.255] (-541.274) (-538.747) -- 0:00:22
      620000 -- (-540.378) (-540.106) [-540.357] (-542.396) * (-539.638) (-540.216) (-543.969) [-539.823] -- 0:00:22

      Average standard deviation of split frequencies: 0.009469

      620500 -- (-544.245) [-537.837] (-539.850) (-541.337) * (-540.744) [-538.746] (-543.176) (-540.569) -- 0:00:22
      621000 -- (-540.236) [-540.601] (-540.213) (-540.577) * (-538.375) (-541.865) [-540.168] (-539.510) -- 0:00:22
      621500 -- (-544.340) (-539.175) (-539.690) [-539.859] * (-538.099) (-540.261) [-540.182] (-542.291) -- 0:00:22
      622000 -- (-544.070) (-538.936) [-545.623] (-539.207) * (-541.289) [-541.270] (-544.224) (-540.412) -- 0:00:22
      622500 -- (-539.117) [-540.568] (-538.052) (-538.916) * (-538.684) (-541.289) (-538.479) [-538.867] -- 0:00:22
      623000 -- (-538.802) [-540.366] (-538.061) (-540.573) * [-540.071] (-539.368) (-539.456) (-541.017) -- 0:00:22
      623500 -- (-539.016) (-542.998) (-543.802) [-541.989] * (-538.959) (-548.521) (-540.081) [-539.405] -- 0:00:22
      624000 -- [-541.738] (-542.843) (-542.908) (-539.033) * [-540.230] (-540.985) (-542.116) (-544.868) -- 0:00:22
      624500 -- [-538.910] (-544.571) (-541.080) (-539.876) * (-540.534) (-546.468) (-541.012) [-539.106] -- 0:00:22
      625000 -- (-539.325) [-539.802] (-541.904) (-540.027) * [-538.996] (-539.399) (-541.339) (-542.583) -- 0:00:22

      Average standard deviation of split frequencies: 0.009037

      625500 -- (-543.543) (-538.131) (-547.858) [-538.968] * [-539.016] (-541.127) (-543.714) (-541.105) -- 0:00:22
      626000 -- [-540.433] (-542.317) (-541.005) (-538.961) * (-537.976) (-539.865) [-540.773] (-546.600) -- 0:00:22
      626500 -- (-542.218) (-539.360) [-540.692] (-541.703) * (-538.367) (-540.648) [-537.881] (-540.291) -- 0:00:22
      627000 -- (-541.346) [-538.525] (-538.708) (-539.735) * [-538.682] (-539.780) (-540.029) (-538.819) -- 0:00:22
      627500 -- [-539.266] (-541.129) (-539.594) (-541.005) * (-537.980) [-541.020] (-538.061) (-541.726) -- 0:00:21
      628000 -- (-544.820) (-538.937) [-538.303] (-540.364) * (-538.074) (-538.619) (-538.584) [-539.937] -- 0:00:21
      628500 -- (-542.529) (-539.200) [-538.358] (-541.116) * (-538.208) (-539.035) [-541.536] (-543.794) -- 0:00:21
      629000 -- (-544.407) (-540.947) [-538.301] (-540.403) * (-539.284) [-539.118] (-547.192) (-540.356) -- 0:00:21
      629500 -- (-542.268) [-539.992] (-540.380) (-539.871) * (-537.955) (-538.811) [-546.350] (-540.708) -- 0:00:21
      630000 -- (-540.948) (-538.376) (-539.807) [-538.972] * (-538.344) (-540.179) (-539.647) [-539.073] -- 0:00:21

      Average standard deviation of split frequencies: 0.008870

      630500 -- (-540.108) [-539.237] (-538.093) (-538.012) * (-538.104) (-539.522) [-540.898] (-540.812) -- 0:00:21
      631000 -- (-539.814) (-541.401) [-538.352] (-538.676) * [-543.015] (-539.254) (-539.671) (-540.218) -- 0:00:21
      631500 -- [-540.655] (-538.992) (-542.676) (-537.988) * (-538.224) (-541.799) (-539.442) [-541.450] -- 0:00:21
      632000 -- (-541.031) [-541.995] (-541.550) (-541.869) * (-538.079) (-540.176) [-543.073] (-540.502) -- 0:00:22
      632500 -- [-539.041] (-542.708) (-540.578) (-539.024) * (-539.407) [-538.112] (-541.198) (-540.946) -- 0:00:22
      633000 -- (-538.526) (-542.840) (-540.577) [-538.423] * (-542.002) [-544.422] (-538.878) (-539.368) -- 0:00:22
      633500 -- (-537.814) (-542.490) (-543.960) [-539.005] * (-539.634) [-541.026] (-538.868) (-538.195) -- 0:00:21
      634000 -- [-540.284] (-538.553) (-541.575) (-539.834) * (-540.804) [-540.946] (-540.432) (-538.106) -- 0:00:21
      634500 -- [-539.336] (-540.297) (-538.930) (-539.688) * (-541.749) [-539.201] (-539.677) (-537.769) -- 0:00:21
      635000 -- (-543.095) [-539.014] (-539.241) (-538.363) * [-539.806] (-539.893) (-538.574) (-539.806) -- 0:00:21

      Average standard deviation of split frequencies: 0.009092

      635500 -- (-543.667) (-539.397) (-542.664) [-539.903] * [-541.066] (-541.032) (-538.468) (-540.185) -- 0:00:21
      636000 -- (-538.514) (-539.813) (-540.613) [-538.524] * (-542.091) (-539.570) [-539.018] (-542.767) -- 0:00:21
      636500 -- (-542.437) (-539.897) (-539.282) [-538.981] * (-543.257) (-540.202) [-539.104] (-540.565) -- 0:00:21
      637000 -- (-541.977) [-537.872] (-538.969) (-538.973) * (-545.381) (-540.852) (-538.365) [-539.259] -- 0:00:21
      637500 -- (-542.639) (-537.818) (-541.717) [-538.323] * [-546.161] (-546.448) (-539.385) (-540.597) -- 0:00:21
      638000 -- (-539.145) (-539.223) [-538.449] (-538.936) * (-540.450) (-539.884) (-541.938) [-539.247] -- 0:00:21
      638500 -- (-539.846) [-540.687] (-540.070) (-538.568) * [-538.002] (-543.277) (-543.230) (-539.906) -- 0:00:21
      639000 -- [-540.263] (-541.065) (-539.120) (-539.561) * (-546.085) [-542.985] (-539.839) (-545.962) -- 0:00:21
      639500 -- [-539.897] (-543.279) (-538.899) (-541.221) * (-539.420) (-543.425) (-541.347) [-538.977] -- 0:00:21
      640000 -- (-540.152) (-541.188) [-540.912] (-539.428) * (-539.139) (-539.393) [-543.204] (-542.919) -- 0:00:21

      Average standard deviation of split frequencies: 0.008928

      640500 -- (-540.376) [-539.560] (-540.309) (-539.514) * (-546.325) [-539.994] (-541.578) (-539.494) -- 0:00:21
      641000 -- [-540.089] (-540.033) (-538.496) (-539.123) * (-541.698) [-539.774] (-539.923) (-542.492) -- 0:00:21
      641500 -- [-538.747] (-545.107) (-542.325) (-543.096) * (-544.292) (-541.809) (-541.184) [-541.489] -- 0:00:21
      642000 -- (-537.786) (-539.964) (-539.561) [-539.940] * [-539.017] (-542.380) (-541.986) (-540.098) -- 0:00:21
      642500 -- (-538.455) [-537.850] (-538.783) (-542.649) * [-539.968] (-538.756) (-538.273) (-540.402) -- 0:00:21
      643000 -- (-538.103) (-539.893) [-540.186] (-539.753) * (-538.679) (-541.315) [-541.435] (-551.712) -- 0:00:21
      643500 -- (-539.248) [-541.037] (-539.724) (-542.389) * (-540.340) [-543.657] (-541.878) (-540.450) -- 0:00:21
      644000 -- (-540.865) (-539.154) (-541.683) [-540.353] * (-539.765) (-542.135) [-543.015] (-540.972) -- 0:00:21
      644500 -- [-541.463] (-542.605) (-539.325) (-540.969) * (-539.017) (-543.671) [-539.112] (-539.197) -- 0:00:20
      645000 -- (-538.347) (-539.334) [-541.168] (-541.691) * (-540.910) [-537.997] (-539.752) (-539.172) -- 0:00:20

      Average standard deviation of split frequencies: 0.008951

      645500 -- (-538.497) (-539.659) [-539.510] (-540.015) * (-541.981) [-538.969] (-540.482) (-539.348) -- 0:00:20
      646000 -- (-538.395) (-539.576) (-542.749) [-540.210] * [-539.830] (-540.723) (-539.742) (-539.021) -- 0:00:20
      646500 -- (-539.353) (-539.783) [-543.406] (-540.192) * (-538.619) (-540.453) (-539.007) [-539.608] -- 0:00:20
      647000 -- (-540.260) (-543.863) (-538.810) [-540.589] * [-538.892] (-542.826) (-538.590) (-539.920) -- 0:00:20
      647500 -- [-539.023] (-544.200) (-538.724) (-548.668) * (-537.827) (-541.538) [-540.636] (-539.677) -- 0:00:20
      648000 -- [-539.604] (-539.296) (-540.389) (-541.740) * [-542.546] (-539.943) (-540.746) (-538.962) -- 0:00:20
      648500 -- (-542.540) [-539.145] (-540.550) (-539.305) * [-541.266] (-538.950) (-540.333) (-544.357) -- 0:00:20
      649000 -- (-539.351) [-538.887] (-540.999) (-539.712) * (-544.881) [-539.895] (-539.998) (-542.865) -- 0:00:21
      649500 -- (-539.934) (-540.134) [-540.950] (-542.667) * (-541.731) (-542.911) (-539.646) [-540.075] -- 0:00:21
      650000 -- (-539.192) (-539.343) [-540.027] (-540.642) * (-539.140) [-540.497] (-538.656) (-539.348) -- 0:00:21

      Average standard deviation of split frequencies: 0.008597

      650500 -- (-544.325) [-539.074] (-539.249) (-541.282) * [-538.047] (-540.213) (-540.121) (-543.384) -- 0:00:20
      651000 -- (-544.718) (-541.539) [-539.848] (-539.837) * [-538.826] (-542.686) (-539.955) (-542.040) -- 0:00:20
      651500 -- [-543.134] (-541.664) (-538.840) (-538.237) * (-538.354) (-542.540) (-540.539) [-539.357] -- 0:00:20
      652000 -- (-538.326) [-539.573] (-538.005) (-538.449) * (-539.437) [-542.770] (-544.587) (-540.313) -- 0:00:20
      652500 -- (-542.228) [-542.024] (-541.043) (-538.570) * (-543.524) (-540.582) (-542.991) [-541.173] -- 0:00:20
      653000 -- [-539.277] (-540.272) (-539.159) (-539.944) * (-541.201) (-542.299) [-544.990] (-544.649) -- 0:00:20
      653500 -- (-539.806) [-538.893] (-539.645) (-540.631) * (-541.555) [-539.757] (-540.416) (-540.449) -- 0:00:20
      654000 -- (-539.136) (-539.013) (-543.500) [-539.344] * (-538.751) (-539.546) (-539.835) [-538.148] -- 0:00:20
      654500 -- (-540.809) (-541.702) [-538.531] (-542.147) * (-540.794) [-540.851] (-540.684) (-540.875) -- 0:00:20
      655000 -- (-539.756) [-539.307] (-539.109) (-542.435) * (-542.603) (-539.800) [-540.445] (-540.961) -- 0:00:20

      Average standard deviation of split frequencies: 0.009150

      655500 -- (-539.014) (-542.693) (-541.971) [-539.555] * (-539.994) (-539.360) (-540.792) [-539.779] -- 0:00:20
      656000 -- (-540.159) (-538.869) (-541.700) [-538.997] * [-542.085] (-538.647) (-540.487) (-540.129) -- 0:00:20
      656500 -- [-539.193] (-541.884) (-540.827) (-539.668) * (-541.770) (-538.767) (-538.938) [-540.634] -- 0:00:20
      657000 -- (-539.906) (-541.527) [-540.544] (-539.036) * (-541.253) (-541.442) [-539.402] (-541.007) -- 0:00:20
      657500 -- (-541.944) (-538.271) [-543.788] (-541.885) * (-538.884) (-541.210) [-542.754] (-541.988) -- 0:00:20
      658000 -- (-540.756) (-540.134) [-538.360] (-539.254) * [-538.887] (-538.630) (-540.521) (-538.947) -- 0:00:20
      658500 -- (-542.018) (-538.674) (-539.457) [-540.425] * (-538.485) [-541.274] (-540.603) (-541.080) -- 0:00:20
      659000 -- (-538.899) (-545.094) [-542.016] (-541.475) * (-540.635) [-538.222] (-539.522) (-539.442) -- 0:00:20
      659500 -- [-541.129] (-542.787) (-540.521) (-540.055) * (-545.191) [-538.358] (-541.844) (-541.533) -- 0:00:20
      660000 -- (-538.764) [-538.635] (-539.646) (-545.531) * (-538.612) [-538.835] (-539.685) (-539.279) -- 0:00:20

      Average standard deviation of split frequencies: 0.008895

      660500 -- (-541.470) [-539.149] (-541.462) (-541.276) * (-539.336) [-539.382] (-539.326) (-538.223) -- 0:00:20
      661000 -- [-541.645] (-540.003) (-544.082) (-540.705) * (-540.751) [-539.514] (-541.221) (-539.365) -- 0:00:20
      661500 -- (-544.455) (-538.958) [-540.350] (-539.020) * [-538.770] (-537.973) (-543.031) (-540.654) -- 0:00:19
      662000 -- (-540.912) (-541.680) (-541.941) [-539.444] * [-538.048] (-537.893) (-541.562) (-538.462) -- 0:00:19
      662500 -- (-542.194) [-539.670] (-539.619) (-539.753) * (-540.861) [-539.557] (-540.826) (-540.104) -- 0:00:19
      663000 -- (-538.371) (-540.930) (-543.479) [-540.279] * (-539.021) [-539.734] (-538.978) (-539.616) -- 0:00:19
      663500 -- (-542.844) [-539.807] (-541.078) (-540.922) * (-539.294) (-539.603) (-543.861) [-539.622] -- 0:00:19
      664000 -- (-539.957) (-539.209) (-542.490) [-538.164] * (-540.374) (-541.265) (-542.503) [-538.611] -- 0:00:19
      664500 -- (-545.349) (-540.013) [-540.510] (-538.864) * (-540.584) (-542.260) [-539.811] (-538.845) -- 0:00:19
      665000 -- (-540.196) [-539.624] (-542.618) (-537.956) * [-540.996] (-543.115) (-539.243) (-540.175) -- 0:00:19

      Average standard deviation of split frequencies: 0.008730

      665500 -- (-541.211) (-540.461) (-540.983) [-538.998] * (-540.279) (-538.911) (-540.786) [-541.797] -- 0:00:19
      666000 -- (-540.812) (-539.011) (-542.221) [-539.770] * (-539.325) (-539.226) [-538.662] (-539.354) -- 0:00:20
      666500 -- [-538.187] (-539.054) (-539.985) (-541.349) * (-539.315) (-540.117) (-541.443) [-540.602] -- 0:00:20
      667000 -- (-538.317) [-538.857] (-541.150) (-538.922) * (-540.510) (-541.271) [-539.769] (-542.154) -- 0:00:19
      667500 -- [-540.351] (-540.994) (-541.793) (-539.020) * [-540.603] (-541.375) (-541.487) (-543.172) -- 0:00:19
      668000 -- (-538.522) (-540.305) (-542.149) [-543.772] * (-539.603) [-539.491] (-539.315) (-538.754) -- 0:00:19
      668500 -- (-539.442) (-538.610) [-539.264] (-540.334) * (-541.806) (-538.825) (-539.118) [-538.910] -- 0:00:19
      669000 -- (-539.236) (-543.956) (-538.751) [-539.616] * (-538.842) (-539.938) (-538.671) [-540.310] -- 0:00:19
      669500 -- (-538.965) (-541.828) (-540.450) [-538.409] * (-540.601) [-546.561] (-539.146) (-541.154) -- 0:00:19
      670000 -- (-539.731) (-541.317) (-540.623) [-537.942] * [-539.807] (-539.466) (-542.651) (-541.114) -- 0:00:19

      Average standard deviation of split frequencies: 0.009138

      670500 -- [-538.635] (-544.253) (-541.897) (-542.584) * (-541.709) [-538.018] (-541.459) (-546.228) -- 0:00:19
      671000 -- (-539.031) (-540.891) [-541.325] (-541.022) * (-538.900) (-539.078) (-541.736) [-544.471] -- 0:00:19
      671500 -- [-538.668] (-541.629) (-539.858) (-539.672) * (-541.801) (-539.410) (-541.509) [-542.876] -- 0:00:19
      672000 -- (-539.094) (-538.664) [-539.380] (-538.977) * (-541.002) (-542.164) (-538.486) [-539.827] -- 0:00:19
      672500 -- [-539.086] (-540.736) (-540.795) (-538.979) * (-540.266) (-541.335) (-539.175) [-538.278] -- 0:00:19
      673000 -- (-538.901) [-540.628] (-539.900) (-538.835) * (-539.716) [-539.873] (-539.480) (-538.319) -- 0:00:19
      673500 -- [-539.058] (-538.202) (-540.108) (-539.145) * (-541.125) (-540.691) [-537.966] (-540.682) -- 0:00:19
      674000 -- (-542.182) (-539.549) [-541.089] (-546.615) * (-540.667) [-543.113] (-541.351) (-541.085) -- 0:00:19
      674500 -- (-539.652) (-539.916) (-540.967) [-542.845] * (-538.269) (-541.858) [-541.397] (-541.894) -- 0:00:19
      675000 -- (-538.683) (-539.847) [-542.013] (-543.130) * (-540.901) [-539.304] (-539.783) (-539.508) -- 0:00:19

      Average standard deviation of split frequencies: 0.008647

      675500 -- (-543.043) (-541.444) [-539.646] (-539.760) * (-540.971) (-537.755) [-541.046] (-540.155) -- 0:00:19
      676000 -- [-540.931] (-541.998) (-538.018) (-541.550) * (-542.363) [-539.356] (-538.962) (-538.783) -- 0:00:19
      676500 -- (-540.370) [-539.376] (-539.514) (-541.642) * (-541.844) (-539.775) (-538.764) [-539.389] -- 0:00:19
      677000 -- (-541.062) [-538.960] (-542.882) (-543.512) * [-540.850] (-539.738) (-538.396) (-538.513) -- 0:00:19
      677500 -- (-540.399) [-539.165] (-540.548) (-544.267) * (-538.927) [-540.603] (-540.837) (-538.567) -- 0:00:19
      678000 -- (-541.968) (-542.782) [-540.152] (-539.930) * [-540.648] (-539.274) (-539.838) (-539.742) -- 0:00:18
      678500 -- (-539.842) (-541.934) (-541.818) [-539.356] * (-544.513) (-538.655) [-539.439] (-541.534) -- 0:00:18
      679000 -- (-538.388) [-538.440] (-539.970) (-539.355) * [-539.821] (-539.758) (-538.380) (-540.215) -- 0:00:18
      679500 -- [-537.827] (-540.058) (-538.764) (-538.615) * (-539.950) [-538.440] (-542.467) (-543.899) -- 0:00:18
      680000 -- [-541.312] (-539.596) (-543.076) (-543.355) * (-541.497) (-537.910) (-543.130) [-540.061] -- 0:00:18

      Average standard deviation of split frequencies: 0.008542

      680500 -- (-539.654) [-538.733] (-539.166) (-541.738) * (-539.565) (-541.504) (-540.086) [-539.380] -- 0:00:18
      681000 -- [-540.621] (-540.284) (-538.084) (-544.041) * (-539.142) (-540.565) (-538.935) [-538.181] -- 0:00:18
      681500 -- (-540.373) (-543.774) (-539.464) [-541.536] * (-539.142) [-540.151] (-538.181) (-543.648) -- 0:00:18
      682000 -- (-539.080) (-543.352) [-538.873] (-539.177) * (-543.546) (-540.134) (-543.591) [-540.755] -- 0:00:18
      682500 -- (-538.624) (-540.884) [-540.518] (-538.865) * (-538.722) (-541.331) (-538.976) [-539.239] -- 0:00:18
      683000 -- (-541.132) [-542.739] (-538.789) (-542.119) * (-539.077) (-539.751) (-542.443) [-540.239] -- 0:00:19
      683500 -- (-541.688) (-539.534) (-539.300) [-539.841] * [-539.902] (-541.809) (-538.370) (-541.377) -- 0:00:18
      684000 -- (-543.308) (-539.260) [-539.410] (-539.891) * (-539.714) [-539.804] (-539.855) (-540.533) -- 0:00:18
      684500 -- (-540.155) [-540.439] (-539.915) (-542.866) * (-540.724) (-539.802) [-539.233] (-539.467) -- 0:00:18
      685000 -- (-542.128) (-538.364) (-538.960) [-540.573] * (-539.764) [-539.771] (-540.902) (-543.082) -- 0:00:18

      Average standard deviation of split frequencies: 0.009254

      685500 -- (-539.705) [-538.555] (-539.035) (-543.438) * (-544.600) (-541.794) [-539.657] (-542.589) -- 0:00:18
      686000 -- (-543.223) (-538.424) (-540.419) [-541.802] * (-538.339) [-542.362] (-538.899) (-541.293) -- 0:00:18
      686500 -- (-539.648) (-539.644) [-538.185] (-545.568) * (-538.577) (-539.688) (-539.134) [-540.792] -- 0:00:18
      687000 -- (-537.934) (-539.796) (-538.410) [-540.363] * (-539.823) [-541.029] (-542.051) (-543.105) -- 0:00:18
      687500 -- [-539.430] (-539.716) (-539.927) (-540.927) * (-541.299) [-539.417] (-538.405) (-543.064) -- 0:00:18
      688000 -- (-540.506) [-540.324] (-541.504) (-540.343) * (-541.298) (-539.897) [-539.039] (-545.025) -- 0:00:18
      688500 -- [-538.314] (-537.920) (-539.851) (-538.476) * (-539.927) (-542.832) (-538.328) [-540.074] -- 0:00:18
      689000 -- (-538.436) (-539.973) (-538.187) [-541.857] * (-540.523) [-542.759] (-539.245) (-538.932) -- 0:00:18
      689500 -- (-542.887) (-539.101) [-538.388] (-540.641) * (-540.270) (-538.417) (-538.928) [-538.069] -- 0:00:18
      690000 -- (-539.258) [-538.843] (-541.921) (-541.905) * (-538.048) [-538.488] (-538.604) (-539.518) -- 0:00:18

      Average standard deviation of split frequencies: 0.008554

      690500 -- (-545.979) (-541.394) (-541.234) [-539.656] * (-540.724) [-541.338] (-539.891) (-538.746) -- 0:00:18
      691000 -- (-542.103) [-539.168] (-540.574) (-538.455) * (-537.798) (-541.622) (-540.351) [-538.762] -- 0:00:18
      691500 -- (-547.615) [-538.647] (-542.862) (-538.657) * (-538.246) (-542.163) (-539.878) [-539.910] -- 0:00:18
      692000 -- (-542.928) [-538.508] (-537.958) (-538.788) * (-545.564) (-542.411) (-538.512) [-537.766] -- 0:00:18
      692500 -- (-538.673) (-540.545) (-538.586) [-539.225] * (-541.893) (-538.567) (-538.525) [-538.451] -- 0:00:18
      693000 -- (-538.927) (-539.232) (-538.260) [-539.644] * (-539.941) (-540.111) [-538.875] (-542.427) -- 0:00:18
      693500 -- (-540.544) (-539.052) (-538.690) [-540.205] * (-545.171) (-538.691) [-543.101] (-538.849) -- 0:00:18
      694000 -- (-540.595) [-539.783] (-538.846) (-540.381) * (-541.226) (-542.931) [-541.171] (-540.669) -- 0:00:18
      694500 -- [-538.480] (-539.103) (-541.337) (-540.483) * (-540.625) (-541.321) [-540.327] (-538.483) -- 0:00:18
      695000 -- (-538.444) [-540.006] (-543.839) (-543.152) * (-541.307) [-539.628] (-539.872) (-541.076) -- 0:00:17

      Average standard deviation of split frequencies: 0.008805

      695500 -- (-538.866) (-538.920) [-539.344] (-542.348) * [-539.267] (-545.054) (-541.082) (-539.372) -- 0:00:17
      696000 -- (-538.904) (-539.650) [-538.776] (-540.782) * (-544.804) (-539.063) [-538.125] (-541.931) -- 0:00:17
      696500 -- (-543.550) (-539.594) (-538.353) [-538.583] * (-539.922) (-539.869) [-540.683] (-541.449) -- 0:00:17
      697000 -- (-539.462) (-543.172) [-540.196] (-541.274) * (-540.250) (-539.516) [-544.181] (-540.589) -- 0:00:17
      697500 -- (-539.252) [-543.473] (-538.761) (-540.061) * (-539.273) (-540.250) [-541.214] (-539.963) -- 0:00:17
      698000 -- (-540.850) (-540.577) (-539.247) [-540.976] * [-539.876] (-538.746) (-539.113) (-541.982) -- 0:00:17
      698500 -- (-538.816) [-541.036] (-541.703) (-541.994) * (-538.282) (-541.027) [-538.035] (-543.524) -- 0:00:17
      699000 -- (-539.332) (-540.087) (-542.276) [-539.853] * [-538.758] (-539.355) (-540.839) (-538.972) -- 0:00:17
      699500 -- (-539.842) [-541.112] (-539.008) (-538.351) * (-538.135) [-539.907] (-540.909) (-541.249) -- 0:00:17
      700000 -- (-542.445) (-541.902) [-538.504] (-538.750) * (-539.500) (-540.875) (-541.396) [-539.343] -- 0:00:17

      Average standard deviation of split frequencies: 0.009554

      700500 -- [-541.722] (-540.087) (-543.175) (-538.811) * (-541.769) (-539.519) (-541.237) [-538.690] -- 0:00:17
      701000 -- (-539.907) (-538.827) [-541.706] (-538.989) * (-541.275) [-538.816] (-540.501) (-545.239) -- 0:00:17
      701500 -- (-539.564) (-543.235) (-538.030) [-539.695] * (-544.046) [-537.910] (-540.208) (-543.891) -- 0:00:17
      702000 -- [-539.300] (-540.108) (-538.162) (-538.751) * (-540.676) (-538.270) (-538.602) [-539.919] -- 0:00:17
      702500 -- (-538.707) (-542.611) [-538.369] (-540.678) * (-543.758) (-541.294) (-537.956) [-543.007] -- 0:00:17
      703000 -- [-538.580] (-539.825) (-538.745) (-539.567) * (-539.203) (-541.162) (-543.541) [-540.170] -- 0:00:17
      703500 -- (-539.281) (-540.073) [-538.543] (-541.197) * (-539.202) (-542.372) [-538.752] (-540.139) -- 0:00:17
      704000 -- (-539.724) (-541.430) [-543.412] (-541.174) * (-539.941) (-542.500) [-544.034] (-539.662) -- 0:00:17
      704500 -- [-540.661] (-543.117) (-540.353) (-539.124) * [-539.928] (-544.139) (-540.121) (-539.835) -- 0:00:17
      705000 -- (-539.420) (-538.869) (-539.464) [-539.194] * (-540.182) (-543.140) [-540.515] (-539.437) -- 0:00:17

      Average standard deviation of split frequencies: 0.009704

      705500 -- (-541.832) (-539.535) (-538.087) [-539.407] * [-540.063] (-539.765) (-540.144) (-543.351) -- 0:00:17
      706000 -- (-539.178) [-538.651] (-540.846) (-537.846) * (-540.110) (-543.011) (-538.796) [-540.203] -- 0:00:17
      706500 -- (-541.573) (-539.765) [-540.187] (-540.738) * [-540.777] (-546.537) (-540.280) (-540.350) -- 0:00:17
      707000 -- (-539.571) [-541.650] (-540.377) (-538.979) * (-539.738) [-540.115] (-541.856) (-539.783) -- 0:00:17
      707500 -- [-542.409] (-539.392) (-539.403) (-539.632) * (-539.113) (-539.493) (-545.288) [-538.961] -- 0:00:17
      708000 -- (-540.991) [-539.573] (-541.276) (-538.996) * (-540.982) (-540.436) [-545.376] (-539.850) -- 0:00:17
      708500 -- (-538.159) (-539.864) [-539.002] (-540.734) * [-538.371] (-545.937) (-541.033) (-539.959) -- 0:00:17
      709000 -- (-542.646) (-539.490) (-541.105) [-544.616] * (-540.408) [-539.933] (-540.632) (-542.532) -- 0:00:17
      709500 -- [-544.596] (-540.207) (-540.147) (-541.658) * (-538.221) (-539.181) [-539.733] (-540.165) -- 0:00:17
      710000 -- (-538.445) (-540.621) [-539.450] (-543.458) * [-538.137] (-539.989) (-538.023) (-538.731) -- 0:00:17

      Average standard deviation of split frequencies: 0.009065

      710500 -- (-539.804) [-539.303] (-539.654) (-540.251) * (-538.535) (-540.196) (-539.556) [-541.222] -- 0:00:17
      711000 -- (-542.167) (-539.179) [-538.248] (-540.243) * (-540.626) [-540.075] (-539.856) (-540.152) -- 0:00:17
      711500 -- (-543.650) (-538.705) (-539.710) [-539.329] * (-541.383) (-541.764) [-540.944] (-540.916) -- 0:00:17
      712000 -- (-538.773) (-539.953) (-540.701) [-538.040] * (-542.088) [-539.402] (-538.195) (-539.289) -- 0:00:16
      712500 -- [-539.391] (-540.585) (-542.522) (-538.207) * (-538.943) (-539.777) [-537.886] (-540.591) -- 0:00:16
      713000 -- (-541.265) (-539.524) [-539.715] (-538.944) * (-539.851) (-539.918) (-537.721) [-539.331] -- 0:00:16
      713500 -- (-542.169) [-540.111] (-540.099) (-542.462) * (-542.863) [-539.918] (-538.049) (-539.068) -- 0:00:16
      714000 -- (-540.351) (-540.179) [-539.720] (-540.261) * [-538.283] (-539.934) (-538.310) (-539.646) -- 0:00:16
      714500 -- (-541.251) (-538.658) (-539.292) [-538.154] * [-540.641] (-543.506) (-540.649) (-542.792) -- 0:00:16
      715000 -- [-540.826] (-539.812) (-540.432) (-539.696) * [-540.727] (-543.785) (-538.350) (-539.137) -- 0:00:16

      Average standard deviation of split frequencies: 0.008778

      715500 -- (-541.967) [-538.794] (-541.915) (-540.801) * [-539.458] (-545.126) (-538.816) (-542.229) -- 0:00:16
      716000 -- [-539.761] (-540.661) (-541.442) (-538.655) * [-538.099] (-539.303) (-539.712) (-540.746) -- 0:00:16
      716500 -- (-540.245) (-542.844) (-540.897) [-540.227] * [-538.480] (-538.803) (-540.149) (-543.475) -- 0:00:16
      717000 -- [-540.685] (-539.280) (-538.908) (-538.848) * (-539.057) [-538.277] (-542.096) (-539.995) -- 0:00:16
      717500 -- [-539.724] (-539.208) (-541.181) (-541.572) * (-539.508) [-538.419] (-541.485) (-538.275) -- 0:00:16
      718000 -- (-539.717) [-542.762] (-542.520) (-540.381) * (-540.558) (-539.116) [-542.308] (-541.740) -- 0:00:16
      718500 -- (-542.125) (-538.520) [-542.395] (-540.986) * [-539.373] (-539.372) (-540.677) (-540.897) -- 0:00:16
      719000 -- [-541.194] (-540.155) (-538.865) (-544.185) * (-540.847) (-540.272) (-540.924) [-538.891] -- 0:00:16
      719500 -- (-539.040) [-540.640] (-539.967) (-538.907) * (-538.951) (-539.963) (-541.423) [-537.990] -- 0:00:16
      720000 -- [-541.490] (-540.164) (-540.624) (-540.357) * (-538.891) (-538.326) (-539.555) [-540.436] -- 0:00:16

      Average standard deviation of split frequencies: 0.008634

      720500 -- (-539.070) (-541.624) (-539.736) [-538.830] * (-540.176) [-539.707] (-538.089) (-539.979) -- 0:00:16
      721000 -- (-539.849) [-545.485] (-541.192) (-542.266) * (-543.955) [-541.750] (-539.593) (-541.622) -- 0:00:16
      721500 -- (-539.583) (-538.544) [-540.517] (-542.111) * (-539.801) [-538.582] (-539.175) (-538.884) -- 0:00:16
      722000 -- (-540.905) (-542.161) [-539.913] (-538.260) * (-543.096) (-538.540) (-540.092) [-541.518] -- 0:00:16
      722500 -- (-539.159) (-538.914) [-538.236] (-538.729) * (-540.285) (-538.501) (-539.214) [-540.204] -- 0:00:16
      723000 -- (-540.835) [-539.405] (-538.161) (-538.892) * (-541.752) (-539.121) (-541.135) [-542.930] -- 0:00:16
      723500 -- [-539.933] (-538.989) (-537.891) (-539.055) * (-538.486) (-538.242) [-538.561] (-541.133) -- 0:00:16
      724000 -- (-538.644) (-542.696) (-539.850) [-539.092] * (-539.438) (-544.581) (-538.340) [-542.843] -- 0:00:16
      724500 -- [-540.186] (-538.714) (-539.186) (-542.833) * (-539.964) [-540.622] (-541.969) (-542.526) -- 0:00:16
      725000 -- (-538.760) [-538.655] (-541.984) (-540.655) * (-541.715) [-538.229] (-538.939) (-539.371) -- 0:00:16

      Average standard deviation of split frequencies: 0.008744

      725500 -- (-538.819) (-539.329) (-540.759) [-540.442] * (-540.960) (-539.558) (-541.493) [-540.415] -- 0:00:16
      726000 -- [-538.732] (-538.896) (-540.624) (-538.871) * (-541.571) [-539.392] (-539.435) (-541.134) -- 0:00:16
      726500 -- (-540.865) (-540.328) (-539.015) [-540.428] * (-538.498) (-537.974) [-538.960] (-538.556) -- 0:00:16
      727000 -- (-541.062) (-539.248) (-540.084) [-542.646] * (-538.195) [-538.440] (-539.865) (-541.481) -- 0:00:16
      727500 -- [-542.280] (-538.911) (-542.974) (-539.880) * (-542.123) (-539.091) (-542.907) [-540.725] -- 0:00:16
      728000 -- (-541.394) (-539.750) [-539.819] (-539.723) * (-541.667) [-540.038] (-545.245) (-540.878) -- 0:00:16
      728500 -- (-537.969) (-538.482) (-539.099) [-540.002] * (-539.329) (-538.605) (-542.033) [-542.555] -- 0:00:16
      729000 -- (-541.242) (-541.385) [-542.317] (-539.104) * (-539.518) (-539.894) (-543.495) [-538.273] -- 0:00:15
      729500 -- (-541.918) (-539.297) (-541.621) [-538.300] * (-539.316) [-542.509] (-539.391) (-539.827) -- 0:00:15
      730000 -- (-543.930) [-538.613] (-541.150) (-539.734) * (-539.096) (-542.481) [-539.339] (-539.147) -- 0:00:15

      Average standard deviation of split frequencies: 0.008602

      730500 -- (-540.006) (-540.099) (-540.267) [-539.448] * (-539.696) (-540.948) (-539.852) [-540.462] -- 0:00:15
      731000 -- (-540.140) [-540.741] (-539.748) (-538.675) * (-539.674) [-538.412] (-541.005) (-548.633) -- 0:00:15
      731500 -- (-539.657) (-539.072) (-543.504) [-538.443] * (-540.063) (-538.650) [-540.021] (-544.212) -- 0:00:15
      732000 -- [-538.956] (-538.520) (-539.895) (-538.975) * (-539.026) [-539.767] (-541.443) (-538.939) -- 0:00:15
      732500 -- (-538.359) (-538.468) (-541.336) [-539.070] * (-540.624) (-543.988) [-541.976] (-539.664) -- 0:00:15
      733000 -- [-539.380] (-539.868) (-540.698) (-543.659) * [-541.024] (-539.655) (-541.570) (-539.114) -- 0:00:15
      733500 -- [-538.681] (-540.361) (-541.016) (-543.792) * (-540.438) (-539.610) (-542.168) [-538.262] -- 0:00:15
      734000 -- (-538.746) (-539.958) [-542.236] (-539.448) * (-539.006) [-539.664] (-539.663) (-538.550) -- 0:00:15
      734500 -- [-541.173] (-541.129) (-543.666) (-540.545) * (-542.158) [-542.576] (-542.387) (-541.841) -- 0:00:15
      735000 -- (-540.819) [-541.094] (-541.290) (-540.927) * (-539.647) (-539.112) [-542.443] (-538.827) -- 0:00:15

      Average standard deviation of split frequencies: 0.008497

      735500 -- [-539.692] (-538.414) (-544.817) (-538.423) * (-540.016) (-538.072) (-539.750) [-539.899] -- 0:00:15
      736000 -- [-538.569] (-539.488) (-542.952) (-545.240) * (-539.024) (-541.798) (-541.450) [-538.206] -- 0:00:15
      736500 -- (-539.522) [-539.382] (-540.237) (-539.213) * (-539.407) [-540.428] (-539.880) (-543.992) -- 0:00:15
      737000 -- [-540.056] (-544.036) (-539.403) (-538.934) * (-541.771) (-538.377) (-542.770) [-540.162] -- 0:00:15
      737500 -- (-539.973) (-543.617) (-540.107) [-539.623] * (-538.890) (-539.122) (-543.123) [-539.868] -- 0:00:15
      738000 -- (-540.552) [-539.354] (-542.878) (-540.845) * (-542.048) (-538.318) (-543.860) [-539.917] -- 0:00:15
      738500 -- (-539.383) (-539.416) (-540.716) [-539.018] * [-541.921] (-539.204) (-541.047) (-541.676) -- 0:00:15
      739000 -- [-539.029] (-540.601) (-541.358) (-540.222) * (-540.157) [-539.107] (-543.764) (-542.100) -- 0:00:15
      739500 -- (-545.312) (-538.057) (-539.500) [-542.074] * [-541.719] (-538.601) (-538.639) (-540.151) -- 0:00:15
      740000 -- (-539.301) [-540.671] (-541.657) (-541.534) * (-539.835) (-541.690) (-538.007) [-538.530] -- 0:00:15

      Average standard deviation of split frequencies: 0.008529

      740500 -- (-538.300) [-539.545] (-540.411) (-539.446) * (-541.173) (-539.344) (-541.257) [-541.441] -- 0:00:15
      741000 -- (-538.071) [-537.774] (-539.662) (-538.298) * [-538.160] (-541.056) (-543.243) (-539.772) -- 0:00:15
      741500 -- [-539.046] (-540.660) (-540.656) (-539.500) * [-538.516] (-542.073) (-541.722) (-538.974) -- 0:00:15
      742000 -- (-539.303) [-539.453] (-540.061) (-539.125) * (-539.602) (-539.682) (-541.345) [-538.718] -- 0:00:15
      742500 -- (-540.113) (-540.231) [-539.598] (-538.768) * (-538.498) [-539.182] (-539.289) (-537.916) -- 0:00:15
      743000 -- [-537.964] (-543.439) (-538.296) (-542.247) * [-539.816] (-540.601) (-539.243) (-537.989) -- 0:00:15
      743500 -- (-539.704) (-538.228) [-539.556] (-540.357) * (-539.830) [-538.372] (-538.607) (-538.511) -- 0:00:15
      744000 -- (-538.186) [-539.247] (-537.979) (-540.523) * (-538.853) [-538.128] (-538.607) (-539.145) -- 0:00:15
      744500 -- (-538.886) [-541.263] (-542.032) (-540.105) * (-541.907) (-538.619) (-538.345) [-540.242] -- 0:00:15
      745000 -- (-540.882) [-542.293] (-542.142) (-542.173) * [-540.620] (-540.992) (-544.064) (-539.485) -- 0:00:15

      Average standard deviation of split frequencies: 0.008762

      745500 -- (-540.610) [-539.017] (-544.474) (-539.287) * [-539.656] (-539.693) (-539.490) (-539.130) -- 0:00:15
      746000 -- (-544.018) (-538.488) (-538.785) [-539.999] * (-542.364) (-547.279) [-539.002] (-540.378) -- 0:00:14
      746500 -- (-548.038) (-539.159) (-542.265) [-539.456] * (-544.759) (-545.510) (-538.409) [-542.228] -- 0:00:14
      747000 -- (-548.896) [-540.830] (-539.742) (-539.285) * (-541.919) [-541.878] (-538.616) (-541.596) -- 0:00:14
      747500 -- (-541.282) (-538.219) [-540.670] (-541.370) * (-538.950) [-541.454] (-538.329) (-539.734) -- 0:00:14
      748000 -- [-540.017] (-538.368) (-540.286) (-539.475) * [-538.380] (-539.897) (-542.284) (-540.065) -- 0:00:14
      748500 -- (-539.821) [-539.503] (-540.236) (-539.409) * (-543.136) (-538.130) [-547.588] (-539.669) -- 0:00:14
      749000 -- [-542.416] (-540.076) (-539.159) (-541.996) * [-544.221] (-538.542) (-543.897) (-539.620) -- 0:00:14
      749500 -- [-541.267] (-541.649) (-541.626) (-541.747) * [-540.743] (-540.219) (-541.806) (-538.825) -- 0:00:14
      750000 -- (-540.935) (-541.297) (-539.663) [-539.532] * (-543.643) (-539.543) (-540.528) [-537.918] -- 0:00:14

      Average standard deviation of split frequencies: 0.008541

      750500 -- (-543.849) (-541.477) [-539.082] (-538.724) * (-541.773) [-540.892] (-540.507) (-538.477) -- 0:00:14
      751000 -- (-544.677) (-539.343) (-538.850) [-538.811] * (-538.771) (-539.312) (-539.077) [-539.194] -- 0:00:14
      751500 -- (-539.609) (-538.804) (-541.919) [-540.621] * (-541.168) (-539.740) (-539.368) [-540.169] -- 0:00:14
      752000 -- (-540.375) (-540.150) (-542.836) [-541.682] * (-541.621) (-538.834) [-539.809] (-539.345) -- 0:00:14
      752500 -- (-549.358) (-539.467) [-538.433] (-541.083) * (-541.343) [-538.275] (-540.866) (-541.568) -- 0:00:14
      753000 -- (-544.925) [-539.740] (-541.231) (-539.664) * (-540.419) (-545.366) [-540.753] (-545.579) -- 0:00:14
      753500 -- [-538.883] (-540.443) (-539.819) (-539.429) * (-540.806) (-538.812) (-538.161) [-544.663] -- 0:00:14
      754000 -- (-538.777) (-538.437) (-539.419) [-539.504] * (-539.860) (-538.924) [-538.064] (-546.363) -- 0:00:14
      754500 -- (-540.211) (-540.110) (-540.649) [-539.185] * [-539.125] (-538.389) (-545.181) (-541.209) -- 0:00:14
      755000 -- (-539.226) [-540.637] (-542.650) (-539.560) * (-540.098) (-541.781) [-541.542] (-540.417) -- 0:00:14

      Average standard deviation of split frequencies: 0.008854

      755500 -- (-540.881) (-538.469) [-541.174] (-542.876) * [-538.576] (-540.730) (-540.657) (-539.632) -- 0:00:14
      756000 -- [-540.009] (-539.357) (-539.764) (-539.972) * (-538.720) [-540.964] (-540.121) (-539.869) -- 0:00:14
      756500 -- (-541.611) [-538.167] (-539.479) (-541.311) * [-538.233] (-539.773) (-541.169) (-540.062) -- 0:00:14
      757000 -- (-543.279) (-546.732) [-541.753] (-540.066) * (-539.570) [-542.348] (-541.970) (-540.922) -- 0:00:14
      757500 -- [-540.864] (-540.234) (-538.947) (-539.592) * (-538.597) [-543.011] (-539.350) (-539.589) -- 0:00:14
      758000 -- (-540.158) [-540.025] (-540.913) (-539.797) * [-539.504] (-541.479) (-541.030) (-539.664) -- 0:00:14
      758500 -- (-538.300) (-541.316) (-538.964) [-539.458] * (-540.036) (-543.113) [-541.106] (-540.388) -- 0:00:14
      759000 -- [-539.712] (-540.031) (-542.492) (-543.131) * [-541.914] (-538.294) (-538.592) (-541.420) -- 0:00:14
      759500 -- (-539.510) [-543.477] (-540.946) (-542.105) * [-539.710] (-539.865) (-540.848) (-540.338) -- 0:00:14
      760000 -- (-539.163) (-540.286) (-542.706) [-537.965] * (-540.094) (-539.622) (-542.175) [-540.259] -- 0:00:14

      Average standard deviation of split frequencies: 0.008470

      760500 -- (-539.724) (-542.233) [-540.291] (-539.767) * (-539.726) [-538.537] (-540.579) (-538.946) -- 0:00:14
      761000 -- (-539.298) (-539.689) [-541.754] (-539.916) * (-542.422) (-538.695) [-538.494] (-539.770) -- 0:00:14
      761500 -- [-542.706] (-542.775) (-538.705) (-539.939) * (-539.039) (-538.644) (-540.728) [-539.276] -- 0:00:14
      762000 -- [-541.382] (-541.543) (-543.002) (-539.749) * (-542.099) (-541.613) (-547.579) [-538.617] -- 0:00:14
      762500 -- [-539.675] (-538.775) (-546.140) (-540.104) * (-540.840) (-540.879) [-538.806] (-540.139) -- 0:00:14
      763000 -- [-539.189] (-540.283) (-542.921) (-539.133) * (-539.900) (-539.560) [-539.600] (-539.713) -- 0:00:13
      763500 -- [-538.778] (-540.268) (-538.665) (-539.581) * (-538.576) (-541.102) [-539.965] (-538.918) -- 0:00:13
      764000 -- (-541.092) (-538.612) (-540.163) [-538.295] * [-540.102] (-540.870) (-540.309) (-540.378) -- 0:00:13
      764500 -- (-539.883) (-542.005) [-540.158] (-539.749) * [-538.195] (-540.248) (-544.570) (-541.897) -- 0:00:13
      765000 -- (-541.199) (-542.130) [-540.317] (-540.758) * (-539.900) (-539.705) (-538.386) [-540.744] -- 0:00:13

      Average standard deviation of split frequencies: 0.008193

      765500 -- [-539.831] (-540.665) (-540.113) (-540.238) * (-540.673) (-541.084) [-538.352] (-540.152) -- 0:00:13
      766000 -- (-541.001) (-546.312) [-539.127] (-539.034) * (-538.366) (-542.134) (-540.832) [-543.408] -- 0:00:13
      766500 -- [-539.234] (-542.670) (-540.219) (-540.095) * (-539.482) [-543.143] (-540.254) (-539.672) -- 0:00:13
      767000 -- (-540.091) [-543.900] (-542.726) (-539.666) * [-541.665] (-541.888) (-539.447) (-540.574) -- 0:00:13
      767500 -- [-539.321] (-540.631) (-544.541) (-538.850) * [-540.723] (-538.326) (-539.838) (-538.934) -- 0:00:13
      768000 -- [-539.548] (-542.698) (-540.552) (-538.786) * (-541.059) (-543.851) (-541.242) [-539.253] -- 0:00:13
      768500 -- [-538.109] (-540.282) (-542.544) (-540.865) * (-539.609) [-541.539] (-538.556) (-538.435) -- 0:00:13
      769000 -- (-538.148) (-540.136) [-541.270] (-539.575) * (-538.459) (-539.513) (-543.490) [-539.450] -- 0:00:13
      769500 -- (-539.344) (-539.775) [-540.214] (-541.571) * (-541.764) (-541.047) [-543.018] (-539.268) -- 0:00:13
      770000 -- (-542.668) (-539.031) (-541.050) [-541.292] * (-539.980) (-543.707) (-539.740) [-540.923] -- 0:00:13

      Average standard deviation of split frequencies: 0.007531

      770500 -- (-538.682) (-538.925) [-541.419] (-540.643) * (-540.313) (-541.666) (-540.376) [-539.457] -- 0:00:13
      771000 -- (-538.988) (-537.782) [-539.104] (-539.509) * [-539.096] (-539.759) (-539.749) (-540.830) -- 0:00:13
      771500 -- [-538.600] (-540.937) (-538.146) (-539.610) * (-539.151) (-538.458) [-538.978] (-538.214) -- 0:00:13
      772000 -- [-540.784] (-540.105) (-540.531) (-541.254) * [-539.038] (-540.063) (-541.746) (-539.146) -- 0:00:13
      772500 -- [-540.137] (-539.493) (-540.780) (-544.409) * (-540.832) [-539.937] (-539.185) (-537.959) -- 0:00:13
      773000 -- (-542.992) (-540.555) (-539.511) [-543.536] * (-545.217) [-539.635] (-538.378) (-540.190) -- 0:00:13
      773500 -- [-538.046] (-540.183) (-541.050) (-542.286) * [-539.388] (-541.692) (-540.094) (-542.163) -- 0:00:13
      774000 -- [-539.049] (-539.197) (-539.832) (-540.229) * (-540.784) (-539.898) (-539.441) [-541.008] -- 0:00:13
      774500 -- (-538.369) (-540.838) [-539.802] (-544.192) * (-539.801) (-540.928) (-539.843) [-543.216] -- 0:00:13
      775000 -- (-539.491) [-538.565] (-539.593) (-539.119) * (-539.429) [-540.246] (-537.913) (-539.973) -- 0:00:13

      Average standard deviation of split frequencies: 0.007707

      775500 -- (-537.887) (-542.517) [-541.811] (-539.775) * [-539.150] (-539.505) (-539.053) (-540.996) -- 0:00:13
      776000 -- (-538.265) (-540.335) [-545.529] (-541.225) * (-541.011) (-542.669) (-538.623) [-538.270] -- 0:00:13
      776500 -- [-541.213] (-539.812) (-545.915) (-541.256) * [-538.550] (-538.748) (-538.879) (-540.263) -- 0:00:13
      777000 -- (-538.746) (-537.962) (-540.789) [-539.931] * (-542.371) [-539.383] (-553.434) (-539.709) -- 0:00:13
      777500 -- (-538.767) (-539.900) [-538.103] (-542.005) * (-539.067) (-541.245) (-544.288) [-539.205] -- 0:00:13
      778000 -- (-540.254) (-538.675) [-539.058] (-540.775) * [-538.363] (-539.745) (-542.983) (-537.769) -- 0:00:13
      778500 -- (-540.374) (-539.689) [-538.471] (-539.450) * (-538.329) (-539.967) (-538.449) [-538.772] -- 0:00:13
      779000 -- (-538.157) [-539.533] (-538.629) (-540.155) * (-538.989) [-539.189] (-539.426) (-539.789) -- 0:00:13
      779500 -- (-539.405) (-543.115) (-542.513) [-538.973] * (-538.857) (-540.961) (-539.504) [-542.053] -- 0:00:13
      780000 -- (-539.057) (-539.374) (-545.506) [-540.709] * (-544.130) [-540.582] (-539.408) (-543.343) -- 0:00:12

      Average standard deviation of split frequencies: 0.007850

      780500 -- (-540.692) [-539.821] (-540.047) (-543.237) * (-541.046) [-541.800] (-541.246) (-538.870) -- 0:00:12
      781000 -- (-539.777) (-539.778) (-539.924) [-540.981] * [-539.664] (-538.852) (-541